Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001502-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001502-protein
Unique NameTCONS_00001502-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1150

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001502-protein ID=TCONS_00001502-protein|Name=TCONS_00001502-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1150bp
MEVNDSNASSETPITPEETSPSEITPPSKETPPSEETLVSEASKEEETQI
QFLVETEANQQSSEEVTASLVTTTIDLSGIAPEESQTTQDGSSSEHNSQT
NVSQSDEIEIAVAMVHGGVNESSTPNGDVTALQQNVVNDKATAAEDTFDD
TDCTYVVARTHSELREAIRLHAEATGAQFCMSKRTKGFGNEKLTEVQLKG
HDIRWNDPVKMRNAKIRHEFFNFNGVPFMSIANMAMNCQFGHGESEQVYL
KRTAKRLAKDVKRRSHKTPSKKCGCPAGIWVRQVIKFPQFFMKKDTEYKR
REMVRKIKLALKENLESVEAEFYYIGRLPGVSRHRNHEMLKGKERSRELL
HKELRIMAQEMTFSNFRIKHIQEKINNHVINNWFYGQTPPSSDSTKYFPR
GGVIRSTRERLFKMCFFSDEELLKLDEIIEKLKADNPTDNIWMEVKHVRQ
QDDEDDIYLDAEDLNLEDTEETPNKKLKNDKKMNHHQFHTFNFVYQNTWQ
QRMLHRYGRIVFITEVKHNKSAVRALTFKTYLLMVQTNVDFQVVGVIMHS
KIKGGTSLSECLERFKSFSLQWVPKYFFVDVSEPIFSSIESAFPDAEYFL
GPAQCRDKWISFLETPSNELKDHSEEILTYLDQMQKSYTKDILTACATVV
EASEVWKESAVLREWFQTVWLPLAKRWVSTYRPEDIIVLEHGQDTFDDIV
RTYSERISNSTLPQMQLGFFALLERIASPETTKKQTDRYFYLNKALHTEC
RHLESAMQIEEIIGIPLRLMPTFRKLKILYDESDFSQIEEQQTGVFKVVE
KSEDLLLEELVSFGGNVTFPSCTCALWHQANLPCVHMYAVFRSQTMWKYD
SLSALYRINPLLDFDYSCIDADSFSKNNGKTIHVHHLFPESKPTDEEEEE
EDEPLAVLLKNQNKSVFKESSKIPESYLGKLKELKTQLFAVRHAFTDASY
QKHLQADLLVLINQLEKLDQPDQDDAFGPLLAKKKTNNKNTSNTKTTAAE
KTKATVDNKENSLRQTPIEYVSMASFKKPGDAANISTPAKVSSSISAKKT
TPSPSTQQTTKPISISAVVSRKTSNAKTKASKRPNTKPTKQTLTSAPVVP
AKSIKLAISDDKKDDNTETKKIVKVLKKAVKDVPPEHIEIEYPDNKDSES
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000763XLOC_000763Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001502TCONS_00001502Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR029309CaRF
IPR007527Znf_SWIM
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 301..321
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 976..1008
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 77..104
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1029..1098
IPR029309Calcium-responsive transcription factorPFAMPF15299ALS2CR8coord: 215..400
e-value: 9.4E-25
score: 87.7
IPR007527Zinc finger, SWIM-typePROSITEPS50966ZF_SWIMcoord: 807..845
score: 9.31

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001502-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top