Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001502 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001502
Unique NameTCONS_00001502
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3823

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001502 ID=TCONS_00001502|Name=TCONS_00001502|organism=Clytia hemisphaerica|type=transcript|length=3823bp
CTAatacaaaaatatattaaaaagatAAATGTACAAATATCTGTGGCTAT
CTTTATTGGAATGAATGATATGTATCTTTAGTTGGGAATACTGCATAAAC
AATTGGATTTGAAGCTGCATCTCACGACAAGaaACGAACTGCATAGACTA
TGGAGGTCAATGATTCAAATGCCTCCTCAGAAACACCAATCACTCCAGAG
GAAACCTCTCCATCAGAGATAACCCCTCCATCAAAGGAAACCCCACCATC
GGAGGAAACCCTAGTATCTGAAGCGTCAAAGGAGGAAGAAACCCAGATAC
AATTTTTAGTGGAAACTGAAGCTAACCAGCAATCCTCTGAAGAAGTAACT
GCTAGCTTGGTAACAACAACTATTGATTTATCAGGAATTGCTCCAGAGGA
ATCACAAACTACACAAGATGGATCAAGTTCGGAGCACAATTCTCAAACGA
ACGTATCACAGTCTGATGAGATTGAAATAGCCGTTGCTATGGTCCACGGT
GGTGTAAATGAATCCTCCACTCCTAACGGAGACGTGACAGCGTTACAGCA
GAACGTCGTTAATGATAAGGCAACGGCTGCCGAAGACACCTTTGATGATA
CGGATTGTACGTATGTTGTTGCGAGGACGCACAGCGAGTTACGTGAAGCT
ATCCGTCTGCACGCTGAGGCTACGGGAGCTCAATTTTGTATGTCTAAACG
AACGAAGGGCTTCGGAAATGAAAAATTAACAGAGGTTCAACTGAAAGGCC
ATGACATTCGATGGAACGATCCTGTCAAAATGCGAAATGCAAAAATTCGT
CATGAGTTCTTCAACTTTAATGGTGTCCCTTTCATGAGTATTGCCAACAT
GGCGATGAATTGTCAATTCGGACACGGCGAAAGTGAACAAGTCTATCTAA
AAAGAACAGCTAAAAGGTTGGCGAAAGACGTCAAAAGGCGCTCACATAAA
ACGCCCTCTAAGAAATGTGGATGTCCAGCTGGTATTTGGGTTCGACAGGT
CATCAAGTTCCCCCAATTCTTCATGAAGAAAGACACTGAATACAAGCGAA
GAGAAATGGTACGTAAAATCAAACTTGCGTTGAAAGAAAACTTGGAGTCA
GTGGAAGCAGAATTTTATTATATCGGAAGGCTACCTGGTGTATCAAGACA
TCGCAATCATGAAATGCTCAAGGGAAAAGAAAGATCGAGAGAGCTCTTAC
ACAAAGAGTTACGTATCATGGCACAAGAGATGACTTTTAGTAATTTTCGC
ATCAAACACATTCAAGAGAAGATCAATAATCATGTCATAAACAACTGGTT
CTACGGTCAAACACCGCCCTCGAGTGATAGCACCAAATATTTTCCACGTG
GTGGCGTGATCAGGTCCACCCGCGAACGCCTCTTCAAAATGTGTTTTTTC
AGTGACGAAGAACTGTTGAAGCTAGACGAAATAATAGAGAAGCTAAAAGC
CGACAACCCGACGGATAACATCTGGATGGAGGTCAAGCACGTCCGACAAC
AAGACGACGAAGATGATATTTACTTAGATGCTGAGGATCTGAATCTTGAA
GATACGGAAGAAACACCAAACAAGAAATTGAAGAATGATAAAAAGATGAA
TCACCACCAGTTCCACACTTTCAATTTCGTCTACCAAAACACGTGGCAAC
AACGCATGTTACATCGGTACGGTCGTATTGTATTCATCACCGAAGTCAAA
CATAACAAAAGCGCCGTGCGTGCTTTGACCTTCAAAACTTATTTACTCAT
GGTGCAAACGAACGTAGATTTCCAAGTGGTTGGTGTGATCATGCATAGTA
AGATTAAAGGAGGGACGTCTCTTAGTGAATGTTTGGAGCGCTTCAAGAGT
TTCAGTCTTCAATGGGTACCAAAGTATTTCTTTGTTGATGTCAGTGAACC
TATCTTCTCATCCATCGAAAGCGCTTTCCCAGATGCTGAATATTTTCTGG
GACCGGCACAATGTCGTGACAAATGGATTTCTTTCCTCGAAACACCGAGC
AACGAGTTGAAGGATCATTcggaagaaattttgacataTTTGGATCAAAT
GCAGAAATCTTATACCAAAGATATTTTGACTGCTTGTGCGACTGTGGTGG
AGGCTAGTGAGGTATGGAAAGAATCGGCTGTTCTCAGAGAATGGTTTCAA
ACAGTATGGCTACCGCTTGCCAAGcGATGGGTTAGCACGTACCGACCGGA
AGACATTATTGTATTGGAACACGGACAAGATACTTTTGATGACATCGTGA
GAACGTATTCTGAACGTATCTCTAACAGTACGTTGCCACAAATGCAACTA
GGATTCTTTGCGTTATTGGAACGTATCGCTAGCCCCGAGACAACAAAGAA
ACAAACGGATAGGTACTTTTACTTGAACAAGGCGCTTCATACCGAATGTC
GTCACCTAGAATCGGCAATGCAAATTGAAGAAATAATTGGCATACCTCTT
CGACTGATGCCGACGTTCCGCAAATTGAAGATCTTGTACGATGAAAGCGA
TTTCTCGCAAATCGAAGAACAACAAACGGGTGTTTTCAAAGTAGTTGAAA
AATCAGAAGATTTGTTATTGGAAGAGTTGGTTAGTTTTGGTGGAAACGTC
ACTTTCCCATCATGCACTTGTGCATTATGGCATCAAGCCAATCTGCCATG
CGTTCACATGTATGCTGTTTTTCGATCGCAGACCATGTGGAAATACGATT
CGTTAAGCGCTTTATATCGCATCAATCCTCTATTGGATTTCGATTATTCG
TGTATCGATGCAGATAGTTTCTCGAAGAATAATGGTAAAACGATTCACGT
GCACCACCTGTTCCCTGAGTCTAAACCCACcgatgaagaagaagaggaaG
AGGATGAGCCACTTGCggttttattgaaaaatcaaaacaagtcaGTTTTC
AAAGAGTCCAGTAAGATTCCTGAAAGCTATCTTGGGAAATTGAAAGAACT
GAAAACTCAATTGTTCGCTGTACGCCATGCGTTTACTGATGCGTCATATC
AAAAACACCTGCAAGCAGATCTCCTAGTTTTGATCAATCAGCTCGAAAAA
CTTGACCAACCAGATCAGGACGATGCATTTGGACCGTTACTCGCAAAGaa
aaaaacgaataataagAACACTAGTAATACGAAAACAACAGCAGCGGAGA
AGACCAAAGCGACAGTTGATAACAAGGAGAATAGTCTACGTCAAACACCC
ATTGAATACGTCTCTATGGCTTCGTTTAAAAAACCGGGAGATGCTGCTAA
CATTTCGACGCCTGCAAAGGTTTCCAGCTCCATATCTGCAAAGAAGACTA
CACCTTCACCGAGTACGCAACAAACTACAAAACCAATCTCTATTTCAGCA
GTAGTTTCAAGAAAGACATCAAACGCAAAAACAAAAGCCAGTAAACGCCC
GAACACCAAACCGACGAAACAAACATTAACTTCGGCACCTGTAGTTCCGG
CAAAGTCAATCAAGCTTGCGATTTCTGATGACAAAAAAGATGATAAtaca
gaaacaaagaaaattgtcaAAGTCTTGAAAAAAGCTGTAAAAGATGTTCC
GCCCGAACATATAGAAATTGAATACCCGGATAACAAGGACAGTGAATCTT
GAGACTCTTaacactttttcttttcctttttcgatTTTAACCCAAAGCTT
GAAATTTATCTTTCTCGATTTGTACATTTTAGCATATTATTAGTTAGTAT
TTATTCGTATCCATTTTACGTCAATTTTCAtggttttgaaatttcatata
gattttttgactgttttttatcattcttttgACGATAATTATATTGAAAT
TATGATTAATTGTGATCAAAATT
Run BLAST on NCBI

protein sequence of TCONS_00001502-protein

>TCONS_00001502-protein ID=TCONS_00001502-protein|Name=TCONS_00001502-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1150bp
MEVNDSNASSETPITPEETSPSEITPPSKETPPSEETLVSEASKEEETQI
QFLVETEANQQSSEEVTASLVTTTIDLSGIAPEESQTTQDGSSSEHNSQT
NVSQSDEIEIAVAMVHGGVNESSTPNGDVTALQQNVVNDKATAAEDTFDD
TDCTYVVARTHSELREAIRLHAEATGAQFCMSKRTKGFGNEKLTEVQLKG
HDIRWNDPVKMRNAKIRHEFFNFNGVPFMSIANMAMNCQFGHGESEQVYL
KRTAKRLAKDVKRRSHKTPSKKCGCPAGIWVRQVIKFPQFFMKKDTEYKR
REMVRKIKLALKENLESVEAEFYYIGRLPGVSRHRNHEMLKGKERSRELL
HKELRIMAQEMTFSNFRIKHIQEKINNHVINNWFYGQTPPSSDSTKYFPR
GGVIRSTRERLFKMCFFSDEELLKLDEIIEKLKADNPTDNIWMEVKHVRQ
QDDEDDIYLDAEDLNLEDTEETPNKKLKNDKKMNHHQFHTFNFVYQNTWQ
QRMLHRYGRIVFITEVKHNKSAVRALTFKTYLLMVQTNVDFQVVGVIMHS
KIKGGTSLSECLERFKSFSLQWVPKYFFVDVSEPIFSSIESAFPDAEYFL
GPAQCRDKWISFLETPSNELKDHSEEILTYLDQMQKSYTKDILTACATVV
EASEVWKESAVLREWFQTVWLPLAKRWVSTYRPEDIIVLEHGQDTFDDIV
RTYSERISNSTLPQMQLGFFALLERIASPETTKKQTDRYFYLNKALHTEC
RHLESAMQIEEIIGIPLRLMPTFRKLKILYDESDFSQIEEQQTGVFKVVE
KSEDLLLEELVSFGGNVTFPSCTCALWHQANLPCVHMYAVFRSQTMWKYD
SLSALYRINPLLDFDYSCIDADSFSKNNGKTIHVHHLFPESKPTDEEEEE
EDEPLAVLLKNQNKSVFKESSKIPESYLGKLKELKTQLFAVRHAFTDASY
QKHLQADLLVLINQLEKLDQPDQDDAFGPLLAKKKTNNKNTSNTKTTAAE
KTKATVDNKENSLRQTPIEYVSMASFKKPGDAANISTPAKVSSSISAKKT
TPSPSTQQTTKPISISAVVSRKTSNAKTKASKRPNTKPTKQTLTSAPVVP
AKSIKLAISDDKKDDNTETKKIVKVLKKAVKDVPPEHIEIEYPDNKDSES
Run BLAST on NCBI

transcript from alignment at sc0000010:811061..828722-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001502 ID=TCONS_00001502|Name=TCONS_00001502|organism=Clytia hemisphaerica|type=transcript|length=17662bp|location=Sequence derived from alignment at sc0000010:811061..828722- (Clytia hemisphaerica)
CTAATACAAAAATATATTAAAAAGATAAATGTACAAATATCTGTGGCTAT CTTTATTGGAATGAATGATATGTATCTTTAGTTGGGAATACTGCATAAAC AATTGGATTTGAAGCTGCATCTCACGACAAGGTATGTCTTTTTCCTTACC AGTATTCTCACATGTCGATCACGCTGTGAGTTCACGTTATTAGTGTAAAA TGGAATTTACAAATCAAATTGTTAATTATCAACGTATGAAAAATAATGTC TTTTTACTAAGACATACAGGGTGTCCCTAATAAAAGTATCGAGTTTGAAC TTGCGATTGAGTAAAAAAGTTTGTGTGTGTTATCGCTAAAATATAAGAAC GTTCTCCATCACATAGGCTCATTACAAAAGGTAGTTACAACGTATAAATT AATCAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAGAGGGAGAGCTTAAAAT ACAATTTTGTGAATACACACTTAAAACTTTCTACTCAATCGCATGTTCAA ACTCGATACTTTTATTAGGGACACCCTGTACTATGCGATCATCAGATTTC GTAAAGAATGCCATTAGAGCGACTACCAGTGCACAAATATATACAAACCA TCCAATGATATAAGACAAGCCCTATTCATCAGAAGTATAACTGATAGCAA CCAAAGCGATACTCATACAAACAACTGCTCCCAAAAATGCCAACGACACT AATCTGCCATCGAAATTTTAAATAGTAAAAGCGAACACTTGAAATATATA ATCCCAGTTGCCAGTAAGGTGAAAGTGATCAATGCACACGATAACAATTT AATCTTTCGATGTGTAATACAACATCTCCTATGACTTAAACCTCAGTAAC TCGGATAGATCACGGAAATATCCTATGAACTATAATGTGAATGGGCTGTG AGTGTTCACAGAGTCGATTTACTTGGATAGTGCAGTAATCTTACACCACT TGGCCATCGCTCCTTCAAAGGTTTGAGCAACTACTTTTCCTTTTTTTCAG AAACGAACTGCATAGACTATGGAGGTCAATGATTCAAATGCCTCCTCAGA AACACCAATCACTCCAGAGGAAACCTCTCCATCAGAGATAACCCCTCCAT CAAAGGAAACCCCACCATCGGAGGAAACCCTAGTATCTGAAGCGTCAAAG GAGGAAGAAACCCAGATACAATTTTTAGTGGAAACTGAAGCTAACCAGCA ATCCTCTGAAGAAGTAACTGCTAGCTTGGTAACAACAACTATTGATTTAT CAGGAATTGCTCCAGAGGAATCACAAACTACACAAGATGGATCAAGTTCG GAGCACAATTCTCAAACGAACGTATCACAGTCTGATGAGATTGAAATAGC CGTTGCTATGGTCCACGGTGGTGTAAATGAATCCTCCACTCCTAACGGAG ACGTGACAGCGTTACAGCAGAACGTCGTTAATGATAAGGCAACGGCTGCC GAAGACACCTTTGATGATACGGATTGTACGTATGTTGTTGCGAGGACGCA CAGCGAGTTACGTGAAGCTATCCGTCTGCACGCTGAGGCTACGGGAGCTC AATTTTGTATGTCTAAACGAACGAAGGGCTTCGGAAATGAAAGTAAGCTA TATTTTTGTATGCTCTTAACGTTGTGTTCCTTATTTATAATTTCATCGTA TATCTAAAGACGTTTTCATGGATTTCACCATGACCAACGCTTACCTATTG TTTTCAAAATATTGCTCTGGTAATTGATTCTCAGAGGAGTTCATAAGAAG CCCGGAATTCCCGAGTTATTTTTTCCGAGTTAAAAAAACCGGGATAACTC GGTTTTTTCTTAACTCGGTTTTTTTAACTCGGAAAAAATAACTCGGGAAT TCCGGGCCTCAGTTCATAAGAAGTTTGCTTATAAAAGTAACACTCGAAGG ATTTAATCACCTTGGTAATGGTTTTCCACTTACGATTCCCGCTTAGTAGG TTCCCACTTAGGTTCCCAGGTTCCCCTATCCCACTTTTCCGGTATGCTGA CTATTATATATGGTTGTATGATAAAACGAGGCCAATTTAATTTGTTGTTT TATGGGCCAAGCTACCCAAAAAAGAGAGTCGGTCGGCAAAAAAATTAGAA TAAGAAGTAGAATTTAACCTATAAAATCTCCTAAAAAGGCAGCAAAAACT ACTACATCTTGACAAAAAAGCAAAATAGAAAATAAAAAGGTAGAAGGAAT GTATAAAATGAAAAATTGAACATAAAATTCTCAAAGCATGGGAAAAACTA CCAAAATTTTGAATTTTTTTATGCTTGTCGGTCGGGCCCGTAAAGCAACC AATCACACAATTTAATTTGTTGTTCTACGGACAGATCGTTAGAAAAATAT GGGTCGGTCGGTCGGCAAAATAAGAATAAATTTTTCATTTATCAGGGTTG GTAAAGTACCGAGAAAAAATTGGTCTCGCCTAAGGAAAAGAAACTAAATA TTATTATTATTTTTCCTTGGCAGAATTAACAGAGGTTCAACTGAAAGGCC ATGACATTCGATGGAACGATCCTGTCAAAATGCGAAATGCAAAAATTCGT CATGAGTTCTTCAACTTTAATGGTGTCCCTTTCATGAGTATTGCCAACAT GGCGATGAATTGTCAATTCGGACACGGCGAAAGTGAACAAGTCTATCTAA AAAGAACAGCTAAAAGGGTGTGTATTCTACTTGTTTTAACCTCCCCCTTT TAAACCTTGGCCTTTGAAAACAAGGGGTTTTTATTACTTTCATGGTCTTC TTGAGTTTCATGGTTTTTTGGATGATCATAATTCCGGACATACAAGACAA ACAGCCTAAAAATGTGTTACAGTGAATATCTGGGCGAAAGAAGTATCGGA AAATTACGATATAGGGTTTTTAATTCTACATCGGTCATTTGATACCAAGT CTGAATTCTTTCAGATGAGCACCATATTTGAAATTTAAAATTCGGTTATT TAGCGTAACTAAGATCGTTAGTTTGAAATTATAATAGTTATCTTCATTTT CTCTACGCAGTTGGCGAAAGACGTCAAAAGGCGCTCACATAAAACGCCCT CTAAGAAATGTGGATGTCCAGCTGGTATTTGGGTTCGACAGGTCATCAAG TTCCCCCAATTCTTCGTAAGTTTGAAAATTTATTTCGCTTTTTTGGACCT ACCTGGAGGTCTATAAATTAACCCGTGTACGTTCGTTCGTTAGTAAGTTA CCAATTTTGCTTGTGATTGACTGTTCAATTTTTCTGACTTTTTGCACAAA GATGTGTCATCATAAACCCTCCAATGTGACGATTGGTTCGTTTCCTGGAT TATCTCAAATTCTATCCTTAGTTCTTTCTGGTGTCTTGTTTATTTTTCTG TTGATTAACCAGGTTAGGTCAATATATAAGTATCACCTGTTATGTCTCTG TTACTTTGATAACACGCGTAATTAAAAATCAATCAACTTTTATAACATGT AATATTTTCAAAATATTCTGAAATCTTGGCTTTGATTCTATTTCCCAAGA ACCAACATCATTAAACCTCAAAGTAAAACGTTTTTTTTTTGGAGGCTATG ATATGATATGACACGAGTACTCAGTAAGTGATAGGGTGATTAAATACTAA TAACAATGGTGAGAGGTTGGCAATTCATGATATGCACCACTGAGAGTCTT CTGAAAACTTTTTCCACCCAATACGTCACTTTTTCTATTGTTTAAGTGAC GTATCGGGTGGAAATTTTTAAAAGCTCTTGGAAGGCTCTCCTGTGTTGCA TATCATGAATATGCAGTGGCATTTTGTCGGCTCACATCTACATTCCTTTC TCATTGACCAAGCATTGCTTCCGTTTAATTATCACAGAGGACACTTTTTA GCATCGGTTCACTTAAATTTAAATTTTGGGAGAGTATTAAAATAATGACA CATTCATGTTATTATATTGTTGAGCTCCTTTTGTTCCGTTAGAAATTGAA ATTCAAAATTTATAAATCTTGGAAACAGAAAATAATTTGAAGTGATCAAA GTGATCATAAAAAGTTAGTAAGAAAGAAGAAACAAAGAAAAGTTTCAGAA GGCTGAAAGAGTTCCAATTAAAAAGGCTGAAAGAGAAAGTTTAGCAAAGA AGATTTTTAAAATACATTACAAATATTGTCGGTTTTGAGTTAAAAAATCC ATTAAAAATGCGCTACTGATAATTTAGTTTTTGTAGTGTGGATCGTAGGG GTTTTTGCCTTCTGGTTCGGTCTTGTATTTTCCTTCATACAAACAAGCGT TCCATTTCTCGTTGAATTGTAATCCTTTTGGACAAGCGATGCATCCGACA GTTTGTCCGTGGAAGCAAGCGACGTATTGGTGTGGGTTGTGATCGTCTTC AATGTTTCCACTGAAGTGTGGTCCACGGGCTGGGCATTTGTCTGGGCATT CGAAGGTGGTGGCTGGTTCCCATGGTTTTGTGGTGACACAGTCGTCGTTT TTGTTGTACAAGCATTGGTTGCATCCTTCGCTGAATTCCAAAGACAATGG CCAGCAGGCTTGACAGTAAGCTAATCCGTTGGAGCATTGGACAAAGTAGT TACGTCTGTATTGGCCATAGTAGTAGTATTCGAAGTTTCCGTCAGGTTTG CCTTTGCACAAGGAGTCTGGGCATGGGACAGCTGGTGGTGTTGTTCCAGT TACTTTGGTAACTTCCAAAGCATAGGATGCTGGAAGAGATGAAAACTGTT CAGAACTGTTTCTTAAAAAAGACTATACAGAGACTCTACAATAATAATTT GAAGTTTAAGAATGTTTTTCACAAAAAAAAGAAATGTTTTTTTTTGTAGA GAAACTTACCAGCGACGAGAGCGAGGAGAATGAAAACCTTCATGTTGTTG AATTGAGAGATCAGATTATCTTTGAAGAAATTGATGATAAATCTCTGGTG AAGATGAGCTTTTATACTGTTCTGGTCGTTTGGAAGATTTCCTGTTTTCA AAGGAACATGTTACATAATTGGTGAACCCCTGTTGTCGAATTGTTTGACA AATCTTTTAATTGAGATTTCCCTTCAAAACAACATTCCTTAGTAAAGGAT AATAGTATTATATTGGGACCGAGCAGAAATTATACCGCTGAAAGTATTTT TAGGAAACAGAATCAACGGAGACATGAAGGTAATGATATAACATCCTCCC TCAATTAAGAATCTACCTCTATTTTTACAAGATAATTGCGTGGTAATTAA TTACCATGTTTTGTTAAAACGTCTGCTTTATTTACCGCCATATTATATTG TTTGGATTTTTTTGTATGTCCAATATTCGTGGTTCCTGAATTCCTTAGTT TAGAAAGTAAGGTGTTTTTTTCTCGTTAGAACCAGACAAGGAGCCTTTTT ATTAATATTTAGTGCTTAATTGTATGGGGAGGATCACTTTGCAAAAGAGT TACCTCAATAGCATTTTAAAAAATTTTCCTGAAAAAATGTCAAATCGTAA TCAAGAAAATTTCCCCACACAATCACTTGATGATAATAATTTGAATATTT TTACAGGTTTTTGAAACCCGTCCAAGGGTCGATATTCAAAACTTCAATTT GGTACCTTGCAATACTTTAATGGGATAAACTTTCGCAGATATTAAATTTC GTGGATTTGGGTGTCATCTGCGAAAATCCGCAAAATTAAGTCCTAATGGA AATTTGGAAGGGCCTCATCCGCGAAATTAAGTACCCGCAAAAAATTTGAA ATCTTTCTTCGATCTGCGAAAATTTTAAATTTCTATGCATGCTATTACGA GTTTTGATTTGCCATTTTTGCTAGGTTTCTTCTCATACTCTAACGAAAAA AGTAATCTTAAATATTTAGCCACTAAAGGTCTGCGAATCAGACTACTCAA ACCCTACTTTGAAGAAAATCTCTTCGTTATTTGATCAAAATTTTGAGAGA AGTTCTGTTTGCAAAATTTGGAATCACTTTAGAAAGATTGGATCAGAATC ACGATCCGCGAAATTACGCGTAAAATCAGGGAACTTCTCATCTGCGAAAT AATTAAGTCCCCGCCAAATTTTCAAATTTCGCGTATAGGCCCAACTGCGA AATTTTATCCTATTAAAGTAACAAAAAAAATGGAAATTACCTCAAAAAAG GGACCATGGTAACAAAATGATTGAGACTTTTGAAAGGGGAGGATGAATCT ATCCTTTTCTAGTTGCAGGAATGTATACTTCTCTCTATTTCCGAACTTTT AAAACAAGAATAATAATAATAATAAGGATTTTTCAAAGTTGAAAAGTTCG AATACCTAGTATTGTGAATAAAGGCATATCATCACCTTTCAATATAGCGG ATAACCCAGGGGGGGGTACAGACACAGGGTGTACTGACCCTTAGCCAGGT GGTGGTGTCTATTTTTGCATTTCACAAAAGTTAGTACCCGGTACTACTTT GGGGCTGGGGGTGTGTATTTTTCACTCTTCAAGCAAGTACAGGATACTAT TTGGGTACTTCTTCACAGAATTTTGCTGTTTTTCAATAAAAAAAGTAGTT TGTCGTAATATGTTGACTTTTTTCAAATATTAATTTTTTTGATTTGTATT TTTTTAATCAACAAATTTTTTTTACTCTTTTGAGAAATTTTTTGATTTTT TTGAAGACAAAACTTCCAAAATGGTCAAGAAGTGTGTGATGAAAATCAAA GGACAAAAGCTTCTGACCCCATCATTGATAGTTTGCTTGAATTATCTGTC AATTTTCAGTGTGAGAAACTAACAATAGTACCCCTCTCTTGGTCTAATCT GTAAAATTTAAGATTTTAGGGGTGGTGTCCCTATTTTTTACAGCAAAAAT GAAGTAGAACCCGGTGCTAAATATGGGTGGGTACTAAACAAAATTTTAGT AAAAAATCAAGTTAGTACCCTATGGGTTAGTACCCACCCCTGGATAACCT CGTTGAAAATATGATCCTACTTTTAAATTGAATAAGCAATTCTTTTCTGA AATATAAACATTTTCAATTGAAAATAAAAGCTGGATAATTCTTGGATTAT AAGAAAACATCATAACGGAGGCTTGCATACATCCAACAGGTTATCCTAAT TATCAGATTTGTCAAACAATTCGACAACAGGGGTTCACCAATTATGTAAC ATGTTCCTTTGAAAACAGGAAATCTTCCAAACGACCAGAACAGTATAAAA GCTCATCTTCACCAGAGATTTATCATCAATTTCTTCAAAGATATTCTGAT CTCTCAATTCATCAACATGAAGGTTTTCATTCTCCTCGCTCTCGTCGCTG GTAAGTTTCTTTGTTCAACAAAACATTTTTTTTTCTTAAACTTACTTCAA CTTCAAACTTTAAATTTATAGAGTCTCTCGTAGCCGCCTTTTCTCAAGAC AACACGATTTTCTTTCATTAAACGAAGACCCTTACATTTCCAGCATCCTA TGCTTTGGAAGTCACCAAAGTAACTGGAACAACACCTCCAGCTGTCCCAT GCCCAGACTCCTTGTGCAAAGGCAAAGCTGACGGAAATTTCGAATACTAC TACTATGGCCAATACAGACGTAACTACTTTGTCCAATGCTCCAACGGATT AGCTTACTGTCAAGCCTGCTGGCCATTGTCTTTGGAATNTGTGCAAAGGC AAACCTGACGGAAACTTCGAATACTACTACTATGGCCAATACAGACGTAA CTACTTTGTCCAATGCTCCAACGGATTAGCTTACTGTCAAGCCTGCTGGC CATTGTCTTTGGAATTCAGCGAAGGATGCAACCAATGCTTGTACAACAAA AACGACGACTGTGTCACCACAAAACCATGGGAACCAGCCACCACCTTCGA ATGCCCAGACAAATGCCCAGCCCGTGGACCACACTTCAGTGGAAACATTG AAGACGATCACAACCCCCATCAATACGTCGCTTGCTTCCACGGACAAACT GTCGGATGCATCGCTTGTCCAAAAGGATTACAATTCAACGAGAAATGGAA CGCTTGTTTGTATGAAGGAAAATACAAGACCGAACCAGAAGGCAAAAACC CCTACGATCCACACTACAAAAACTAAATTAGCATTAGCGCATTTTTAATG GATTTTTTTACTCAAAACCGACAATATTTGTAATGTATTTTAAAAATCTT CTTTGCTAAACTTTCTCTTTCAGCCTTTTTAATTGGAACTCTTTTAACCT CCTGGAACTTTTCTTTGTTTCTTCTTTCTTACTCTATTTTAATGACCACT TTGCTCACTTCAAATTATTTTCTGTTTCCAAGATTTGTAAATTTTGAATT TCAATTTCTAACTGAACAAAACGAACTGAACAATAAAATAACATGAATGT GTCCTTATTTTACTACTCACCCAAAATTTAAATTTAAGTACATTTAAGTG AACCGATGCTAAAAAGTGTCATGTGTGATAATGAAATGAAAACAATGGCA ATGATTGGTCAATGAGACAGGGATGTAAATTTGAGTCAACAAAACAAACC ACACTACAGAAACTAAACAGTATTTTAATTTTTAAAGAAACGTTGAAAAA TGAAAAAGAAAATCAATGACTGTAAAAAATATTTTGAATTCACCCTATCC TGCTACGTTTTGGGTGAATTTTGTTTACCATGAATTTAAATGAATTTAAA GAGTACACTTAAAAAATCCTATGCAATGACCACGACCCATAATTTTCCTT CTCACGAAGCTCACATGAGTTAAAGATTAATAGGGTGGAATTCATATACA CTGGAGTCTTATGAACTCGAACCTCTGTTACTCGAATGTCTCCTTGATTC GAAAAAGTTTTTCTTGTCCTTTTACGGTATTGTCCTTATGAATCAGTCTC CCCGACTCAAGAGTCACTCACGGAGTTCTCCGTGTTTTTCGAGTTGCAGA TTAAGGATTTTATTAAATTTTTATTCGATGGAAATCGACTTATCAAACGC TATGAAGACTGTCCTTTAACACTATTTCCGGCTTACATTAAAACTAAATT CCTACCTTATCGGCCAAAACTTAGTCGGCCCTAAGTGACTAAATTTTGGC TTGGTGACTAAAATTTGGACCGAATAAAAATTTTGGCTAAATTAAAAGTT TATAATTAAGTTTTCCTTATTTTCCAGTATTTTAAGCTTTCTCCTATTTT CCATCTGCTTTTAAATTTAGAAATGGCCAAAATTTTTAGTCGGCCCTTAG TGACTAAATTTTGACGAGGTGACTAAAATTAGGGCCGACTAATAATTAAG GCCGACTAAGTTTTGGCCGATAAGGTACCTTGTCGACAAGCGTGATCGAT TTCTGAGATTGAAACCATAAAAACTTAAAATATCGCAAAATTCTCCTTGA AGACCCTGGAATACCTTGCTCAAATGTCTGTGTCTGAATTGTTGGACCTA CCCCGGTGGAGGTCCTATAAATTAACCTGTGTTTGTTCGTCCGTTCGTGT TACCAACTTTTCTCAGGATTGAATCATAGGAATCTTTTGATTTTTGGTAC AAAGGTGTAAGATGGTGGTGGCCAAAATGTGACGGAGCCCGATTTTTGAA AATAAATTTTTTGGGCAAATTTGGGCCAAAAAACGGCTAAAAAACGAGTT TTTTGGACTTTGTGAAAAATTGGATCATTAATTTTTTCTGATTTTTTGCA TGAAAGTAGGTAAAAGATGGCTCAAGCCTGTTTTTGTAAAAAACGAATCA TTCAGCTCAAAAAACGCATGTTTACCTATAATAATCACTATTAATAAGCA TACATCAATGTTCTTAGCCAAATTACTCAATTTTTTGATGAGATAGATGT TTTTTTTGCTGTCTTGAATATGAAAGAATATTTCAAGAACATGAAATTTT GGTTTCTAAACATTTTTTTATAAGAAACAAACGACTAATTTTAAAAGATC GTCACTATTTGTGTTCTGAATGATTGTTTAATGGTCACGTCACGTAGATA TCAATTATAAATGTGTTAAATGCATAACTACCTGGTCCATAAAAGTATCA CTTGTTTCCCCTCTGACTACTTTTTTGGCTACTGCATTGAATGTTTGTAG TTGTATGTCCGACATTCGGGTGCCTGTATCATCAAATTTTTAAGTTTTGA AAATGAGGGGGTTTTTCCCTTCAAACCAAGCTTTTTTGGAAGGAGCCTCT TTATTTTGTCCTTAACTGTAATGGGAGAATCACTATGCAATTTTTCGTGA AGAGTCACCCCAATACCATTTAATGATAAACATCCCCCTCCTTTTATGAA ATTTACCTGAAAATAAAACCTTCATTATCCTCACGTTATTTAGAAAAATT ACTTGACAATAATGATTCGAATCTTTTAAATCAGGAAATACAGTTGATGC TCTCTAATTCGACTTTCTACTATTCGATAGGCTCTATTATTTGATGAGAT TTGAAGTCCCCGTCAACAAGAAACTCTCGTAAACGACGCTCCCTTATTTG ATAAGCTCCCTTATTCGTTGAAAATCCAATTCACCTTATGAAGATCGAAT TAGAGAGCGTCAACTGTAGTTTAAATCAACTTTTCCAAAACCCGTCCAAT GGTCGTCCATATTCAAAACTTCAATAAAGATCCCAATGTATCCCGATTTG TGTTGACCGATCAAAAATTATATACCTACTGGTAACAAAAATGGAAATCT TCCTCGAAAAAGGGGCCACTTTAACAAAATGATGGAGACCTTTGAAAGGG AATGGACGAAGCTTATATTTCTAGTTGCAGGAATGTTTACTTCTCCATAT TTCTAAACTTTCAAATCAAAAGGGAAGATCCCCCTATTTACAATCTATCT ACTATTTCTGAGGTAACTTAAGTGTGGTTTTTCACTGGTCAGCATTTTGA CAAACTCGATAGTTTCCAAAGATGAAAATTATGATTACCTATGGGAATTG GTATTTTTTTCCGCTTCGAAGAAAGGCATATCATTCCCCTTATAGTACTA TAACGTAGGCACTGTTGAAATATTCGTTCAAAAGAAGGCTGGATCATAAA ACGATTCTGATAATCCATTGAAAATATGATTTTGTTTAGCTGCTCAAAAA CTTGTAAATTGAATAACCAATTCTTTTTTGAAATAGAAACATTATCAATT GAAAGTAAAAAGCTGGATAATTCTCGGATTATAAGAAAAATCATAACGGA GGCTTGCATACATCCAACAGGTTATCCTAATTATCAGATTTGTCAAACAA TTCGACAACAGGGGCTCACCAATTATGTAACATGTTCCTTTGAAAAAAGG AAATCTCCCAAACGACCAGAACAGTATAAAAAGTCATCTTCGACAGAGAT TTATCACCAATTTCTTCAAAGATATTCTGATCTCTCAATTCATCAACATG AAGGTTTTCATTCTCCTCGCTCTCGTCGCTGGTAAGTTTCTTTGTTCAAC AAAACATTTATTTTTTCTTAAACTTACTTAAACTTCAAACTTTAAATTTA TAGAGTCTCTACATAGCCTTTTTTGTTGAGAAACCACATTTTTCTTTCAT TAAACGAACACTTTTACATTTCCAGCATCATATGCTTTGGAAGTCACCAA AGTAACTGGAACAACACCACCAGCTGTCCCATGCCCAGACTCCTTGTGCA AAGGCAAACCTGACGGAAACTTCGAATACTACTACTATGGCCAATACAGA CGTAACTACTTTGTCCAATGCTCCAACGGATTAGCTTACTGTCAAGCCTG CTGGCCATTGTCTTTGGAATTCAGTGAAGGATGCAACCAATGTTTGTACA GCAAACACGACGACTGTGTCACCACACAAAAATGGCACCCAGCCACCACC TTCGCTTGTCCAGACAAATGCCCAGCCCGTGGACCACACTTCAGTGGAAA CATTGAAGACCCACACAACCCACACCAATACATCGCTTGCTTCCACGGAC AAACTGTCGGATGTATCGCTTGTCCAAAAGGATTACAATTCAACGAGAAA TGGAACGCTTGTTTGTATGAAGGAAAATACAAGACCGAACCAGAAGGCAA AAACCCCTACGAACCACACTACAGACAATAAATTATCAGTTGCTTCTTTT TAAATTTTTTAATTGTAAAAGTGAAAGTAATTTCAATTTTTTATCGAAAT GTTGAAAAATGAAGAAAATCAATCATTGTAAAAAATATTTTGAATTCACT CTATCCTGCTCCGTTTTGGGTATATATTGTTTTACTATGATTTAAAAAAA AACTCCGACCCATATGTAAATTTCCTATAGCACAAGGTTACAAATTGATG GGATGAATCTCAAGAAATTTCATTTGACTATAAAGGAAAATCGGCCGATC AAATGCCAGGAAGAATTGTTATTTCTAGCTTTGGGTTTATTAAAACTAAC TAACGAATTGGCTAAACTAATTCACTATGATTTACGAAAAAAGAAATTGA AAAAACGGAACTTATCGTATTGGTATTCAGTAGCCCAGGACACAACGCAA TTTCAAAGTAAATATTCATATTCATGTATATTCATGTATACCTTTTTTAG GAAAATTTCTGGAAACTTTTGAACCTCAGTGGCACACACATATAGGTCGG TCGACAAGCGTGATTGCTTTCGAAATTGATACCATAAAAACGTGAATATT GCAAACTTCTAGTTCTAGTCCGAGATATGGCCCATTGATCTGTCTGTGCC TTATATATTATGTTTTCTTTCCCATCTGAATACTTTTTTGGCTACTTCAG TCAACTCTCTCTAGTTCGAATCTCCATTATTCGAATCTCTGAATTTCTGA AATTCGAATTAAAATATTGATCCCCTCAGCTTAATAGTGGTTTGAGTAAC TTGAATCTTTCTCTAATTCGAACAAAATTTTCGTCCTTGAAAATCGAATT AGAGAGTCAACTCTACTAAAATTAGTTTTTCTCAATACTTCTCCTTCTTG ACTTGTTTCAGATGAAGAAAGACACTGAATACAAGCGAAGAGAAATGGTA CGTAAAATCAAACTTGCGTTGAAAGAAAACTTGGAGTCAGTGGAAGCAGA ATTTTATTATATCGGAAGGCTACCTGGTGTATCAAGACATCGCAATCATG AAATGCTCAAGGTATGTAGCTTTCCTGTTATGAAAATGCCTTCTGAAGAT AAGCTTGATATATTTGATATGTTAAAGTTTGTCTAAACACAATACTCCAT CTCATCGGCGGAATATTAGTCGTAAATTTTTTGGAGCGAATTTTGGTCAC TTGTTGAAAATTCTGTCAAAGCTGCTCTGAAATTGCTCGGCAAATTTAAT AACCCACTATATTTTGGGCACATTCTCAGGTATGATGATACACTTTTGAA CAGACTGATGAAGCGACAAATTTGGCTACTGTTTTGCTAAGAATTTCCAT TACATTAAGGGGACTGGTAAAATGCCATTTTTACTGAAGATTCTCAAAAA ACCCCTTGGAATATGAAAATATTTCGGCAAAAAGTGGGTGTCAACCGCGA AAATTATGCAAATTATGCAAAATGCGCTAATTGAGTACCCTCGCACCGCG AAAATTAATTCCCATAAGATAGATCCGTTTACAACAGATGACAGTTCTGC AAAGGGTCTCATCGTGGAATTTTTCATCTACAACTTTCAGGGAAAAGAAA GATCGAGAGAGCTCTTACACAAAGAGTTACGTATCATGGCACAAGAGATG ACTTTTAGTAATTTTCGCATCAAACACATTCAAGAGAAGATCAATAATCA TGTCATAAACAACTGGTTCTACGGTCAAACACCGCCCTCGAGTGATAGCA CCAAATATTTTCCACGTGGTGGCGTGATCAGGTCCACCCGCGAACGCCTC TTCAAAATGTGTTTTTTCAGTGACGAAGAACTGTTGAAGCTAGACGAAAT AATAGAGAAGCTAAAAGCCGACAACCCGACGGATAACATCTGGATGGAGG TCAAGCACGTCCGACAACAAGACGACGAAGATGATATTTACTTAGATGCT GAGGATCTGAATCTTGAAGATACGGAAGAAACACCAAACAAGAAATTGAA GAATGATAAAAAGATGAATCACCACCAGTTCCACACTTTCAATTTCGTCT ACCAAAACACGTGGCAACAACGCATGTTACATCGGTACGGTCGTATTGTA TTCATCACCGAAGTCAAACATAACAAAAGCGCCGTGCGTGCTTTGACCTT CAAAACTTATTTACTCATGGTGCAAACGAACGTAGATTTCCAAGTGGTTG GTGTGATCATGCATAGTAAGATTAAAGGAGGGACGTCTCTTAGTGAATGT TTGGAGCGCTTCAAGAGTTTCAGTCTTCAATGGGTACCAAAGTATTTCTT TGTTGATGTCAGTGAACCTATCTTCTCATCCATCGAAAGCGCTTTCCCAG GTAAGATTATTTCCTCCATTCGTTGATCAGAAGTTTTCTTCCGGGTACTA AGACTTACGTTCCTTATAATCGAGCCAAGCTTATTATCCCCTAATTAGTT TTAAAAGGAGCTTTCTTCAGTGTTTTCAAATAAAATTCGATGTTTGAATT TCATTAACTTGCGGTTACACGATCGAATTTTAGCTGCATATTTGAANCGA TGTTTGAATTTCATTAACTTGCGGTTACACGATCGAATTTTACCTGCGTA TTTGAAGTGAAACTTGATTAACAAAAACGTTTTTAACCGTCTAATTTTTG GCTTTAGATGCTGAATATTTTCTGGGACCGGCACAATGTCGTGACAAATG GATTTCTTTCCTCGAAACACCGAGCAACGAGTTGAAGGATCATTCGGAAG AAATTTTGACATATTTGGATCAAATGCAGAAATCTTATACCAAAGATATT TTGACTGCTTGTGCGACTGTGGTGGAGGCTAGTGAGGTATGGAAAGAATC GGCTGTTCTCAGAGAATGGTTTCAAACAGTATGGCTACCGCTTGCCAAGG TATGAGTTTTGTTGTTTTGTTACACTAGAGATGTTTTGAGTGTTTTATAC TGTTACGTGACAACCTTTAACGCATCTCCTCTATTTACTCTTCTTACACA GCATTATAAAAATGAAGAAAGAACAACTTTTTCTGTCTTCCGCGTTTCAC AAACACAAATGTTAAGAAATTCTATTGTTCATTCTGCTTCGTCAGTAGGA TATTTCTAGCCTAAAATGGATATCTCGAACCTACCAGAGAACGGCATGTT TCTAAAATAAAGACTTAGAATTATATTCTTCGAAGTAATTTCGCTTAACG TCAGTAGACCCTGTCAAAGCAAGATGCAGAATCTCGTTCTTTATAAAGTC TGTCACTGAAGTATGTAAAAAAAAAAAAAAGTAGACAGAAAATGCAATCG GTAATCATTGTCTTTCAACCTTTCATATAAAAATAAAACAAACGGGTAAA TACGGAAATGTTTTATGTATGTTTTATGCATCAACTATATGATTGATTAT TTCCAAATCGGAATATCCAAATGGGAAACACACAAATCAACGATAATCAC TCTCTGTAATTTATCATTTTTTTCAGCGATGGGTTAGCACGTACCGACCG GAAGACATTATTGTATTGGAACACGGACAAGATACTTTTGATGACATCGT GAGAACGTATTCTGAACGTATCTCTAACAGTACGTTGCCACAAATGCAAC TAGGATTCTTTGCGTTATTGGAACGTATCGCTAGCCCCGAGACAACAAAG AAACAAACGGATAGGTAACAACGACTTTTTTTCCGATAAATGATTATATG TGTTTTTTGTCAATTACAGTTGACTCTCTAATTCGACGTTCTACTATTCG ATACACTCCTTTATTCGATGATATTGAAAGCCACTATCAATAAGAAAGAC TCATAACGACGTTCTACTATTCGATACGCTTCCTTATTCGATGAAAATCT TATTCCCTTTGAAAATCGATTTAGAGAGCGTCAACTTATGTTTTTGTAAA CGTTCGAAATTTCTTAAATTCTTTAAAACCACTCTAAAATTTGGTAATTT TATGATGCACATTCTAGTGTCGACCGGTGGTCCCTGTTTGGAGACTCAAT TATAAAAAATGTAATGCTAGGTTGTTTTAAAGAATGCAAGAAATTTAGAT ATATAAGAAGGCTAATATGATTTCCTTATGATTTTCAGTGTTATCTGATA GTATTGAACGAAAACATTTCGAATCACTAAACAAAGCTTTTGAATTTCCA GGTACTTTTACTTGAACAAGGCGCTTCATACCGAATGTCGTCACCTAGAA TCGGCAATGCAAATTGAAGAAATAATTGGCATACCTCTTCGACTGATGCC GACGTTCCGCAAATTGAAGATCTTGTACGATGAAAGCGATTTCTCGCAAA TCGAAGAACAACAAACGGGTGTTTTCAAAGTAGTTGAAAAATCAGAAGAT TTGTTATTGGAAGAGTTGGTTAGTTTTGGTGGAAACGTCACTTTCCCATC ATGCACTTGTGCATTATGGCATCAAGCCAATCTGCCATGCGTTCACATGT ATGCTGTTTTTCGATCGCAGACCATGTGGAAATACGATTCGTTAAGCGCT TTATATCGCATCAATCCTCTATTGGATTTCGATTATTCGTGTATCGATGC AGATAGTTTCTCGAAGAATAATGGTAAAACGATTCACGTGCACCACCTGT TCCCTGAGTCTAAACCCACCGATGAAGAAGAAGAGGAAGAGGATGAGCCA CTTGCGGTTTTATTGAAAAATCAAAACAAGTCAGTTTTCAAAGAGTCCAG TAAGATTCCTGAAAGCTATCTTGGGAAATTGAAAGAACTGAAAACTCAAT TGTTCGCTGTACGCCATGCGTTTACTGATGCGTCATATCAAAAACACCTG CAAGCAGATCTCCTAGTTTTGATCAATCAGCTCGAAAAACTTGACCAACC AGATCAGGACGATGCATTTGGACCGTTACTCGCAAAGAAAAAAACGAATA ATAAGAACACTAGTAATACGAAAACAACAGCAGCGGAGAAGACCAAAGCG ACAGTTGATAACAAGGAGAATAGTCTACGTCAAACACCCATTGAATACGT CTCTATGGCTTCGTTTAAAAAACCGGGAGATGCTGCTAACATTTCGACGC CTGCAAAGGTTTCCAGCTCCATATCTGCAAAGAAGACTACACCTTCACCG AGTACGCAACAAACTACAAAACCAATCTCTATTTCAGCAGTAGTTTCAAG AAAGACATCAAACGCAAAAACAAAAGCCAGTAAACGCCCGAACACCAAAC CGACGAAACAAACATTAACTTCGGCACCTGTAGTTCCGGCAAAGTCAATC AAGCTTGCGATTTCTGATGACAAAAAAGATGATAATACAGAAACAAAGAA AATTGTCAAAGTCTTGAAAAAAGCTGTAAAAGATGTTCCGCCCGAACATA TAGAAATTGAATACCCGGATAACAAGGACAGTGAATCTTGAGACTCTTAA CACTTTTTCTTTTCCTTTTTCGATTTTAACCCAAAGCTTGAAATTTATCT TTCTCGATTTGTACATTTTAGCATATTATTAGTTAGTATTTATTCGTATC CATTTTACGTCAATTTTCATGGTTTTGAAATTTCATATAGATTTTTTGAC TGTTTTTTATCATTCTTTTGACGATAATTATATTGAAATTATGATTAATT GTGATCAAAATT

Coding sequence (CDS) from alignment at sc0000010:811061..828722-

>TCONS_00001502 ID=TCONS_00001502|Name=TCONS_00001502|organism=Clytia hemisphaerica|type=CDS|length=27624bp|location=Sequence derived from alignment at sc0000010:811061..828722- (Clytia hemisphaerica)
GTACTTTTACTTGAACAAGGCGCTTCATACCGAATGTCGTCACCTAGAAT
CGGCAATGCAAATTGAAGAAATAATTGGCATACCTCTTCGACTGATGCCG
ACGTTCCGCAAATTGAAGATCTTGTACGATGAAAGCGATTTCTCGCAAAT
CGAAGAACAACAAACGGGTGTTTTCAAAGTAGTTGAAAAATCAGAAGATT
TGTTATTGGAAGAGTTGGTTAGTTTTGGTGGAAACGTCACTTTCCCATCA
TGCACTTGTGCATTATGGCATCAAGCCAATCTGCCATGCGTTCACATGTA
TGCTGTTTTTCGATCGCAGACCATGTGGAAATACGATTCGTTAAGCGCTT
TATATCGCATCAATCCTCTATTGGATTTCGATTATTCGTGTATCGATGCA
GATAGTTTCTCGAAGAATAATGGTAAAACGATTCACGTGCACCACCTGTT
CCCTGAGTCTAAACCCACCGATGAAGAAGAAGAGGAAGAGGATGAGCCAC
TTGCGGTTTTATTGAAAAATCAAAACAAGTCAGTTTTCAAAGAGTCCAGT
AAGATTCCTGAAAGCTATCTTGGGAAATTGAAAGAACTGAAAACTCAATT
GTTCGCTGTACGCCATGCGTTTACTGATGCGTCATATCAAAAACACCTGC
AAGCAGATCTCCTAGTTTTGATCAATCAGCTCGAAAAACTTGACCAACCA
GATCAGGACGATGCATTTGGACCGTTACTCGCAAAGAAAAAAACGAATAA
TAAGAACACTAGTAATACGAAAACAACAGCAGCGGAGAAGACCAAAGCGA
CAGTTGATAACAAGGAGAATAGTCTACGTCAAACACCCATTGAATACGTC
TCTATGGCTTCGTTTAAAAAACCGGGAGATGCTGCTAACATTTCGACGCC
TGCAAAGGTTTCCAGCTCCATATCTGCAAAGAAGACTACACCTTCACCGA
GTACGCAACAAACTACAAAACCAATCTCTATTTCAGCAGTAGTTTCAAGA
AAGACATCAAACGCAAAAACAAAAGCCAGTAAACGCCCGAACACCAAACC
GACGAAACAAACATTAACTTCGGCACCTGTAGTTCCGGCAAAGTCAATCA
AGCTTGCGATTTCTGATGACAAAAAAGATGATAATACAGAAACAAAGAAA
ATTGTCAAAGTCTTGAAAAAAGCTGTAAAAGATGTTCCGCCCGAACATAT
AGAAATTGAATACCCGGATAACAAGGACAGTGAATCTTGACGATGGGTTA
GCACGTACCGACCGGAAGACATTATTGTATTGGAACACGGACAAGATACT
TTTGATGACATCGTGAGAACGTATTCTGAACGTATCTCTAACAGTACGTT
GCCACAAATGCAACTAGGATTCTTTGCGTTATTGGAACGTATCGCTAGCC
CCGAGACAACAAAGAAACAAACGGATAGATGCTGAATATTTTCTGGGACC
GGCACAATGTCGTGACAAATGGATTTCTTTCCTCGAAACACCGAGCAACG
AGTTGAAGGATCATTCGGAAGAAATTTTGACATATTTGGATCAAATGCAG
AAATCTTATACCAAAGATATTTTGACTGCTTGTGCGACTGTGGTGGAGGC
TAGTGAGGTATGGAAAGAATCGGCTGTTCTCAGAGAATGGTTTCAAACAG
TATGGCTACCGCTTGCCAAGGGAAAAGAAAGATCGAGAGAGCTCTTACAC
AAAGAGTTACGTATCATGGCACAAGAGATGACTTTTAGTAATTTTCGCAT
CAAACACATTCAAGAGAAGATCAATAATCATGTCATAAACAACTGGTTCT
ACGGTCAAACACCGCCCTCGAGTGATAGCACCAAATATTTTCCACGTGGT
GGCGTGATCAGGTCCACCCGCGAACGCCTCTTCAAAATGTGTTTTTTCAG
TGACGAAGAACTGTTGAAGCTAGACGAAATAATAGAGAAGCTAAAAGCCG
ACAACCCGACGGATAACATCTGGATGGAGGTCAAGCACGTCCGACAACAA
GACGACGAAGATGATATTTACTTAGATGCTGAGGATCTGAATCTTGAAGA
TACGGAAGAAACACCAAACAAGAAATTGAAGAATGATAAAAAGATGAATC
ACCACCAGTTCCACACTTTCAATTTCGTCTACCAAAACACGTGGCAACAA
CGCATGTTACATCGGTACGGTCGTATTGTATTCATCACCGAAGTCAAACA
TAACAAAAGCGCCGTGCGTGCTTTGACCTTCAAAACTTATTTACTCATGG
TGCAAACGAACGTAGATTTCCAAGTGGTTGGTGTGATCATGCATAGTAAG
ATTAAAGGAGGGACGTCTCTTAGTGAATGTTTGGAGCGCTTCAAGAGTTT
CAGTCTTCAATGGGTACCAAAGTATTTCTTTGTTGATGTCAGTGAACCTA
TCTTCTCATCCATCGAAAGCGCTTTCCCAGATGAAGAAAGACACTGAATA
CAAGCGAAGAGAAATGGTACGTAAAATCAAACTTGCGTTGAAAGAAAACT
TGGAGTCAGTGGAAGCAGAATTTTATTATATCGGAAGGCTACCTGGTGTA
TCAAGACATCGCAATCATGAAATGCTCAAGTTGGCGAAAGACGTCAAAAG
GCGCTCACATAAAACGCCCTCTAAGAAATGTGGATGTCCAGCTGGTATTT
GGGTTCGACAGGTCATCAAGTTCCCCCAATTCTTCAATTAACAGAGGTTC
AACTGAAAGGCCATGACATTCGATGGAACGATCCTGTCAAAATGCGAAAT
GCAAAAATTCGTCATGAGTTCTTCAACTTTAATGGTGTCCCTTTCATGAG
TATTGCCAACATGGCGATGAATTGTCAATTCGGACACGGCGAAAGTGAAC
AAGTCTATCTAAAAAGAACAGCTAAAAGGATGGAGGTCAATGATTCAAAT
GCCTCCTCAGAAACACCAATCACTCCAGAGGAAACCTCTCCATCAGAGAT
AACCCCTCCATCAAAGGAAACCCCACCATCGGAGGAAACCCTAGTATCTG
AAGCGTCAAAGGAGGAAGAAACCCAGATACAATTTTTAGTGGAAACTGAA
GCTAACCAGCAATCCTCTGAAGAAGTAACTGCTAGCTTGGTAACAACAAC
TATTGATTTATCAGGAATTGCTCCAGAGGAATCACAAACTACACAAGATG
GATCAAGTTCGGAGCACAATTCTCAAACGAACGTATCACAGTCTGATGAG
ATTGAAATAGCCGTTGCTATGGTCCACGGTGGTGTAAATGAATCCTCCAC
TCCTAACGGAGACGTGACAGCGTTACAGCAGAACGTCGTTAATGATAAGG
CAACGGCTGCCGAAGACACCTTTGATGATACGGATTGTACGTATGTTGTT
GCGAGGACGCACAGCGAGTTACGTGAAGCTATCCGTCTGCACGCTGAGGC
TACGGGAGCTCAATTTTGTATGTCTAAACGAACGAAGGGCTTCGGAAATG
AAAGTACTTTTACTTGAACAAGGCGCTTCATACCGAATGTCGTCACCTAG
AATCGGCAATGCAAATTGAAGAAATAATTGGCATACCTCTTCGACTGATG
CCGACGTTCCGCAAATTGAAGATCTTGTACGATGAAAGCGATTTCTCGCA
AATCGAAGAACAACAAACGGGTGTTTTCAAAGTAGTTGAAAAATCAGAAG
ATTTGTTATTGGAAGAGTTGGTTAGTTTTGGTGGAAACGTCACTTTCCCA
TCATGCACTTGTGCATTATGGCATCAAGCCAATCTGCCATGCGTTCACAT
GTATGCTGTTTTTCGATCGCAGACCATGTGGAAATACGATTCGTTAAGCG
CTTTATATCGCATCAATCCTCTATTGGATTTCGATTATTCGTGTATCGAT
GCAGATAGTTTCTCGAAGAATAATGGTAAAACGATTCACGTGCACCACCT
GTTCCCTGAGTCTAAACCCACCGATGAAGAAGAAGAGGAAGAGGATGAGC
CACTTGCGGTTTTATTGAAAAATCAAAACAAGTCAGTTTTCAAAGAGTCC
AGTAAGATTCCTGAAAGCTATCTTGGGAAATTGAAAGAACTGAAAACTCA
ATTGTTCGCTGTACGCCATGCGTTTACTGATGCGTCATATCAAAAACACC
TGCAAGCAGATCTCCTAGTTTTGATCAATCAGCTCGAAAAACTTGACCAA
CCAGATCAGGACGATGCATTTGGACCGTTACTCGCAAAGAAAAAAACGAA
TAATAAGAACACTAGTAATACGAAAACAACAGCAGCGGAGAAGACCAAAG
CGACAGTTGATAACAAGGAGAATAGTCTACGTCAAACACCCATTGAATAC
GTCTCTATGGCTTCGTTTAAAAAACCGGGAGATGCTGCTAACATTTCGAC
GCCTGCAAAGGTTTCCAGCTCCATATCTGCAAAGAAGACTACACCTTCAC
CGAGTACGCAACAAACTACAAAACCAATCTCTATTTCAGCAGTAGTTTCA
AGAAAGACATCAAACGCAAAAACAAAAGCCAGTAAACGCCCGAACACCAA
ACCGACGAAACAAACATTAACTTCGGCACCTGTAGTTCCGGCAAAGTCAA
TCAAGCTTGCGATTTCTGATGACAAAAAAGATGATAATACAGAAACAAAG
AAAATTGTCAAAGTCTTGAAAAAAGCTGTAAAAGATGTTCCGCCCGAACA
TATAGAAATTGAATACCCGGATAACAAGGACAGTGAATCTTGACGATGGG
TTAGCACGTACCGACCGGAAGACATTATTGTATTGGAACACGGACAAGAT
ACTTTTGATGACATCGTGAGAACGTATTCTGAACGTATCTCTAACAGTAC
GTTGCCACAAATGCAACTAGGATTCTTTGCGTTATTGGAACGTATCGCTA
GCCCCGAGACAACAAAGAAACAAACGGATAGATGCTGAATATTTTCTGGG
ACCGGCACAATGTCGTGACAAATGGATTTCTTTCCTCGAAACACCGAGCA
ACGAGTTGAAGGATCATTCGGAAGAAATTTTGACATATTTGGATCAAATG
CAGAAATCTTATACCAAAGATATTTTGACTGCTTGTGCGACTGTGGTGGA
GGCTAGTGAGGTATGGAAAGAATCGGCTGTTCTCAGAGAATGGTTTCAAA
CAGTATGGCTACCGCTTGCCAAGGGAAAAGAAAGATCGAGAGAGCTCTTA
CACAAAGAGTTACGTATCATGGCACAAGAGATGACTTTTAGTAATTTTCG
CATCAAACACATTCAAGAGAAGATCAATAATCATGTCATAAACAACTGGT
TCTACGGTCAAACACCGCCCTCGAGTGATAGCACCAAATATTTTCCACGT
GGTGGCGTGATCAGGTCCACCCGCGAACGCCTCTTCAAAATGTGTTTTTT
CAGTGACGAAGAACTGTTGAAGCTAGACGAAATAATAGAGAAGCTAAAAG
CCGACAACCCGACGGATAACATCTGGATGGAGGTCAAGCACGTCCGACAA
CAAGACGACGAAGATGATATTTACTTAGATGCTGAGGATCTGAATCTTGA
AGATACGGAAGAAACACCAAACAAGAAATTGAAGAATGATAAAAAGATGA
ATCACCACCAGTTCCACACTTTCAATTTCGTCTACCAAAACACGTGGCAA
CAACGCATGTTACATCGGTACGGTCGTATTGTATTCATCACCGAAGTCAA
ACATAACAAAAGCGCCGTGCGTGCTTTGACCTTCAAAACTTATTTACTCA
TGGTGCAAACGAACGTAGATTTCCAAGTGGTTGGTGTGATCATGCATAGT
AAGATTAAAGGAGGGACGTCTCTTAGTGAATGTTTGGAGCGCTTCAAGAG
TTTCAGTCTTCAATGGGTACCAAAGTATTTCTTTGTTGATGTCAGTGAAC
CTATCTTCTCATCCATCGAAAGCGCTTTCCCAGATGAAGAAAGACACTGA
ATACAAGCGAAGAGAAATGGTACGTAAAATCAAACTTGCGTTGAAAGAAA
ACTTGGAGTCAGTGGAAGCAGAATTTTATTATATCGGAAGGCTACCTGGT
GTATCAAGACATCGCAATCATGAAATGCTCAAGTTGGCGAAAGACGTCAA
AAGGCGCTCACATAAAACGCCCTCTAAGAAATGTGGATGTCCAGCTGGTA
TTTGGGTTCGACAGGTCATCAAGTTCCCCCAATTCTTCAATTAACAGAGG
TTCAACTGAAAGGCCATGACATTCGATGGAACGATCCTGTCAAAATGCGA
AATGCAAAAATTCGTCATGAGTTCTTCAACTTTAATGGTGTCCCTTTCAT
GAGTATTGCCAACATGGCGATGAATTGTCAATTCGGACACGGCGAAAGTG
AACAAGTCTATCTAAAAAGAACAGCTAAAAGGATGGAGGTCAATGATTCA
AATGCCTCCTCAGAAACACCAATCACTCCAGAGGAAACCTCTCCATCAGA
GATAACCCCTCCATCAAAGGAAACCCCACCATCGGAGGAAACCCTAGTAT
CTGAAGCGTCAAAGGAGGAAGAAACCCAGATACAATTTTTAGTGGAAACT
GAAGCTAACCAGCAATCCTCTGAAGAAGTAACTGCTAGCTTGGTAACAAC
AACTATTGATTTATCAGGAATTGCTCCAGAGGAATCACAAACTACACAAG
ATGGATCAAGTTCGGAGCACAATTCTCAAACGAACGTATCACAGTCTGAT
GAGATTGAAATAGCCGTTGCTATGGTCCACGGTGGTGTAAATGAATCCTC
CACTCCTAACGGAGACGTGACAGCGTTACAGCAGAACGTCGTTAATGATA
AGGCAACGGCTGCCGAAGACACCTTTGATGATACGGATTGTACGTATGTT
GTTGCGAGGACGCACAGCGAGTTACGTGAAGCTATCCGTCTGCACGCTGA
GGCTACGGGAGCTCAATTTTGTATGTCTAAACGAACGAAGGGCTTCGGAA
ATGAAAGTACTTTTACTTGAACAAGGCGCTTCATACCGAATGTCGTCACC
TAGAATCGGCAATGCAAATTGAAGAAATAATTGGCATACCTCTTCGACTG
ATGCCGACGTTCCGCAAATTGAAGATCTTGTACGATGAAAGCGATTTCTC
GCAAATCGAAGAACAACAAACGGGTGTTTTCAAAGTAGTTGAAAAATCAG
AAGATTTGTTATTGGAAGAGTTGGTTAGTTTTGGTGGAAACGTCACTTTC
CCATCATGCACTTGTGCATTATGGCATCAAGCCAATCTGCCATGCGTTCA
CATGTATGCTGTTTTTCGATCGCAGACCATGTGGAAATACGATTCGTTAA
GCGCTTTATATCGCATCAATCCTCTATTGGATTTCGATTATTCGTGTATC
GATGCAGATAGTTTCTCGAAGAATAATGGTAAAACGATTCACGTGCACCA
CCTGTTCCCTGAGTCTAAACCCACCGATGAAGAAGAAGAGGAAGAGGATG
AGCCACTTGCGGTTTTATTGAAAAATCAAAACAAGTCAGTTTTCAAAGAG
TCCAGTAAGATTCCTGAAAGCTATCTTGGGAAATTGAAAGAACTGAAAAC
TCAATTGTTCGCTGTACGCCATGCGTTTACTGATGCGTCATATCAAAAAC
ACCTGCAAGCAGATCTCCTAGTTTTGATCAATCAGCTCGAAAAACTTGAC
CAACCAGATCAGGACGATGCATTTGGACCGTTACTCGCAAAGAAAAAAAC
GAATAATAAGAACACTAGTAATACGAAAACAACAGCAGCGGAGAAGACCA
AAGCGACAGTTGATAACAAGGAGAATAGTCTACGTCAAACACCCATTGAA
TACGTCTCTATGGCTTCGTTTAAAAAACCGGGAGATGCTGCTAACATTTC
GACGCCTGCAAAGGTTTCCAGCTCCATATCTGCAAAGAAGACTACACCTT
CACCGAGTACGCAACAAACTACAAAACCAATCTCTATTTCAGCAGTAGTT
TCAAGAAAGACATCAAACGCAAAAACAAAAGCCAGTAAACGCCCGAACAC
CAAACCGACGAAACAAACATTAACTTCGGCACCTGTAGTTCCGGCAAAGT
CAATCAAGCTTGCGATTTCTGATGACAAAAAAGATGATAATACAGAAACA
AAGAAAATTGTCAAAGTCTTGAAAAAAGCTGTAAAAGATGTTCCGCCCGA
ACATATAGAAATTGAATACCCGGATAACAAGGACAGTGAATCTTGACGAT
GGGTTAGCACGTACCGACCGGAAGACATTATTGTATTGGAACACGGACAA
GATACTTTTGATGACATCGTGAGAACGTATTCTGAACGTATCTCTAACAG
TACGTTGCCACAAATGCAACTAGGATTCTTTGCGTTATTGGAACGTATCG
CTAGCCCCGAGACAACAAAGAAACAAACGGATAGATGCTGAATATTTTCT
GGGACCGGCACAATGTCGTGACAAATGGATTTCTTTCCTCGAAACACCGA
GCAACGAGTTGAAGGATCATTCGGAAGAAATTTTGACATATTTGGATCAA
ATGCAGAAATCTTATACCAAAGATATTTTGACTGCTTGTGCGACTGTGGT
GGAGGCTAGTGAGGTATGGAAAGAATCGGCTGTTCTCAGAGAATGGTTTC
AAACAGTATGGCTACCGCTTGCCAAGGGAAAAGAAAGATCGAGAGAGCTC
TTACACAAAGAGTTACGTATCATGGCACAAGAGATGACTTTTAGTAATTT
TCGCATCAAACACATTCAAGAGAAGATCAATAATCATGTCATAAACAACT
GGTTCTACGGTCAAACACCGCCCTCGAGTGATAGCACCAAATATTTTCCA
CGTGGTGGCGTGATCAGGTCCACCCGCGAACGCCTCTTCAAAATGTGTTT
TTTCAGTGACGAAGAACTGTTGAAGCTAGACGAAATAATAGAGAAGCTAA
AAGCCGACAACCCGACGGATAACATCTGGATGGAGGTCAAGCACGTCCGA
CAACAAGACGACGAAGATGATATTTACTTAGATGCTGAGGATCTGAATCT
TGAAGATACGGAAGAAACACCAAACAAGAAATTGAAGAATGATAAAAAGA
TGAATCACCACCAGTTCCACACTTTCAATTTCGTCTACCAAAACACGTGG
CAACAACGCATGTTACATCGGTACGGTCGTATTGTATTCATCACCGAAGT
CAAACATAACAAAAGCGCCGTGCGTGCTTTGACCTTCAAAACTTATTTAC
TCATGGTGCAAACGAACGTAGATTTCCAAGTGGTTGGTGTGATCATGCAT
AGTAAGATTAAAGGAGGGACGTCTCTTAGTGAATGTTTGGAGCGCTTCAA
GAGTTTCAGTCTTCAATGGGTACCAAAGTATTTCTTTGTTGATGTCAGTG
AACCTATCTTCTCATCCATCGAAAGCGCTTTCCCAGATGAAGAAAGACAC
TGAATACAAGCGAAGAGAAATGGTACGTAAAATCAAACTTGCGTTGAAAG
AAAACTTGGAGTCAGTGGAAGCAGAATTTTATTATATCGGAAGGCTACCT
GGTGTATCAAGACATCGCAATCATGAAATGCTCAAGTTGGCGAAAGACGT
CAAAAGGCGCTCACATAAAACGCCCTCTAAGAAATGTGGATGTCCAGCTG
GTATTTGGGTTCGACAGGTCATCAAGTTCCCCCAATTCTTCAATTAACAG
AGGTTCAACTGAAAGGCCATGACATTCGATGGAACGATCCTGTCAAAATG
CGAAATGCAAAAATTCGTCATGAGTTCTTCAACTTTAATGGTGTCCCTTT
CATGAGTATTGCCAACATGGCGATGAATTGTCAATTCGGACACGGCGAAA
GTGAACAAGTCTATCTAAAAAGAACAGCTAAAAGGATGGAGGTCAATGAT
TCAAATGCCTCCTCAGAAACACCAATCACTCCAGAGGAAACCTCTCCATC
AGAGATAACCCCTCCATCAAAGGAAACCCCACCATCGGAGGAAACCCTAG
TATCTGAAGCGTCAAAGGAGGAAGAAACCCAGATACAATTTTTAGTGGAA
ACTGAAGCTAACCAGCAATCCTCTGAAGAAGTAACTGCTAGCTTGGTAAC
AACAACTATTGATTTATCAGGAATTGCTCCAGAGGAATCACAAACTACAC
AAGATGGATCAAGTTCGGAGCACAATTCTCAAACGAACGTATCACAGTCT
GATGAGATTGAAATAGCCGTTGCTATGGTCCACGGTGGTGTAAATGAATC
CTCCACTCCTAACGGAGACGTGACAGCGTTACAGCAGAACGTCGTTAATG
ATAAGGCAACGGCTGCCGAAGACACCTTTGATGATACGGATTGTACGTAT
GTTGTTGCGAGGACGCACAGCGAGTTACGTGAAGCTATCCGTCTGCACGC
TGAGGCTACGGGAGCTCAATTTTGTATGTCTAAACGAACGAAGGGCTTCG
GAAATGAAAGTACTTTTACTTGAACAAGGCGCTTCATACCGAATGTCGTC
ACCTAGAATCGGCAATGCAAATTGAAGAAATAATTGGCATACCTCTTCGA
CTGATGCCGACGTTCCGCAAATTGAAGATCTTGTACGATGAAAGCGATTT
CTCGCAAATCGAAGAACAACAAACGGGTGTTTTCAAAGTAGTTGAAAAAT
CAGAAGATTTGTTATTGGAAGAGTTGGTTAGTTTTGGTGGAAACGTCACT
TTCCCATCATGCACTTGTGCATTATGGCATCAAGCCAATCTGCCATGCGT
TCACATGTATGCTGTTTTTCGATCGCAGACCATGTGGAAATACGATTCGT
TAAGCGCTTTATATCGCATCAATCCTCTATTGGATTTCGATTATTCGTGT
ATCGATGCAGATAGTTTCTCGAAGAATAATGGTAAAACGATTCACGTGCA
CCACCTGTTCCCTGAGTCTAAACCCACCGATGAAGAAGAAGAGGAAGAGG
ATGAGCCACTTGCGGTTTTATTGAAAAATCAAAACAAGTCAGTTTTCAAA
GAGTCCAGTAAGATTCCTGAAAGCTATCTTGGGAAATTGAAAGAACTGAA
AACTCAATTGTTCGCTGTACGCCATGCGTTTACTGATGCGTCATATCAAA
AACACCTGCAAGCAGATCTCCTAGTTTTGATCAATCAGCTCGAAAAACTT
GACCAACCAGATCAGGACGATGCATTTGGACCGTTACTCGCAAAGAAAAA
AACGAATAATAAGAACACTAGTAATACGAAAACAACAGCAGCGGAGAAGA
CCAAAGCGACAGTTGATAACAAGGAGAATAGTCTACGTCAAACACCCATT
GAATACGTCTCTATGGCTTCGTTTAAAAAACCGGGAGATGCTGCTAACAT
TTCGACGCCTGCAAAGGTTTCCAGCTCCATATCTGCAAAGAAGACTACAC
CTTCACCGAGTACGCAACAAACTACAAAACCAATCTCTATTTCAGCAGTA
GTTTCAAGAAAGACATCAAACGCAAAAACAAAAGCCAGTAAACGCCCGAA
CACCAAACCGACGAAACAAACATTAACTTCGGCACCTGTAGTTCCGGCAA
AGTCAATCAAGCTTGCGATTTCTGATGACAAAAAAGATGATAATACAGAA
ACAAAGAAAATTGTCAAAGTCTTGAAAAAAGCTGTAAAAGATGTTCCGCC
CGAACATATAGAAATTGAATACCCGGATAACAAGGACAGTGAATCTTGAC
GATGGGTTAGCACGTACCGACCGGAAGACATTATTGTATTGGAACACGGA
CAAGATACTTTTGATGACATCGTGAGAACGTATTCTGAACGTATCTCTAA
CAGTACGTTGCCACAAATGCAACTAGGATTCTTTGCGTTATTGGAACGTA
TCGCTAGCCCCGAGACAACAAAGAAACAAACGGATAGATGCTGAATATTT
TCTGGGACCGGCACAATGTCGTGACAAATGGATTTCTTTCCTCGAAACAC
CGAGCAACGAGTTGAAGGATCATTCGGAAGAAATTTTGACATATTTGGAT
CAAATGCAGAAATCTTATACCAAAGATATTTTGACTGCTTGTGCGACTGT
GGTGGAGGCTAGTGAGGTATGGAAAGAATCGGCTGTTCTCAGAGAATGGT
TTCAAACAGTATGGCTACCGCTTGCCAAGGGAAAAGAAAGATCGAGAGAG
CTCTTACACAAAGAGTTACGTATCATGGCACAAGAGATGACTTTTAGTAA
TTTTCGCATCAAACACATTCAAGAGAAGATCAATAATCATGTCATAAACA
ACTGGTTCTACGGTCAAACACCGCCCTCGAGTGATAGCACCAAATATTTT
CCACGTGGTGGCGTGATCAGGTCCACCCGCGAACGCCTCTTCAAAATGTG
TTTTTTCAGTGACGAAGAACTGTTGAAGCTAGACGAAATAATAGAGAAGC
TAAAAGCCGACAACCCGACGGATAACATCTGGATGGAGGTCAAGCACGTC
CGACAACAAGACGACGAAGATGATATTTACTTAGATGCTGAGGATCTGAA
TCTTGAAGATACGGAAGAAACACCAAACAAGAAATTGAAGAATGATAAAA
AGATGAATCACCACCAGTTCCACACTTTCAATTTCGTCTACCAAAACACG
TGGCAACAACGCATGTTACATCGGTACGGTCGTATTGTATTCATCACCGA
AGTCAAACATAACAAAAGCGCCGTGCGTGCTTTGACCTTCAAAACTTATT
TACTCATGGTGCAAACGAACGTAGATTTCCAAGTGGTTGGTGTGATCATG
CATAGTAAGATTAAAGGAGGGACGTCTCTTAGTGAATGTTTGGAGCGCTT
CAAGAGTTTCAGTCTTCAATGGGTACCAAAGTATTTCTTTGTTGATGTCA
GTGAACCTATCTTCTCATCCATCGAAAGCGCTTTCCCAGATGAAGAAAGA
CACTGAATACAAGCGAAGAGAAATGGTACGTAAAATCAAACTTGCGTTGA
AAGAAAACTTGGAGTCAGTGGAAGCAGAATTTTATTATATCGGAAGGCTA
CCTGGTGTATCAAGACATCGCAATCATGAAATGCTCAAGTTGGCGAAAGA
CGTCAAAAGGCGCTCACATAAAACGCCCTCTAAGAAATGTGGATGTCCAG
CTGGTATTTGGGTTCGACAGGTCATCAAGTTCCCCCAATTCTTCAATTAA
CAGAGGTTCAACTGAAAGGCCATGACATTCGATGGAACGATCCTGTCAAA
ATGCGAAATGCAAAAATTCGTCATGAGTTCTTCAACTTTAATGGTGTCCC
TTTCATGAGTATTGCCAACATGGCGATGAATTGTCAATTCGGACACGGCG
AAAGTGAACAAGTCTATCTAAAAAGAACAGCTAAAAGGATGGAGGTCAAT
GATTCAAATGCCTCCTCAGAAACACCAATCACTCCAGAGGAAACCTCTCC
ATCAGAGATAACCCCTCCATCAAAGGAAACCCCACCATCGGAGGAAACCC
TAGTATCTGAAGCGTCAAAGGAGGAAGAAACCCAGATACAATTTTTAGTG
GAAACTGAAGCTAACCAGCAATCCTCTGAAGAAGTAACTGCTAGCTTGGT
AACAACAACTATTGATTTATCAGGAATTGCTCCAGAGGAATCACAAACTA
CACAAGATGGATCAAGTTCGGAGCACAATTCTCAAACGAACGTATCACAG
TCTGATGAGATTGAAATAGCCGTTGCTATGGTCCACGGTGGTGTAAATGA
ATCCTCCACTCCTAACGGAGACGTGACAGCGTTACAGCAGAACGTCGTTA
ATGATAAGGCAACGGCTGCCGAAGACACCTTTGATGATACGGATTGTACG
TATGTTGTTGCGAGGACGCACAGCGAGTTACGTGAAGCTATCCGTCTGCA
CGCTGAGGCTACGGGAGCTCAATTTTGTATGTCTAAACGAACGAAGGGCT
TCGGAAATGAAAGTACTTTTACTTGAACAAGGCGCTTCATACCGAATGTC
GTCACCTAGAATCGGCAATGCAAATTGAAGAAATAATTGGCATACCTCTT
CGACTGATGCCGACGTTCCGCAAATTGAAGATCTTGTACGATGAAAGCGA
TTTCTCGCAAATCGAAGAACAACAAACGGGTGTTTTCAAAGTAGTTGAAA
AATCAGAAGATTTGTTATTGGAAGAGTTGGTTAGTTTTGGTGGAAACGTC
ACTTTCCCATCATGCACTTGTGCATTATGGCATCAAGCCAATCTGCCATG
CGTTCACATGTATGCTGTTTTTCGATCGCAGACCATGTGGAAATACGATT
CGTTAAGCGCTTTATATCGCATCAATCCTCTATTGGATTTCGATTATTCG
TGTATCGATGCAGATAGTTTCTCGAAGAATAATGGTAAAACGATTCACGT
GCACCACCTGTTCCCTGAGTCTAAACCCACCGATGAAGAAGAAGAGGAAG
AGGATGAGCCACTTGCGGTTTTATTGAAAAATCAAAACAAGTCAGTTTTC
AAAGAGTCCAGTAAGATTCCTGAAAGCTATCTTGGGAAATTGAAAGAACT
GAAAACTCAATTGTTCGCTGTACGCCATGCGTTTACTGATGCGTCATATC
AAAAACACCTGCAAGCAGATCTCCTAGTTTTGATCAATCAGCTCGAAAAA
CTTGACCAACCAGATCAGGACGATGCATTTGGACCGTTACTCGCAAAGAA
AAAAACGAATAATAAGAACACTAGTAATACGAAAACAACAGCAGCGGAGA
AGACCAAAGCGACAGTTGATAACAAGGAGAATAGTCTACGTCAAACACCC
ATTGAATACGTCTCTATGGCTTCGTTTAAAAAACCGGGAGATGCTGCTAA
CATTTCGACGCCTGCAAAGGTTTCCAGCTCCATATCTGCAAAGAAGACTA
CACCTTCACCGAGTACGCAACAAACTACAAAACCAATCTCTATTTCAGCA
GTAGTTTCAAGAAAGACATCAAACGCAAAAACAAAAGCCAGTAAACGCCC
GAACACCAAACCGACGAAACAAACATTAACTTCGGCACCTGTAGTTCCGG
CAAAGTCAATCAAGCTTGCGATTTCTGATGACAAAAAAGATGATAATACA
GAAACAAAGAAAATTGTCAAAGTCTTGAAAAAAGCTGTAAAAGATGTTCC
GCCCGAACATATAGAAATTGAATACCCGGATAACAAGGACAGTGAATCTT
GACGATGGGTTAGCACGTACCGACCGGAAGACATTATTGTATTGGAACAC
GGACAAGATACTTTTGATGACATCGTGAGAACGTATTCTGAACGTATCTC
TAACAGTACGTTGCCACAAATGCAACTAGGATTCTTTGCGTTATTGGAAC
GTATCGCTAGCCCCGAGACAACAAAGAAACAAACGGATAGATGCTGAATA
TTTTCTGGGACCGGCACAATGTCGTGACAAATGGATTTCTTTCCTCGAAA
CACCGAGCAACGAGTTGAAGGATCATTCGGAAGAAATTTTGACATATTTG
GATCAAATGCAGAAATCTTATACCAAAGATATTTTGACTGCTTGTGCGAC
TGTGGTGGAGGCTAGTGAGGTATGGAAAGAATCGGCTGTTCTCAGAGAAT
GGTTTCAAACAGTATGGCTACCGCTTGCCAAGGGAAAAGAAAGATCGAGA
GAGCTCTTACACAAAGAGTTACGTATCATGGCACAAGAGATGACTTTTAG
TAATTTTCGCATCAAACACATTCAAGAGAAGATCAATAATCATGTCATAA
ACAACTGGTTCTACGGTCAAACACCGCCCTCGAGTGATAGCACCAAATAT
TTTCCACGTGGTGGCGTGATCAGGTCCACCCGCGAACGCCTCTTCAAAAT
GTGTTTTTTCAGTGACGAAGAACTGTTGAAGCTAGACGAAATAATAGAGA
AGCTAAAAGCCGACAACCCGACGGATAACATCTGGATGGAGGTCAAGCAC
GTCCGACAACAAGACGACGAAGATGATATTTACTTAGATGCTGAGGATCT
GAATCTTGAAGATACGGAAGAAACACCAAACAAGAAATTGAAGAATGATA
AAAAGATGAATCACCACCAGTTCCACACTTTCAATTTCGTCTACCAAAAC
ACGTGGCAACAACGCATGTTACATCGGTACGGTCGTATTGTATTCATCAC
CGAAGTCAAACATAACAAAAGCGCCGTGCGTGCTTTGACCTTCAAAACTT
ATTTACTCATGGTGCAAACGAACGTAGATTTCCAAGTGGTTGGTGTGATC
ATGCATAGTAAGATTAAAGGAGGGACGTCTCTTAGTGAATGTTTGGAGCG
CTTCAAGAGTTTCAGTCTTCAATGGGTACCAAAGTATTTCTTTGTTGATG
TCAGTGAACCTATCTTCTCATCCATCGAAAGCGCTTTCCCAGATGAAGAA
AGACACTGAATACAAGCGAAGAGAAATGGTACGTAAAATCAAACTTGCGT
TGAAAGAAAACTTGGAGTCAGTGGAAGCAGAATTTTATTATATCGGAAGG
CTACCTGGTGTATCAAGACATCGCAATCATGAAATGCTCAAGTTGGCGAA
AGACGTCAAAAGGCGCTCACATAAAACGCCCTCTAAGAAATGTGGATGTC
CAGCTGGTATTTGGGTTCGACAGGTCATCAAGTTCCCCCAATTCTTCAAT
TAACAGAGGTTCAACTGAAAGGCCATGACATTCGATGGAACGATCCTGTC
AAAATGCGAAATGCAAAAATTCGTCATGAGTTCTTCAACTTTAATGGTGT
CCCTTTCATGAGTATTGCCAACATGGCGATGAATTGTCAATTCGGACACG
GCGAAAGTGAACAAGTCTATCTAAAAAGAACAGCTAAAAGGATGGAGGTC
AATGATTCAAATGCCTCCTCAGAAACACCAATCACTCCAGAGGAAACCTC
TCCATCAGAGATAACCCCTCCATCAAAGGAAACCCCACCATCGGAGGAAA
CCCTAGTATCTGAAGCGTCAAAGGAGGAAGAAACCCAGATACAATTTTTA
GTGGAAACTGAAGCTAACCAGCAATCCTCTGAAGAAGTAACTGCTAGCTT
GGTAACAACAACTATTGATTTATCAGGAATTGCTCCAGAGGAATCACAAA
CTACACAAGATGGATCAAGTTCGGAGCACAATTCTCAAACGAACGTATCA
CAGTCTGATGAGATTGAAATAGCCGTTGCTATGGTCCACGGTGGTGTAAA
TGAATCCTCCACTCCTAACGGAGACGTGACAGCGTTACAGCAGAACGTCG
TTAATGATAAGGCAACGGCTGCCGAAGACACCTTTGATGATACGGATTGT
ACGTATGTTGTTGCGAGGACGCACAGCGAGTTACGTGAAGCTATCCGTCT
GCACGCTGAGGCTACGGGAGCTCAATTTTGTATGTCTAAACGAACGAAGG
GCTTCGGAAATGAAAGTACTTTTACTTGAACAAGGCGCTTCATACCGAAT
GTCGTCACCTAGAATCGGCAATGCAAATTGAAGAAATAATTGGCATACCT
CTTCGACTGATGCCGACGTTCCGCAAATTGAAGATCTTGTACGATGAAAG
CGATTTCTCGCAAATCGAAGAACAACAAACGGGTGTTTTCAAAGTAGTTG
AAAAATCAGAAGATTTGTTATTGGAAGAGTTGGTTAGTTTTGGTGGAAAC
GTCACTTTCCCATCATGCACTTGTGCATTATGGCATCAAGCCAATCTGCC
ATGCGTTCACATGTATGCTGTTTTTCGATCGCAGACCATGTGGAAATACG
ATTCGTTAAGCGCTTTATATCGCATCAATCCTCTATTGGATTTCGATTAT
TCGTGTATCGATGCAGATAGTTTCTCGAAGAATAATGGTAAAACGATTCA
CGTGCACCACCTGTTCCCTGAGTCTAAACCCACCGATGAAGAAGAAGAGG
AAGAGGATGAGCCACTTGCGGTTTTATTGAAAAATCAAAACAAGTCAGTT
TTCAAAGAGTCCAGTAAGATTCCTGAAAGCTATCTTGGGAAATTGAAAGA
ACTGAAAACTCAATTGTTCGCTGTACGCCATGCGTTTACTGATGCGTCAT
ATCAAAAACACCTGCAAGCAGATCTCCTAGTTTTGATCAATCAGCTCGAA
AAACTTGACCAACCAGATCAGGACGATGCATTTGGACCGTTACTCGCAAA
GAAAAAAACGAATAATAAGAACACTAGTAATACGAAAACAACAGCAGCGG
AGAAGACCAAAGCGACAGTTGATAACAAGGAGAATAGTCTACGTCAAACA
CCCATTGAATACGTCTCTATGGCTTCGTTTAAAAAACCGGGAGATGCTGC
TAACATTTCGACGCCTGCAAAGGTTTCCAGCTCCATATCTGCAAAGAAGA
CTACACCTTCACCGAGTACGCAACAAACTACAAAACCAATCTCTATTTCA
GCAGTAGTTTCAAGAAAGACATCAAACGCAAAAACAAAAGCCAGTAAACG
CCCGAACACCAAACCGACGAAACAAACATTAACTTCGGCACCTGTAGTTC
CGGCAAAGTCAATCAAGCTTGCGATTTCTGATGACAAAAAAGATGATAAT
ACAGAAACAAAGAAAATTGTCAAAGTCTTGAAAAAAGCTGTAAAAGATGT
TCCGCCCGAACATATAGAAATTGAATACCCGGATAACAAGGACAGTGAAT
CTTGACGATGGGTTAGCACGTACCGACCGGAAGACATTATTGTATTGGAA
CACGGACAAGATACTTTTGATGACATCGTGAGAACGTATTCTGAACGTAT
CTCTAACAGTACGTTGCCACAAATGCAACTAGGATTCTTTGCGTTATTGG
AACGTATCGCTAGCCCCGAGACAACAAAGAAACAAACGGATAGATGCTGA
ATATTTTCTGGGACCGGCACAATGTCGTGACAAATGGATTTCTTTCCTCG
AAACACCGAGCAACGAGTTGAAGGATCATTCGGAAGAAATTTTGACATAT
TTGGATCAAATGCAGAAATCTTATACCAAAGATATTTTGACTGCTTGTGC
GACTGTGGTGGAGGCTAGTGAGGTATGGAAAGAATCGGCTGTTCTCAGAG
AATGGTTTCAAACAGTATGGCTACCGCTTGCCAAGGGAAAAGAAAGATCG
AGAGAGCTCTTACACAAAGAGTTACGTATCATGGCACAAGAGATGACTTT
TAGTAATTTTCGCATCAAACACATTCAAGAGAAGATCAATAATCATGTCA
TAAACAACTGGTTCTACGGTCAAACACCGCCCTCGAGTGATAGCACCAAA
TATTTTCCACGTGGTGGCGTGATCAGGTCCACCCGCGAACGCCTCTTCAA
AATGTGTTTTTTCAGTGACGAAGAACTGTTGAAGCTAGACGAAATAATAG
AGAAGCTAAAAGCCGACAACCCGACGGATAACATCTGGATGGAGGTCAAG
CACGTCCGACAACAAGACGACGAAGATGATATTTACTTAGATGCTGAGGA
TCTGAATCTTGAAGATACGGAAGAAACACCAAACAAGAAATTGAAGAATG
ATAAAAAGATGAATCACCACCAGTTCCACACTTTCAATTTCGTCTACCAA
AACACGTGGCAACAACGCATGTTACATCGGTACGGTCGTATTGTATTCAT
CACCGAAGTCAAACATAACAAAAGCGCCGTGCGTGCTTTGACCTTCAAAA
CTTATTTACTCATGGTGCAAACGAACGTAGATTTCCAAGTGGTTGGTGTG
ATCATGCATAGTAAGATTAAAGGAGGGACGTCTCTTAGTGAATGTTTGGA
GCGCTTCAAGAGTTTCAGTCTTCAATGGGTACCAAAGTATTTCTTTGTTG
ATGTCAGTGAACCTATCTTCTCATCCATCGAAAGCGCTTTCCCAGATGAA
GAAAGACACTGAATACAAGCGAAGAGAAATGGTACGTAAAATCAAACTTG
CGTTGAAAGAAAACTTGGAGTCAGTGGAAGCAGAATTTTATTATATCGGA
AGGCTACCTGGTGTATCAAGACATCGCAATCATGAAATGCTCAAGTTGGC
GAAAGACGTCAAAAGGCGCTCACATAAAACGCCCTCTAAGAAATGTGGAT
GTCCAGCTGGTATTTGGGTTCGACAGGTCATCAAGTTCCCCCAATTCTTC
AATTAACAGAGGTTCAACTGAAAGGCCATGACATTCGATGGAACGATCCT
GTCAAAATGCGAAATGCAAAAATTCGTCATGAGTTCTTCAACTTTAATGG
TGTCCCTTTCATGAGTATTGCCAACATGGCGATGAATTGTCAATTCGGAC
ACGGCGAAAGTGAACAAGTCTATCTAAAAAGAACAGCTAAAAGGATGGAG
GTCAATGATTCAAATGCCTCCTCAGAAACACCAATCACTCCAGAGGAAAC
CTCTCCATCAGAGATAACCCCTCCATCAAAGGAAACCCCACCATCGGAGG
AAACCCTAGTATCTGAAGCGTCAAAGGAGGAAGAAACCCAGATACAATTT
TTAGTGGAAACTGAAGCTAACCAGCAATCCTCTGAAGAAGTAACTGCTAG
CTTGGTAACAACAACTATTGATTTATCAGGAATTGCTCCAGAGGAATCAC
AAACTACACAAGATGGATCAAGTTCGGAGCACAATTCTCAAACGAACGTA
TCACAGTCTGATGAGATTGAAATAGCCGTTGCTATGGTCCACGGTGGTGT
AAATGAATCCTCCACTCCTAACGGAGACGTGACAGCGTTACAGCAGAACG
TCGTTAATGATAAGGCAACGGCTGCCGAAGACACCTTTGATGATACGGAT
TGTACGTATGTTGTTGCGAGGACGCACAGCGAGTTACGTGAAGCTATCCG
TCTGCACGCTGAGGCTACGGGAGCTCAATTTTGTATGTCTAAACGAACGA
AGGGCTTCGGAAATGAAAGTACTTTTACTTGAACAAGGCGCTTCATACCG
AATGTCGTCACCTAGAATCGGCAATGCAAATTGAAGAAATAATTGGCATA
CCTCTTCGACTGATGCCGACGTTCCGCAAATTGAAGATCTTGTACGATGA
AAGCGATTTCTCGCAAATCGAAGAACAACAAACGGGTGTTTTCAAAGTAG
TTGAAAAATCAGAAGATTTGTTATTGGAAGAGTTGGTTAGTTTTGGTGGA
AACGTCACTTTCCCATCATGCACTTGTGCATTATGGCATCAAGCCAATCT
GCCATGCGTTCACATGTATGCTGTTTTTCGATCGCAGACCATGTGGAAAT
ACGATTCGTTAAGCGCTTTATATCGCATCAATCCTCTATTGGATTTCGAT
TATTCGTGTATCGATGCAGATAGTTTCTCGAAGAATAATGGTAAAACGAT
TCACGTGCACCACCTGTTCCCTGAGTCTAAACCCACCGATGAAGAAGAAG
AGGAAGAGGATGAGCCACTTGCGGTTTTATTGAAAAATCAAAACAAGTCA
GTTTTCAAAGAGTCCAGTAAGATTCCTGAAAGCTATCTTGGGAAATTGAA
AGAACTGAAAACTCAATTGTTCGCTGTACGCCATGCGTTTACTGATGCGT
CATATCAAAAACACCTGCAAGCAGATCTCCTAGTTTTGATCAATCAGCTC
GAAAAACTTGACCAACCAGATCAGGACGATGCATTTGGACCGTTACTCGC
AAAGAAAAAAACGAATAATAAGAACACTAGTAATACGAAAACAACAGCAG
CGGAGAAGACCAAAGCGACAGTTGATAACAAGGAGAATAGTCTACGTCAA
ACACCCATTGAATACGTCTCTATGGCTTCGTTTAAAAAACCGGGAGATGC
TGCTAACATTTCGACGCCTGCAAAGGTTTCCAGCTCCATATCTGCAAAGA
AGACTACACCTTCACCGAGTACGCAACAAACTACAAAACCAATCTCTATT
TCAGCAGTAGTTTCAAGAAAGACATCAAACGCAAAAACAAAAGCCAGTAA
ACGCCCGAACACCAAACCGACGAAACAAACATTAACTTCGGCACCTGTAG
TTCCGGCAAAGTCAATCAAGCTTGCGATTTCTGATGACAAAAAAGATGAT
AATACAGAAACAAAGAAAATTGTCAAAGTCTTGAAAAAAGCTGTAAAAGA
TGTTCCGCCCGAACATATAGAAATTGAATACCCGGATAACAAGGACAGTG
AATCTTGACGATGGGTTAGCACGTACCGACCGGAAGACATTATTGTATTG
GAACACGGACAAGATACTTTTGATGACATCGTGAGAACGTATTCTGAACG
TATCTCTAACAGTACGTTGCCACAAATGCAACTAGGATTCTTTGCGTTAT
TGGAACGTATCGCTAGCCCCGAGACAACAAAGAAACAAACGGATAGATGC
TGAATATTTTCTGGGACCGGCACAATGTCGTGACAAATGGATTTCTTTCC
TCGAAACACCGAGCAACGAGTTGAAGGATCATTCGGAAGAAATTTTGACA
TATTTGGATCAAATGCAGAAATCTTATACCAAAGATATTTTGACTGCTTG
TGCGACTGTGGTGGAGGCTAGTGAGGTATGGAAAGAATCGGCTGTTCTCA
GAGAATGGTTTCAAACAGTATGGCTACCGCTTGCCAAGGGAAAAGAAAGA
TCGAGAGAGCTCTTACACAAAGAGTTACGTATCATGGCACAAGAGATGAC
TTTTAGTAATTTTCGCATCAAACACATTCAAGAGAAGATCAATAATCATG
TCATAAACAACTGGTTCTACGGTCAAACACCGCCCTCGAGTGATAGCACC
AAATATTTTCCACGTGGTGGCGTGATCAGGTCCACCCGCGAACGCCTCTT
CAAAATGTGTTTTTTCAGTGACGAAGAACTGTTGAAGCTAGACGAAATAA
TAGAGAAGCTAAAAGCCGACAACCCGACGGATAACATCTGGATGGAGGTC
AAGCACGTCCGACAACAAGACGACGAAGATGATATTTACTTAGATGCTGA
GGATCTGAATCTTGAAGATACGGAAGAAACACCAAACAAGAAATTGAAGA
ATGATAAAAAGATGAATCACCACCAGTTCCACACTTTCAATTTCGTCTAC
CAAAACACGTGGCAACAACGCATGTTACATCGGTACGGTCGTATTGTATT
CATCACCGAAGTCAAACATAACAAAAGCGCCGTGCGTGCTTTGACCTTCA
AAACTTATTTACTCATGGTGCAAACGAACGTAGATTTCCAAGTGGTTGGT
GTGATCATGCATAGTAAGATTAAAGGAGGGACGTCTCTTAGTGAATGTTT
GGAGCGCTTCAAGAGTTTCAGTCTTCAATGGGTACCAAAGTATTTCTTTG
TTGATGTCAGTGAACCTATCTTCTCATCCATCGAAAGCGCTTTCCCAGAT
GAAGAAAGACACTGAATACAAGCGAAGAGAAATGGTACGTAAAATCAAAC
TTGCGTTGAAAGAAAACTTGGAGTCAGTGGAAGCAGAATTTTATTATATC
GGAAGGCTACCTGGTGTATCAAGACATCGCAATCATGAAATGCTCAAGTT
GGCGAAAGACGTCAAAAGGCGCTCACATAAAACGCCCTCTAAGAAATGTG
GATGTCCAGCTGGTATTTGGGTTCGACAGGTCATCAAGTTCCCCCAATTC
TTCAATTAACAGAGGTTCAACTGAAAGGCCATGACATTCGATGGAACGAT
CCTGTCAAAATGCGAAATGCAAAAATTCGTCATGAGTTCTTCAACTTTAA
TGGTGTCCCTTTCATGAGTATTGCCAACATGGCGATGAATTGTCAATTCG
GACACGGCGAAAGTGAACAAGTCTATCTAAAAAGAACAGCTAAAAGGATG
GAGGTCAATGATTCAAATGCCTCCTCAGAAACACCAATCACTCCAGAGGA
AACCTCTCCATCAGAGATAACCCCTCCATCAAAGGAAACCCCACCATCGG
AGGAAACCCTAGTATCTGAAGCGTCAAAGGAGGAAGAAACCCAGATACAA
TTTTTAGTGGAAACTGAAGCTAACCAGCAATCCTCTGAAGAAGTAACTGC
TAGCTTGGTAACAACAACTATTGATTTATCAGGAATTGCTCCAGAGGAAT
CACAAACTACACAAGATGGATCAAGTTCGGAGCACAATTCTCAAACGAAC
GTATCACAGTCTGATGAGATTGAAATAGCCGTTGCTATGGTCCACGGTGG
TGTAAATGAATCCTCCACTCCTAACGGAGACGTGACAGCGTTACAGCAGA
ACGTCGTTAATGATAAGGCAACGGCTGCCGAAGACACCTTTGATGATACG
GATTGTACGTATGTTGTTGCGAGGACGCACAGCGAGTTACGTGAAGCTAT
CCGTCTGCACGCTGAGGCTACGGGAGCTCAATTTTGTATGTCTAAACGAA
CGAAGGGCTTCGGAAATGAAAGTACTTTTACTTGAACAAGGCGCTTCATA
CCGAATGTCGTCACCTAGAATCGGCAATGCAAATTGAAGAAATAATTGGC
ATACCTCTTCGACTGATGCCGACGTTCCGCAAATTGAAGATCTTGTACGA
TGAAAGCGATTTCTCGCAAATCGAAGAACAACAAACGGGTGTTTTCAAAG
TAGTTGAAAAATCAGAAGATTTGTTATTGGAAGAGTTGGTTAGTTTTGGT
GGAAACGTCACTTTCCCATCATGCACTTGTGCATTATGGCATCAAGCCAA
TCTGCCATGCGTTCACATGTATGCTGTTTTTCGATCGCAGACCATGTGGA
AATACGATTCGTTAAGCGCTTTATATCGCATCAATCCTCTATTGGATTTC
GATTATTCGTGTATCGATGCAGATAGTTTCTCGAAGAATAATGGTAAAAC
GATTCACGTGCACCACCTGTTCCCTGAGTCTAAACCCACCGATGAAGAAG
AAGAGGAAGAGGATGAGCCACTTGCGGTTTTATTGAAAAATCAAAACAAG
TCAGTTTTCAAAGAGTCCAGTAAGATTCCTGAAAGCTATCTTGGGAAATT
GAAAGAACTGAAAACTCAATTGTTCGCTGTACGCCATGCGTTTACTGATG
CGTCATATCAAAAACACCTGCAAGCAGATCTCCTAGTTTTGATCAATCAG
CTCGAAAAACTTGACCAACCAGATCAGGACGATGCATTTGGACCGTTACT
CGCAAAGAAAAAAACGAATAATAAGAACACTAGTAATACGAAAACAACAG
CAGCGGAGAAGACCAAAGCGACAGTTGATAACAAGGAGAATAGTCTACGT
CAAACACCCATTGAATACGTCTCTATGGCTTCGTTTAAAAAACCGGGAGA
TGCTGCTAACATTTCGACGCCTGCAAAGGTTTCCAGCTCCATATCTGCAA
AGAAGACTACACCTTCACCGAGTACGCAACAAACTACAAAACCAATCTCT
ATTTCAGCAGTAGTTTCAAGAAAGACATCAAACGCAAAAACAAAAGCCAG
TAAACGCCCGAACACCAAACCGACGAAACAAACATTAACTTCGGCACCTG
TAGTTCCGGCAAAGTCAATCAAGCTTGCGATTTCTGATGACAAAAAAGAT
GATAATACAGAAACAAAGAAAATTGTCAAAGTCTTGAAAAAAGCTGTAAA
AGATGTTCCGCCCGAACATATAGAAATTGAATACCCGGATAACAAGGACA
GTGAATCTTGACGATGGGTTAGCACGTACCGACCGGAAGACATTATTGTA
TTGGAACACGGACAAGATACTTTTGATGACATCGTGAGAACGTATTCTGA
ACGTATCTCTAACAGTACGTTGCCACAAATGCAACTAGGATTCTTTGCGT
TATTGGAACGTATCGCTAGCCCCGAGACAACAAAGAAACAAACGGATAGA
TGCTGAATATTTTCTGGGACCGGCACAATGTCGTGACAAATGGATTTCTT
TCCTCGAAACACCGAGCAACGAGTTGAAGGATCATTCGGAAGAAATTTTG
ACATATTTGGATCAAATGCAGAAATCTTATACCAAAGATATTTTGACTGC
TTGTGCGACTGTGGTGGAGGCTAGTGAGGTATGGAAAGAATCGGCTGTTC
TCAGAGAATGGTTTCAAACAGTATGGCTACCGCTTGCCAAGGGAAAAGAA
AGATCGAGAGAGCTCTTACACAAAGAGTTACGTATCATGGCACAAGAGAT
GACTTTTAGTAATTTTCGCATCAAACACATTCAAGAGAAGATCAATAATC
ATGTCATAAACAACTGGTTCTACGGTCAAACACCGCCCTCGAGTGATAGC
ACCAAATATTTTCCACGTGGTGGCGTGATCAGGTCCACCCGCGAACGCCT
CTTCAAAATGTGTTTTTTCAGTGACGAAGAACTGTTGAAGCTAGACGAAA
TAATAGAGAAGCTAAAAGCCGACAACCCGACGGATAACATCTGGATGGAG
GTCAAGCACGTCCGACAACAAGACGACGAAGATGATATTTACTTAGATGC
TGAGGATCTGAATCTTGAAGATACGGAAGAAACACCAAACAAGAAATTGA
AGAATGATAAAAAGATGAATCACCACCAGTTCCACACTTTCAATTTCGTC
TACCAAAACACGTGGCAACAACGCATGTTACATCGGTACGGTCGTATTGT
ATTCATCACCGAAGTCAAACATAACAAAAGCGCCGTGCGTGCTTTGACCT
TCAAAACTTATTTACTCATGGTGCAAACGAACGTAGATTTCCAAGTGGTT
GGTGTGATCATGCATAGTAAGATTAAAGGAGGGACGTCTCTTAGTGAATG
TTTGGAGCGCTTCAAGAGTTTCAGTCTTCAATGGGTACCAAAGTATTTCT
TTGTTGATGTCAGTGAACCTATCTTCTCATCCATCGAAAGCGCTTTCCCA
GATGAAGAAAGACACTGAATACAAGCGAAGAGAAATGGTACGTAAAATCA
AACTTGCGTTGAAAGAAAACTTGGAGTCAGTGGAAGCAGAATTTTATTAT
ATCGGAAGGCTACCTGGTGTATCAAGACATCGCAATCATGAAATGCTCAA
GTTGGCGAAAGACGTCAAAAGGCGCTCACATAAAACGCCCTCTAAGAAAT
GTGGATGTCCAGCTGGTATTTGGGTTCGACAGGTCATCAAGTTCCCCCAA
TTCTTCAATTAACAGAGGTTCAACTGAAAGGCCATGACATTCGATGGAAC
GATCCTGTCAAAATGCGAAATGCAAAAATTCGTCATGAGTTCTTCAACTT
TAATGGTGTCCCTTTCATGAGTATTGCCAACATGGCGATGAATTGTCAAT
TCGGACACGGCGAAAGTGAACAAGTCTATCTAAAAAGAACAGCTAAAAGG
ATGGAGGTCAATGATTCAAATGCCTCCTCAGAAACACCAATCACTCCAGA
GGAAACCTCTCCATCAGAGATAACCCCTCCATCAAAGGAAACCCCACCAT
CGGAGGAAACCCTAGTATCTGAAGCGTCAAAGGAGGAAGAAACCCAGATA
CAATTTTTAGTGGAAACTGAAGCTAACCAGCAATCCTCTGAAGAAGTAAC
TGCTAGCTTGGTAACAACAACTATTGATTTATCAGGAATTGCTCCAGAGG
AATCACAAACTACACAAGATGGATCAAGTTCGGAGCACAATTCTCAAACG
AACGTATCACAGTCTGATGAGATTGAAATAGCCGTTGCTATGGTCCACGG
TGGTGTAAATGAATCCTCCACTCCTAACGGAGACGTGACAGCGTTACAGC
AGAACGTCGTTAATGATAAGGCAACGGCTGCCGAAGACACCTTTGATGAT
ACGGATTGTACGTATGTTGTTGCGAGGACGCACAGCGAGTTACGTGAAGC
TATCCGTCTGCACGCTGAGGCTACGGGAGCTCAATTTTGTATGTCTAAAC
GAACGAAGGGCTTCGGAAATGAAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000763XLOC_000763Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001502-exon-sc0000010-1575043694:828592..828722TCONS_00001502-exon-sc0000010-1575043694:828592..828722Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1575043694:827031..827622TCONS_00001502-exon-sc0000010-1575043694:827031..827622Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1575043694:825956..826149TCONS_00001502-exon-sc0000010-1575043694:825956..826149Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1575043694:825508..825612TCONS_00001502-exon-sc0000010-1575043694:825508..825612Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1575043694:815612..815761TCONS_00001502-exon-sc0000010-1575043694:815612..815761Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1575043694:814323..815082TCONS_00001502-exon-sc0000010-1575043694:814323..815082Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1575043694:813774..814015TCONS_00001502-exon-sc0000010-1575043694:813774..814015Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1575043694:813009..813196TCONS_00001502-exon-sc0000010-1575043694:813009..813196Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1575043694:811061..812521TCONS_00001502-exon-sc0000010-1575043694:811061..812521Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:828592..828722TCONS_00001502-exon-sc0000010-1510915933:828592..828722Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:827031..827622TCONS_00001502-exon-sc0000010-1510915933:827031..827622Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:825956..826149TCONS_00001502-exon-sc0000010-1510915933:825956..826149Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:825508..825612TCONS_00001502-exon-sc0000010-1510915933:825508..825612Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:815612..815761TCONS_00001502-exon-sc0000010-1510915933:815612..815761Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:814323..815082TCONS_00001502-exon-sc0000010-1510915933:814323..815082Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:813774..814015TCONS_00001502-exon-sc0000010-1510915933:813774..814015Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:813009..813196TCONS_00001502-exon-sc0000010-1510915933:813009..813196Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1510915933:811061..812521TCONS_00001502-exon-sc0000010-1510915933:811061..812521Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:828592..828722TCONS_00001502-exon-sc0000010-1491911889:828592..828722Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:827031..827622TCONS_00001502-exon-sc0000010-1491911889:827031..827622Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:825956..826149TCONS_00001502-exon-sc0000010-1491911889:825956..826149Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:825508..825612TCONS_00001502-exon-sc0000010-1491911889:825508..825612Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:815612..815761TCONS_00001502-exon-sc0000010-1491911889:815612..815761Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:814323..815082TCONS_00001502-exon-sc0000010-1491911889:814323..815082Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:813774..814015TCONS_00001502-exon-sc0000010-1491911889:813774..814015Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:813009..813196TCONS_00001502-exon-sc0000010-1491911889:813009..813196Clytia hemisphaericaexon
TCONS_00001502-exon-sc0000010-1491911889:811061..812521TCONS_00001502-exon-sc0000010-1491911889:811061..812521Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001502-proteinTCONS_00001502-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:811061..828722 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
41.25 37.5448 10.6927 6.3941 46.2551 35.976 29.3185 31.0396 14.394 21.3336 17.4746 13.3046 17.8889 16.4353 17.0238 16.4686 20.5827 21.142 10.018 8.29914 14.9964 15.8192 51.7312 46.233 25.9596 27.1284 13.703 10.372 39.2686 46.0031
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029309CaRF
IPR007527Znf_SWIM
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008270 zinc ion binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001502 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top