Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001415 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001415
Unique NameTCONS_00001415
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length7401

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001415 ID=TCONS_00001415|Name=TCONS_00001415|organism=Clytia hemisphaerica|type=transcript|length=7401bp
TGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGAGTGTCATTGAA
GACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTC
GTCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAAC
GTGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGAC
GAGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGA
GAAAAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGC
TTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACA
CAAAAATTCGAGaGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTT
AGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAA
GTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTG
GAGAAGAAACTGACCAGTATTGACGTCATgcttaaattgaaattgaagGA
GTTTgatgacaaagaaaaagaacaagaaaTCATGAGATTGCAAGAAGAAA
AGAAACGACTGGTTGCCGATGAAGAGGTCATTCTAACACAATCTAGTCGT
GTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTC
TGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTC
CTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTG
GTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGTGAG
CGTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAA
CGATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACA
GAAGAAAATGCACAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGA
CTTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGAC
ATATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGT
GCTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTc
cagatatttcaaaatgaagaatGACTTAACAAACGTACAAGTTTGGTTGG
AAGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATG
AAGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGT
TAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCC
CCAAACGACAAATCTCAttattgaacaaaaaattcaaattggtTTCTTAC
CAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACCACCTACAAAAT
CAGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCA
ACATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGT
CAATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTT
TACGTTCCGTTCACAACCATGGCTtggaaaactttccaaattACGCGTCT
GGCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTAT
ATACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATG
GTTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTA
TGGCCCTTTATAAAGAAACTGCTCCAGATATCTTGGCCCGTAAACACAAG
TTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGA
GAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGA
TCagagaaattgaagaaattcaTGCCGTTTTCAATGACGAGTGCTTCTCA
AAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAgAAAT
GGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGG
TGCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATT
GATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGA
GTTTCGTCACAGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAAC
AGTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAA
AACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGACCTCTATGA
TGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCA
CGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAA
TTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAG
CAGGAAGTTGGGATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTA
ATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTC
TTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAG
GGATGACCTCAAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGA
TAGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTG
TCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGC
TCAAGTACAAGATCTGACCACAGGACATAGCAAACGATTTGATGTTGTTG
AGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTT
TCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAA
CAAACCGGGATATAATGTCGACCCTGAGATCATGAAGAAATCATTAGAAA
CACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAA
GCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAA
GATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAG
CGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTT
CAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTT
ATCTTTCACAACGACTGAAACttcaaaatacaaatatgaaaTGTATTCTT
CAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACAC
GATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCT
TGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACTCCATCC
AATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATG
GCAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACA
TTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACC
AAGCTCTGGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGAT
AATTATGTGTACAAAGCCGATATTCAATTGAACGAAAACCAACAGATTGG
TACTACCGTCACCGAACTAGAAGCACAACTTGAAAAACACAAGaAATTCC
AAGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTA
GCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAA
AACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGCT
CGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAA
TTTCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATC
GAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCTGAGGATA
CTTCAAACGTGGATGAACTACAAGGTGAAATGCAGGAACTCGAAGATGAC
ATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACA
AATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAA
AGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTC
GATATCAGGGATAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATT
ATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAAC
TCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAG
AATAAACACCATCagGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGT
CATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAAT
CTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGC
GTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCT
CGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTAT
TAGAgCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACT
TTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATAT
ACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGAGAATGCAAG
AACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTC
AAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGG
AGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCC
AGATTCGACAGGagaatttgcaaaatttgatgTCTGGTTCGGATGCAGGA
TCAGTTATGTTACAagAAAGCGTACCGACACCATGGGAACGTGGACAAGC
ATTGAACAAAGTGCCATATTTCATCAATCATACCACAAAAACGACACAAT
GGGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAAT
GACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCA
AAAGGCTTGTTGTCTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAG
CATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTC
GGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAA
TCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACT
GGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTA
TCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAA
ATGGAAATATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACA
GCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAA
CTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAG
GAGCTGCTTCGAAATGGCTAAAAACAACTCAGCGATCGATTCCAACAACT
TTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTA
TTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGG
TATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCgctgtttgaaat
gttttaacTTTGATCTTTGTCAGACTTGCTTCTGGTCTGGACGTGTCTCG
AAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGACGAC
GACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCA
AATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCA
GTGCAGACCATCATGGAAGGAAGTTCCATTGAAACGCCAACGGAACCAAC
GACACCTGATCTATCCAACTTCACTTTCGACTCGGCAATGAACGGTCACC
ACGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATT
GGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGG
TGAAATCACAAACAATAACACAACGCCGAAAAGTCCGTCACAAATTTTGG
CGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGT
CTTGAAGAGGAACACCAATCTCTAATGGAAGAATACACCCGACTGAAGGG
AATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATA
CACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAA
GGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATT
AGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGCCCTCCG
AACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAA
GGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGA
ATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATAC
ATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAG
GATTAACGGAGGAATGGAAATTTTGTTCTATTAGTGTATTGTTCTGCTTT
TTCTCTTGTGTTAGTAGTGTTTATATGAAAGATTGAATCTTTTAGAATTA
GCGCTTTATTGTTAATACACAAAGAAATAATGTCATTTTTCTATCTACCC
ATTTTCAGAATCAGAAATAAAGTTCTAGGAACACCGGACGGTTTTTAGAT
CCCTGGAGGACCTAAAGAAAATATCCGAAACCTTTTCTGCTACTGAAGGT
TTGGTTTTTGTAAAATAGAATACCAGTCTGGACAATTAGGTTGATAGATA
Catgaaattatttattttgaaatttaaaagaaatatttatagcttatata
tatttttatattgtaCCTTGTccatataataattttttttgtcttttctg
TTGTCTTTCCTTGTCCTCCCTGAATTCTATGTTGTGTTTTTGTTTGCCTC
CAGAAAAAACGAGGTCGCTTTATTTTCGCGTATTATTTTGCTTTTtgtaa
ataagttttttttgttttgtcttatattttttgacagaaaatctttttta
tggaTAGAAATAATTTTATACAATTGAAAATACCTTTGCGTTCATTATCA
T
Run BLAST on NCBI

transcript from alignment at sc0000010:243650..305170-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001415 ID=TCONS_00001415|Name=TCONS_00001415|organism=Clytia hemisphaerica|type=transcript|length=61521bp|location=Sequence derived from alignment at sc0000010:243650..305170- (Clytia hemisphaerica)
TGCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGTTTGACTTATA TGATAATTACATATTTTGATTCTTGTATAACTGACTTTTACATCGTAAAA TATCGAATCTACTAAGATAAGTATATGATAAGGCTATCATTGTGTCTCAC TAACATTCTGCCGATTGGTAGTGTGAAGGTTTCGGTCACAGACTTGCACT GCAATGGACTGTGCTCGAATTCCAAGTACTTACAGGCAGTATGTTAGGGA AGCATAGTGATAGACTCTCTACCTTCACTCGTACATCGAATCTGCTCTTT CCTTTTTTAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGC AACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCG GCTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCA ATCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGA TACAACAGTTAGATGAATACGAGAAAAAGGTGACTGAATTTGTGGCGCTC ATCTTTTTTTTGCTTTAAACTATCTATAATGGACTCTCACTGATTCGAAC TTCCTTTGTTCGAATTTTTTTATCATTCCAACAAAGTGGGTTCCCGACAT TAGAGTTCGAATTAGCGAGAGCCAACTGTACCTAAAGTCTATTCACGATA AGTGTGCACTCTTTTTTCTTTTACCTATAACTTTTGAAGGAATTCTTCAA TCTTTATAAATTTGGTATCATTGGAAAGATATTANNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA TCATTTTCACTGGAGAGATTCTTTGATCTTAGGAGATCATCACTGTGAAG AAATTTCATTAAAATGTTTATTCAATATAAAGTTATGATACAAAGTTAAT AAGTGATTGACCCCAAAAAACAGCAAAAAACTGCAGAAAACAGCGTTTTT AGACGTCAATCAGCTTATAACTTTGTTTGATATCTTTTGACTGAATAAAT ATTTTTGAGAATTTTTTTCACAGTGATGACGTTCGATGATTAAAGATTCA CTTCAGTGAAAATGATAGTTATAGCACTTTTCTACAAGATCTTAATTTTT TTCTTCTTCTTTTTCATCTTCATTTTTAGAATTTTTTTAAAGATTTTTTT ATTTGAAATTGTTCCACTCACTAATATCTTTCCAATGATACCAAATTTAT AAAGATTGAAGAATTCCTTCAAAAGTTATAGGTAAAAGAAAAAAGAGTGC ACACTTATCGTGAATAGACTTTAGTTTATGGTTTATAGTTATTTGACTAA AATTAACGTCTTTTTTTTCCCTCAAATAAAAAGTCAGCGTGCTCTGTTAA ATTGTTTTATAATATCATTTGATATTTAGACTCACAAGTTGAATTTTAAC TAAATACGTCATTTTACCTTGTGCAAGGCAGAGTACCTAGTATTGAACGA TACTTTGAATTCTACTAATTTCCCTAAATGTAGTAGTCTACCACTTGAAA AGTCACGCCGCCACTTTAGGCTGACTTGTTTTAATCAGTAGTGCGGTCAC TCTTAATCACCTGCAATCATTAGAATATTAAAAATCTACCAAAAATATTT GTTTCATCATTTTTTGAAACCCGCATGCTACACACCGTGTAGAGAGTTGC GTGTGTTTTGGAGAAGTTTAATTTATGGTAAGAGAAGAACATACAACGTT AGTAATACTTTGTTATGTTTTGAAAAGTTTGCAAATTTACTCTGGAGTGT TCTTTATATAATAGTACAGTTGAGTCTCCATAACCCCTGCGGGGAATACA CAAATTTTTTGCAAATTTTGAGATATAGAGTAAGGTTTTTTTTATGGCAT TGTTAACATTGAAGGGACCAAAAAACTTGTTTGAGTTAACGATACAAGTA ATAAATAGAAGTTAGAGTTAGAGGGACTGTAATACAAGTCATGAATAAAA TACTGTCTCCCTTTGATTTCCGTTGCCATACCCTTTGCATTCGAAATCTA ACTTGGAAAATATTATAAACCGGATTTTGTTCTCTAATATCTCTAATATC TTTAAACACAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAG CATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGG AAACACAAAAATTCGAGGTAAATCATGTAAATTTAGATTGATTTTGGGTT GTAACCTAAGAATACCGTATGGATATCCATGATGAAATGGAAAAATACCA TTCTTATAAAAAATAGCGTGTAATCACTTCGATCAACTTCGACGATTGGA TTGTTTGATCAACATCTCTTGTTTCGAAGGGTCCTAAACTTAGGAATTAT TTTTGAGTTGAGGCAGCTTCATATATTCTTGCACTTGAACCTTTAGCTTA GGGCAAAAAATAAACTCTCCTATAAATCGAGGCTTGCGTCTGCTTATCAT AATAGTTCCCTTAATTAGTTTTTACGTGTCACTTTGTCAAAATCTAAGGT TCTCAAGTAAGCATCTTATACCTAGATATAGTCGCTTATAAAGATACAAA AGGGTATTCTGATAATTATAGGGTATTAACAACTATCATTAATGGATAAA AAAGTAGGATCAATTTGTTTACTGAAAAATAAATCATTAATTGATAAAAA CAACATTTGTCTTTTATAGAAGAGCTTACCTTTTTGCAAAGAATAACGCT TTTAATGATTGATTAAAAACAATTTTTTTTGTAGAGCTTGAAATCCATGG TAAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAA TTAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGAT CTACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCA TGCTTAAATTGAAATTGAAGGTTTGTGTGGNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCGAG TCTCCATAACCCCTGCGGGGAATACACAAATTTTTTGAAAATTTTGAGAT ATAGAGTAAGGTTTTTTTTATGGCATTGTTAACATTGAAGGGACCAAAAA ACTTGTTTGAGTTAACGATACAAGTAATAAATAGAAGTTCGAGTTAGAGG GATTTGACTGTAATACAAGTCATAAATAAAATACTGTCTCCCTTTGATTT CCGTTGCCATACGCTTTGCATTCGAAATCTAACTTGAAAAATATTATAAA CCGGATTTTTTCTCTAATATCTCTAATATCTTTAAACACAAGGTTGACGA TTTGAACACGTGGATCGATGGCCGAATGAGCACGCTTGAGAGCATCGGTG GAGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGGTA AATCATGTAAATTTAGATTGAATTTGGGTTGTAACCTAAGAATACCGTAT GGATATCCATGATGAAATGGAAAAATACCATTCTTATAAAAAATAGCGTG TAATCACTTCGATCAACTTCGACAATTGGATTGTTTGATCAACATCTCTT GTTTCGAAGGGTCCTAAACTTAGGAATTATTTTTGAGTTGAGGCAGCTTC ATATATTCTTGCACTTGAACCTTTAGCTTAGGGCAAAAAATAAACTCTCC TATAAATCGAGGCTTGCGTCTGCTTATCATAATAGTTCCCTTAATTAGTT TTTACGTGTCACTTTGTCAAAATCTAAGGTTCTCAAGTAAGCATCTTATA CCTAGATATAGTCGCTTATAAAGATACAAAAGGGTATTCTGATAATTATA GGGTATTAACAACTATCATTAATGGATAAAAAAGTAGGATCAATTTGTTT ACTGAAAAATAAATCATTAATTGATAAAAACAACATTTGTCTTTTATAGA AGAGCTTACCTTTTTGCAAAGAATAACGCTTTTAATGATTGATTAAAAAC AATTTTTTTTGTAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGAC TTAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTC AAGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATC TGGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAG GTTTGTGTGGTCTTTTTTACATTTCCTTCATAGTTCAACTTACTTTTTGA TTTGCATTACTGCAACTGTAAGTGTGCATTTTTTTGTTGCTACCATAAAA AAACCATCTTCAAGGGAATTAGCAATCTTTTACCCAGAGCCACTTGAATC ACTTGTTAATTTTATTAATTTCATATGATGTTACAACCTTTCGTGAGCAA TCATAAAAAGCGAACTAAGGGACTGGTTTTGAGTTTGGGGAATTAGACTA ATTACGCTGGTATGGAATGGCCTTATTTTTTCTGTTGATTTCTGACGAAA TTTGCGTTGACGTAAAATGATGTGATTTCCTTCTTTTGCTGGTTACTGTA TTAAAACTTTAACTTTATGGCTACGTAATGGTTTCTTTGCCTTATTGAAC GCTGGGAGTCCTTCACTCTAAGCTACCTGTCTGAACAAAGGTGTCACTCA CAAGCATAGATATTTTATACAAACATGAGATGGAACTTTTTCGTCTCGAG CTGAAGCAAAAAAATGCAGGTCGTTTGCTTTGATTGAAAAAATCGTCAGT CTATTCAACAAATATGGTGCATTATTTTTCTTGACTGCTTTTGATTGGTA AATACAGAGTAGTTCTATCTAGTGTTTTATGTAAGATATCTGTGGTCACA AGGCATTTTCTATTCATGATTCTTTTTCTATTTTCTTTAAATAGGAGTTT GATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAA ACGACTGGTTGCCGATGAAGAGGTACGATTAACTTACAGTTGACGCTCTC TAATTCGATTTTTAAGGGGAATTGGATTTTCGTCGAATAAGAGAACGTAT CGCATCGTAAATGAGAGTTTCTTGTTGACCTTAACTTTCAATATTATCGG ATAATGGGGCGTAACAAATCGTGGAACGTCGAATTAGAGAGCCTCAAGTG TACTTTACTTTTTTCATCGCAAGTAAACTGAACCAAAAAGAATTACAGTT AACATTCTTCCTAATTATATCAAAGGATCGAGGGGATCATCCAATGATTT TCTTTGAAATAGAGGAAGGTTCGGATTTGATGAAGTTCAAGACTTTCCAA GCTGAGGTGTGTCCAAGTGTGTCAGTTGTGATATCTAAACTTCGATCCAC AAGGCTTACTAATGAATCCTTAGTGTTAGTTAGCTAAAGGATTGTGTTTG TTTTTCTTGAGGAAAAGAATATACCGGTTCAAGATCGTTCGAAAATCGTT CAAATTGCGACAAAGACACATTGATTTCCAATGCTAACATACACGTTAGA TAATTAGTTTTTTAGAGGATACTAATTAATAGTAATAGCTTTTCGAATGC AACCAGCTAATTAAGAGTATATAGGTTTAGCATTGAGATGTAAATTTTTT GTATCTCAGAGAGAAGGTAGTTGAAGAATCGAGTGCATTTTTTTTTGTTT TCTGAAATTAATTTTGTTACATGTAGTTGTTCCAATAATGGTTTGGATTG GGTTCTGGTTTTCCTAAAAATTTCAGTATTATTTGGACGCAACATTTTAG GGAGCTTTTCTGAAAGAATGGAAAGCCTTTCGGTTAAAGGTATAAAGGTT AAAGGTTATTTAAATTAATGGTGGGGGAGAATGGGCGAATCGATTGTTAC TTGTTATTTGGTATTTGAGGTTTTGAGTTTTCAAGTATAGTTTGATCTGC GTGGATAACTTTCTTTGCATTCGAATTAATGGTGCTACAGTCTTCTTGAA GAAAAACACACACTTTTTAAGCTTTTTTTACGATATAATTAACCAAGATT ATGACATTTGTATGCAAGCAATTTCCGTGAAACAAGTTTGCATTTCCTTT GCGAAAAAAAACAATGAAATTATACTCGCACAAGTAAAGNAATTTCCGTG AAACAAGTTTGTATTTCCTTTGCGAAAAAAAATTGAAATTACACTCGCAC ATAGCAAGTAAAGAAGTGAAGGAGTTAGAAAGTTAATCCTCTCCACTTCT CAGGACACAATATTCATTCAGACAGCATTTTTAATTTCGCTTAGCGAAAG TATTACGATAGCCTTCCGTGTATGTATGTATGTGGCGAGACATTTTTTGG GGCGCAAATTATGGCGTGGNCGTACAAAGGACATTTAGATCCAGCCCACC ATACACCACTGCACAATATGCAGCAGTCCCTCTTTAAAATGATGACAGTT TTTTATCCGATGAATTTTGATTGGTGCTAGATGAGTTTGGTTAGTAAAAG TTCCAGCTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNCTTTATCACAAGTTCCTTCAAAGCACAAAA CGAGGTTTCTGGCATCAAAGAATGAAAAGTTCATTTTTTCTTTTTCATTT TCAAAAAAAATTTTAATTATTTTTCTCAAGTATATTGCAGTTCTCTGAAT TATTCTGAATTGAAAGATCTTGTTTACGCTTTATAGTATGGAATTCTTTA GTCGCATTTTTGAAGGAATCTTTTTTTTAATGGATTGAGATTTTTCATTA AAAAAAAACAGGGTATCTATGACCTGTGTGTACAATATATNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGT GTGTACAATACATTGTGTATATTTTGTGTAACGCTTCATTCAAAATGCAT AATGCTGCAGGAGTCACGTTTCACGCGTCTTCGTCGTTGATGTTCGAGTA TTATGCGAAATTTTCGACTTCAAGTCGTCTTGTTTGTATGTCAACGAACG CTTATAATCCTGTCTTTTTCAAAAAATCTTTCTTCTGGGATAAGCAACAA GATTTTCGAGTTGTCCTAAGTAGCACTTAATAAAAATAGGATTTCAGCAG GATTTCAATTTTAAAGACTGTTTGTCTGCGTCTTACACGGGAGAAAGTAA GGTTTATTCATTTTATGTTTTTTTTATCATCTACAGTGGCTCGTTTTGTA TGCTCTTGACTCTATGACGAATAATAGTAACCACTTCTGCTGATATTTTC TCCAAAAGTATTATAAAGTTTAGTTACATGGTTGGACTTCGACAGTACGT TAGACGCTAGTACAGTGGAGTCTCCATATTCAAAAATTTGTTCGAATTAT GGAAATCTTGAGTTTTGGAGATTGGTATATAAGGCATTGTTAGTTAACTG AAGGGACCAGAAAACTTGTTCTAGTCAAGGAGACATTCGAGTTATAGAGG TTTGAGTTATGAAGACCCCACTGTATAAAGATTTTGAGGTGTACATTTGA ATCGTGCAATCTTTCCGAAGCAGTAAAAAATTGTGTTTATTCTGTTGTTT GCTTATTTTTCCTTTCATTGGCAGTGTTGTACTACAACTAGTTGATATTA ATGTGTTATTTGCCCATTCAAATTTTTGTACCCTAGTTGTTACTAAAAAA AAACATTTTGCAAATCTATTTGAGGGTTCATTTTTAAGGCCTTGTTGCAA ATCATTTTTAGAATGTTTTGATATATTTTTATATATTTTTTTAGCTTTTT CTCATTGCAGCTTGTTCTGAACTGAAAAAATTTCTTTTACACGAACATAG TTGAAATCTCTTTACAACAGTACTGGTATCTCCATACTTGTCTTTTAAGA TTGTATTTTGAGGGATAAGAAGCATAAAGTGAAAAATTACTCTAGTTAAT TACAGAAAGTTTTTTTCCCTTTATACAGAAAAATGTCCTTTCCCTAAATG GTAGCCAGGAGAAAGATCAAAGCAGTTGATGATTATGATTTTAATTCAGT AGAATAACTAGAGGTTCTTCATTTTGCTTTTTTAGGTCATTCTAACACAA TCTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCA ATTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTT CTTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCT GTTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGA GAAAGGTTGGTCTTTTTAACATTTTTACTGTTCCCCTGTTCTGTAATTCG ATCACATGCTAAGAGTAGTTCGAGATATGGAGAGCTCGAGTAAAGCTATT TTCGGATGCTTAGTGCAAATGATAGTTTACGAGTCTAAGGGAGAGTTCTA CTTTTTTGGTTGGCATGTTGTCACAGTCTTTTTGGGGGACACAGGGCCCA TGCCACCAAGGCAACAAGGGCTATGTTTACTTGGAAGGGACTTGGAGTAA GTTCGTTGCTTGCAGTAGTAGAGTGTCTACTATAGAATTTAGAGTCAAAA GGATGGCCCCAATGACAATCATCTTCAGGAGGTATTAGGCGGGACACAAT TATGAGAAAGAATCACCCAGGTTATTTACAAGAAGGAAAAATCACTTAGA TTTTTTGGTCACCGTTGGAAACACTTCAAGCATTCATTGAGAACAAAAAA GTATGAAAAAGGAAGAAAGAAAAAATTGAAATCCTCAGTCCTCCTGTGCT TTGGGTTTAATCCATATCAATGAATGAGATTTATTAAGTAAGCAAGCAGT GTAATCTCTCATCTGTTTTCAAATGGTATCTGACAAGATTACATAAAAAA TGGATCAATACGATACTTTTTCATGTTATGTTTGTTAAGGATTCAAAAGG GATAACATACGATTATAATTTAGCTTCAATAATTTAATGAACAAGTTTAT TGCTCATTTGGCTCTCCTTGAATGTAATATCAACTGTGCTGCACTGTCGG GCTCAATCGAACTTGCTTTCGTTTTCAAAAATAAAATGGACATACCTATC TATAGTACATTTTTCCTATAAGAACTTTAATCAAACATTGAGGCAGATTT TTGTCAATGTAACATTGAAATGTCGATACAAGTAAGGTGAAGAAGTAAGC TGGACATGTTTTGGATAACCAAATTGATTATTTCGAAACTGCAAACTTTC CTTATTCCTATACTGGAAGGTGTCATAAACCTTCATTATCCCTTAGGTTG TTCTTATAGAGCTAGTTTTTTGTGTTTTCTATCCTTTAACATTGGACAAC TGAGTGTCAAACTGTTCAAGAGAAAGTCTCCCAAGAAACAAATTTTAACA AAGTTTATGCTATATGGGCTGCTCGTTTTTTATTTTCATACTGTAGTTCT TATGATGAGATTTGGAGAGATGTATTTCTATCAAAATAGAAGATTTTTAA TGAAAATTTTTTTTATATCAGTGCCGGGAGACAGACAACATATAAGTGAT ATTTTTCATACGTTTATTTCTGTTCATAATAATCAAAGTTTTACTATGTT ATTATTACACACTGATGATTGAAAATGAAGAATTTCGCATTGGTGATTGA AAATGAAGAAGAGAAATTTACTTTACTTTAGAGATTCCAAAAGCAGAATT ATATACTGTTATTGAAAACAAGAAATCGTATGGAATCATTTTTTCACCAG TATTATAGTTATAGATTGGTGTTATGACGTGTTATGAAAATATCGAAGAA TTTTTTCAAGAGGAGATTATTATGATATTTTGAAAATAAAGAACCCTAGA GAACCTCTTTTGCTATTTGGGGACCAACAAGGACAGAAATAAAAAGGGGA AATTAATTCAAGAAATAGAAAAGAATTAAAAGGACAACAATAAAAGGACA AGGAAATCTTAAAACAAAAATGAAAATCTTATCGAAACGTATTTTCAACA AAGTCTTTCAAGCTCATGGTGTGTTTCGTTCTTTGTTCGATCTCATTTCT TACAGTTGACTCTCTCTAATTCGATCTTCAAAGGCACCAAAGATTTTCTT CGAATAATAGAGAGTATTTTGCATGGCTTCCCCTTGACGGAAACTGGGAA TCATTTCGAATTACAGAAAGATTCGAATAATAGAATTTCGAACTGGCGAG AGTGCATTATATTTCTTATTGAGTACTTTTTCTATACACAGAAGGTCTTA TTCGATGGGCAGGGCATGTTGTGCTGCATTTTTCCAAGGAACTAAGTGAT TTAATCAAGTCAACTAAAACTCCCTGAGCTCTCTCTAGAAAGACCCGTCG TTTGTTAAACCTAATATTTGATCCATTCTCATAGAGACCCCAAGGTAACT TATAGATGCTTTCTCTAGATTTTAGCTAATGCGATGGAGAGAAGTTAATA CGATAGTCCACCTTACTCCAAGTCAATCTTCTGCTTTTTGCAATAAGTTT TAAACCGAACTCTGAGGTCAATGATATGGCAATGTTGTTTGGGAACCTTG TCACAAACTCGTTAACATAGTTGTAATAGTTTTATCCTCTTTCCCTTTCC CCGAAACTAAATGGTGGTCTAGTCGAAAATATTCTTAACAACGTAAACTC AACGAGATTGTCTCCTCCACAGATAAACTTCATGATTTTTCATGCATCTT TGTTTGCTTTTCTTCATTGCAGTGAGCGTCGAACGTGACTTGGATGAGAT GATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTA ACGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTATGTATA GCCTAGAAATCTAACCCAGATTGATTCAGTCACTTAGTAAAATCTGATGG TAAATTGTGACTGAATATCTGTTTTTCGAGGCAAACTTAAAATTCCGTAC GTATCATAAAAATCATTAAAGCGCCGATAACGCTATATTGCCTTCAGCCG TATCTTAGCCTTATAGAAACTGGCTTGGTTAACCAGGCTAAGGTATATAG AGAAAAGAAGAAAGGAATACAGTGTTTTTTTTTCACTTTTGCACTTTTAA ATAAAAGAGACAACATTTATTGTCCACTAGTTTTCCCTTCCCTTATTCAT TTTCTAGAAAATTCTATACCCCTCATTGTATTCCTTGACAGTATTTTCAA CAAGTCTATAGCCCTCTTTACATTCTTTGAGAGGATCTTCCACACCTTGA TACTTTAATCGCCATCCATGAGAAGCTTCTTTATTTGTAATGCAAATGAC TTGNAATCTTCAACACCTTGATACTTTAATCGCCATCCATGAGAAGCTTC TTTATTTGTAATGCAAAAGACTTGCTTTATTCTGCTATCTGGCTATGTGT CAGAGGTTTGGTACAAGGAAATTTGAATTCTCCTAATAAAGTCAGCTTAA AGTCGATTTATTAACATATGAAGCTAGACAAGCTGGCTGATGTTTTTAAA ATGGTATCTTCCTTTCATTTTTTATTCACTAAAGCTCTTCAAAAAAAATT ATTTTAAATTTACAAAAAAGTCTTCTATGAACGAATAAAAAAGAAATTTT TGATATGTGCCCTAGCAGACTCTCATGATACTTTTAGTGGGGCTTTGGGA TTTTTTGTGATACAGTTGGCTCTCTCTAATTCGATTTTCAGGGGACCAAA AATCTTCTTCTAGATAAAGAAAGATTCGAATTACAGAGAGTATTTTATAC TATTTTTCAGCTGAGGGAACCAATATTTTAGTTCAAATTGTAGAAAGCTT CAAATAGTAGAGGATCGAATTAGAGACTGTTGTTTGTAATATCAAACCTG GTTATTTATAAATTTTGAGCGTCAGAGAGTATGAATTTTAAAATGGATCG CAAGTTCGATTTCATCTTTAAATTAAAAATGATGCTTGTCATCTACCTTA AGGTACCTTTGTAAAATGTTTTCTCTTTTTCAATTATTTACTTCATCAAA AGCTAATATTGCATTACTGCCGCTTTCTGTGCGATTACCTGCTAGTAGCA TCCCTTTGCTAAGACATTCCTTCCGTCCGCGCGTCTAAAAAATCATTTTG ATAAAATACTTCCGCGCGTGCGAAATTTGATTTCAAATTTTGTTTCACGA ATAAAATTCTTAAGCAAACAATTGATGTTTAAATGTTGCGTTAGATTAGA ATATCGTGTTTGGCTAAGAAAGAAAAAAAAGAATAAGATATTTTTGAAAG TAAAAACTCACATGAAATGAAAATATTTTAATGTTTTATCGTTTGTCAAA GGTCAAAATGATAATTGTATATTAAGCCTCGTTTTGATGTAGCCTCGTTT TAAAAATATATAAAGAATGCCAGGAAGTGAACGTCCGTGCTCCATTGATC TCTATTTTCAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTT GAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATAT CGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTC ACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGA TATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGA GACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGG TATGCCCGTAAACACGTGTTTGCGCTTGTGGTGAGCGGAGAAAAATAGAC TACTCCTCAACAGGGTCTTAAGAATAGACCTTTTCATAAATTACTTTACG GACATCACTTGCCTCGTTTTGAAATTATTGCCATGTATGGTGATTAACTC CCGGCAGATTTTATTAAAACTACTTTCTATCTGTTCATTAAAAAAATCGT TTATGTATCATGAATACGAGGCAAGTGATGAAAAGGTCTATTCCAAAGAA CTAAAATTCTGAGCGTTACTTCTATCCGCAGACACGTGTTTCTCCCTTCC CAGTACTCATCAGTGTGGCTCCGGTAAGCGAGAACATATATAAATAAACG GATCCGTCCCTCGTAACTTTTGGTTTGACAAACTAAATAGTTCTCTAAAG ATATCTTTTCCTTACCTTAAATTTTCCTGTCCCTTCCTATCCTATGTTTG AGTTTCCCCTACAGTATTCATCGTTGTTCGTTACTTATTTTGTACACAAA TCTTCATTCCAGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAAT GGAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATT CTCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTG GTTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGGTTTGGA AGTGTTTTCGTCTATTTCCTCCATGCCGTAGATCACTGACCTTTATATAC CCTGGACCAAGCAAAATCTTTGATCGGAGTATTTTGAAAAGTGGTACCCT AATGGCGGCACTACTCAATAGCGGTGTAAATGCATCGAAAGCGCCGCTAG GTCTACTTTACCTCTAGACTAGAGTCTACTTCTGGCTGAACTTTGCTTTT TGATAATTTTTGATGACGCNTAGGTCTACTTTTCCTCCAATACTTTTGAT GATGTAGTGCCGTTAGACGTTAATTTTTAACATCGGGTACCAATTCCAAA AAAACTTCGATCAAAGATGGCGGATATAGCTAGGTCCAGGGATATATAAA GGTCAGTGCAGTAGACACATCCTTAAGGGAATTTTGGTTTAGTATTTTTA CCCTTGTATCTCTCAATATATTCTTTCAATGATATCCTGCCTGGAACTGA ATGGTTGGGATAGAATTGTCTAGAAGTTGATCAACATTTCTGATGGTTGT TGACAGAAAGGGGACCGTAGATTTCACTTAAAACTAATTTTCAAAATAAC ATTCTTGCCCTTTACAACATATTTCAAGGCCTTTTAAATTGATTTAACTT TTTTTTCTCCATAGAAACCACCTACAAAATCAGCGTCGAGACAGGAGACG TCGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAA TACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAA AAAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCAT GGCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCA AACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGG ACGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTG CCGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACT GGTGCGTTACTTTANAGGTGCCGTTTTACGTGAAATCCCTGTTGGTGCTA TGGCCCTTTATAAAGAAACTGGTGCGTTACTTTAAGATTCCATTTTTCAA TTTTTTTTTAATCTATCACAATGTCGAGTCTCTTACCTCGGACTACAACT CGAATGTCTCCTAAACTCAAACAAGTTTTCTTGTACCTTCAGTTAACAAT GCTTCCATACTCCATAACTTGAAATTTCTATAACCCGTGTAAATTTGTGT TCCCCGTGTGGGCTTGAGTTATATAAACTCAACTTTATATACGATGGGCG TGTATTAGTAAAATACCACAGGGGATATTTTTTAGAGCCCCCTTCAAGGT CTTCTAAAAGTAACCGTAATATTGTTACAATTGCTTCCTCTAAAGAATGC ATTGTTTTGAAATTGGTCCCTTCACCGGCTACAGTGACGATTACTTTCAA CAAGTTCGATCATTTCTTTTCAGCTCCAGATATCTTGGCCCGTAAACACA AGTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATAT GAGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGT GATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCT CAAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAGTA AGATGATTTTTTAACATAGCATGTCGGGTCTTCCCTTATCTAGCCCGGGG CCACTTATAGCTTTTTGATTGACTTGAGAGATCCAAATTTCGGTGGTGTT TTCATATTTTTACTATATTTTTATAAACTTGGGGTTTAAGATTACTATTT TATTGCTTTGATTGATGTTTTTATATAATTTTTGAAAACGAAAGTGAAAA ATTCCAAGATGTCGATATCCTCTATTCTACTTAGCTGGACCCGTTTGGAG ATTCCTCGAATCACCAATATTTGAGATGAATTTTTTTCATTTTAAATTTG TTCTTAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACG TCACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGA AATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATG CGCTGGATAAAGAGTTTCGTCACAGGTATGAGTTCAAGCCATTTTGGTCA AACTCAGCTTTAAGAAAGCGCGGAGACAAAACCCTATCTTTTTAAATCTA CGCTTTCTGTCTGCATACTTCTTATAAATTTCAAAAATTGGAATATGGCA AAACCATTGCGTTCTAATAGATTTAGAACGCCATGGGCAAAACCAAAGTT TGGCCTTTTTAAAAAGACATTCAAAATTTTTGAAACCTTCGGATGTTCTT CTTAAATTGTTTTTATTTTCACCAGTTTTGGTGAGTATTTTTATATTTTC TTAAGAAATCAGTTTTCAGAGTTCGCAAAGCCTCAAAATGTTCTCAACTT GTTCTTAATATTTTGGCAATCAAAGCCGTATATTCTTATATAGTTTGTTC TCATATATAAAAACGTTTACTAACGTGTACATTTCTTTCTAGATACGTAT CGGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAAT TCACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCA AAATGATGATGTTGAAAAGGTTTGCCAACTTGTTTTGTTCTCTTTTTCAG ATGGATTTCCGATTCAGCGAAGTAAATAATTAGGCTTTCCCGTCTCAAAA TACTGCATAACTAACTCGCTCAAGTCTCAAGAATATATGCAAATTTGCTG TGCAAAAACCATTTTTCGGGCTCAGACAGGTAGAAAACCCTGCTTTGACC ACTGATTGTGTTTTCCTTTTTTCATTATTTTATCTTCACGGTAGGCTAGG GGCTCAAGTTGTGCTGCTGAATCTGTAACATCATCGAGGAACCATTAAGA TAGTGACACCATTAGATTCTCTGACTACTTCTAAAGACTTATTTTTAAAC AACAAAGTAATTCAATAAAAGTTTTAACAGTGATGTTTCAAAATATCAAA AGAGACTTCACTTTCAGACTACAATGCAATGGCTGAACTTGTTTCAGAAG TAGAAAGAAATCTTAAAACATTCTACGATTTCATTGAGCTTCATTTGGAT TCAGAATATAGTATTTTAATAGTCTATAATATTAGCGGGATGCTAGTTAT GGAAGCTTATTTCAGATCACAAGACTAGACAGAGTCTTAGAACTAAAAAT CATCTTGTCTAATCATGATTCACAAAGATAAAAAAGAAAGCTTAAGATGA TGAATTAATCATTCTATAGACTAGAAAGAACCGAGAGGATGATCACTACT TTGGTCATTAATTGTCCATTCTGCAAAATTTAAATCTCACTTTTATATCT TCTACAGCACGCGTGGTTTGCTATTTTCTAAATCAAATAATTCTCAATTC ATACGAAACAAAGACTTTTAAAAGTCGCCGGTTTTAAAAATTAAAACAAA TCGATTTGGTCCCAAAAATGCAAAACTTTAAACTTTTAGGCTCGCAATTT GTTAACTTTGTTTACCATTATGTAATTGCAATAATTTGGCATTAGTCAGT TTAGAAAATTTCTATATTCTTATAAAACATGTCTACTCTATAAAGAATAC GATGACATCATTTTTCATTAGTTTTGTTTGTTTGTTTATCTACACAGGAC CTCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAA TACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGA AAGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGA TTGAATAGCAGGAAGTTGGGGTAAGTCAGTTTCATTGTTGTATATTTTGT ATTGATATTTGAACGTTTGAAAAAACTTGTGAACTAAAGATAAGCTAATC CATTGGTTTCAACTGATGATTTTCAACAAACTATCTTAGAAAGAGAAGAA AAAAGTTTTTTTGAAGTGAACCAAGAAACATTCTACTAATTACTCAAGTA TAGAATAATTTAGGGATCGGGCTATTCCAGAAATAGTCTGTACCCCCTAT GTTGAGGTCCAGGGCAGTCTGGGAAATGAAAAATCTAGGGTTTTCTGGTT TTTTCGAGTTTACAAATCCAGGGTGGTCCAAAAAATAAGTACAAAAATCC AGGGGGTCACCTTCCCCAAAAAAGACCTCTTCGACATAGGGGGTACAAAT CTTTTCTGGAACAGCGAATTCCTAATTTAGTATTGGAAGTGACGCCACGA TTGCACTCTCTTGTCATTGACCTAGAAATTTTTATATGTCAAATTTCCTT TCAGTTCGCTACTCAAAGCTGAGCTGATCAAGTGCTTTAAATACAGCAAA GTGAAAGCTCTTAGAGCTTTGTCCTATATAGTACTAGCTTTACTCGTTAA GCCTATCATCAGCTAAAATATATGTAATGGTTGTAAAGAAAAAATTCTGA ATATTTTTATAAAAGTGATTTTATAAGAACAATCTTATAAACAATATTTC AAAGGTTTTGATTTAGTTCTTTCAATAAATCCTGAAGAAATATTTCTGGA AATTTATGTTTGGTAAAATGTCACAAATTCCTAACTCTTATATCGTATAG ATTATTAGTTTAAAACCAACAAAACTATTCTTGGGCCATTCCACATTAAG TACTTACATACCTTCATGACTGATATACGTCAAAACCTTTGGCAAAATGC GGGGGCGAGCTTATTGTTCTTAATCTGCACTTAAGAGTGTTTTCTCCCTG CTTTTTTTGATTTTGTTGTTCTTGCTCGAGAGCTTTTTTCAGCTATGCAA TTTTTTTTGTAGAGTACAATTTTTTTAGTAGAGTTCACTTTGATTTAGCT GTATACACATTTTTACTGGAGAGGACTTTAAATTAGTATTCGTTTAGATC TTGTTGGTATGCGAATAAAGGTTATTATGATATTTGTTCGTTTTTCATTG TGTTTAATCACACAGATCGGCATTCTTGACTACACTTTTTTTTACAAGAA CCAGGAAATTTTGACAAGGCTCGTTTGTTCTTATTTTTTGGTACTTTCAG CGTCAAATTGTTCTTATCCTGTTCTTATTTATAGTGTGAAATTGAATTAT TTCATGATGTATACCCAATGTTTACTACTTTGACCCCTAAATTGCTTGAA ATTGAGTCAGTGTTCAAGCATTGTTCTTAAATTGTTCTTATTTTTGGCGA TTTTGAGCCTCGTTGTTCTTATAAAATTGTTCTTAAAAAAGGAAAAAAAA GTGTATTAGTAACATATCATATATTTCATATTCATTAACTTTCATCTCTC CCTTTAGATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAA TCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCA TACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATG ACCTCAAGGTATGTGCTTTTGTACTTTTAATCTTTTGCTGTTGTAGATCT TTTGCGGAAAACCTTGGACAGCCATCCTATAGAACAGGATGACTAAATCA AGGAACTTTAATAAAACAGATTAAATTGGAAAATAAGCTGAATTTTGCTC TTCTTTTGTCTAAAATGATTTATGATAATTTCAAAGTCTGTTCTCGTTAA CGGTGTATTTCTTTATGGCCTTCATACGAAAACTTTGTCAATGCCAGTAG ACTAACACCTTCGAAAGTGGTTAATATGTGGTATGAAGAGAAATACACAA TTTGTGAATAGACTTAGCTACTAGCTAATATTTTGCGATTCTTTTTCTCC TTGCACAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGA CGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGC CAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAG TACAAGATCTGACCACAGGACATAGTATGTCTCTTAGTTTTTTGGTTGTT TGTTTTTTCTGGTCATTTTGAATGCATTGCTCCCTTTTTTTATCCAGTAA TTCAGTTTTCAATTCCGTTAACCTTAGAAGATCATTTCCTCTACTTTACC ATTACTGAATTCAATAATTCCAAATTATTTTAGTTTTTTTATGTTATTTT GATTCATGCCGTCCGTATGAACTAGAATTATCAGCCAAAACTTCTAAAAA TTCAGAAAATTGATTTATCAAAATATAAATGATTGTTTTCTCGAGCATTC AAAATTTCATTCATTGTTTTTTTTCTTCAAACTTTCAGGCAAACGATTTG ATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTC GATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCA CAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGGTATTGTTGACAT TGTTTTTTTTGACTCGTAACTCTTTTTTTTCTGATGATCTTATAAATTTT AATTAACTCTGATAACTGGAGATATTGGTCGTGAGATCTTTCAAAGAACC ATGAATTTTCTTAGTGTTTTTAATTTAAAAAAGGAATAAGCACTGTATTA AATGAATGAACCTGAGAAATATTATCTCGCTCAATTTACCTTGATTACCC TGATTACCCAGATCACAGCGATCCGCCAGTCTCTCGTATCTTATCGCATC AAGCCTTTCATAATCTCAACAATTTCTCTCATCACAGATCATGAAGAAAT CATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAA GACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGT TGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTC TTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCA GAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACA AACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAA GTAAGAGAATTTTTCCCAAAGTGAGTGTCTAGGATAGGAAATCTTGGTCA AAATTTTAATGATACCCTCGGACACCCTATGGTTTTGATCATAATTCATG TTATGCACTATTGCAATGTCTTCTGGTATTATATCACGGACCCAATAGCT GATTGGTTGTATACGTAAAATCAGTCAATACGTCACTTTCAACCAATCAG CTATTGGATCCACGGAAGACATTGCAATGGTGCATAGCATGAATTCATTC AGTTAAGCCGTCTGTAATATTTGTACATTATATTGTATCAATTAATCTGA GTTGCTCGTATTGTCTCTTCTTAGCAGATTCATTGGTAAAAATAGAAAAG CCCGGGAAACAATTAATCTTAAGTGATTTCCTAACAGTATCCACTTCCAG AAGCAATAACACCAGGCCTTCAGCGATTCGAAATAAATGGTGGTGGCTCG ATCTAATACGCTTCATTGGAACTCTGCGATCCTTTCTTGGTACTTCAAAT TTGGTTACCCATGAGTCTACATGGGCTACCTTATCTTTGAAAAAAATGAA ACGATAGGTCGCTTTTGTCGTAGTGCGTTTTATTACCTAGTATTATATAT GCTTATAATAAAAATCAACAAAAAGTCATCTAATTAGACCCATCATTATC ACTTAAGATTGTTTTCAACGGTAGGAGGTAGTTATAGTAATTATTTAAAA AAATTTTTTTCCCTTTTACAGTGTATTCTTCAACGAACGAGAACAGTATC GGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGA ACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGG CGGCTGCCGTACAAAAACAAAACGTAAGTTGGTGCTGATTTATGGGATTG AAGAATTTTAAAACCCTTTTTCATTAGGTCTTGTATTGGTTCAGTGGATC CTCTCTGTGTCAAAGATTTTTATAAATTGAAGTTTGGAATTTCTCTTTGA ATCTACCTTTCAAAACAGTCCTTTCTATGGGCGAAAGTTTAAATTTGAAA AGGTATTTCAGCTGACAACGTTCTTCCCTTTTTCGTTCTCTGCATTTTAA AGACTATCATGTCTAGTGTTTTTACAAGTTCTTTATAAATCGAGTCTCGT CGGTTTGTCAAGCCCTGCTGTGATGAACCTACCGAGTTAAACTATCGGTC CTTGATGAAATAGAGAGAGATCACTGTACAAATATTTGACCAATCAAATT GGGTTTAAACTAGTCATAGCTTTCACTAAATGCCCACGCAGAAGATCATG TCAAGCACTTAAAGCTTTTAATGCTTTAAAGATTAAAGTAGTAAAAATAA TCAGGAATAATTGATTGATTTAATTATTGAATGATTGATTAATTAATTGA TTGAGGCATTGTTTGAAAAAAACATTATATTCCATTAACACAATAGACCT TTTTTTAAAGAGGCAGCCATGTTGAATAATTATGTACTCCAGCATAAAAA CAATGATACAGCCATGCATAATTTTTGAAANNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATATATTTCAAAAATT ATAGTATCATTAGCTTACTGGTTTTCACATCTTGTTTGTTTTTTTTCTCC CAGTTTCTTTCTTACAACAATATATGTCATTATTATTATTATTCACAATA GACCTTTTCTGATAATGCCGCAGACATCTTAGATTGTAGGCAAAATATAT AGCGGTGACTGAATAAATAAAAAAGGCAACCAATCAGAAATAGCTTGTTT TTTTTTTCATTGGCTGCTATAGTTCAACATTTCTCTGTTGCTACTTTGCC TAATAAACAATAGTCAAGAATACTGCGTATAAAATTTATCAAAAAGTTCT GCGCCATCTTAAATTGGGTGAAATAGAAACCAATCCTAGTTAAGGCCCGG GCTCCACTTGCGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNGACTAAATTACAGTAGTTAGTAT TCAGTTTCAAAGACAAGAAACTAAATTTGACATACCAAACACTTTTTCCA GTCAATGAATCAGCTCATCATTATAACCTTCCATTATAACCAGTCTGCCA TTTTGTTTGTTTTGATTCGCACAAGTAATATTGTAATTTGTGTTATATCA TACACCTGTTATAATTTGCATTTATAACACTNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNC TATGAGTGCCTCCTCGTCGCTGCGCTCCTGCGGGGGCAAAAAATTTAGTC GGAAGAAAAAACTTTAGAAATTAGTTAAAGAAATTGAAAAAATTTGTGAT TGTGGTGACTTTTTATTTGGTTTTGAACATAAAGAAATGGTACGTCAGCA GCCCTCCGAAACACTTCAAACATCAGGTAAAACTAACTAAGAATCAGAAT ATGTCTTTTCCACGTCTCTATAGAGGACGTTACCAGTCAAAAATAAAACC TCGAGCTTATGAATCTTTCTTAATTCTATGCTTGCGTCGATTACAGCATC TCAAATTCTTCTGAAATTTGGTACGAAGATTTGTCAAGATTTTAGCTACT GTATTGAAAAAATGTTTTTAAAATATTTCCGGGACACCTACTAATGGTTG CTAGTCATTTTAGGAAAATAATGATAGCATGTACCAAACTTTTCTTAATG TCGTAAAGGAATGGTCAAAAAATCTAATTTTTTTTTAGATTCTACACGTT TTTTTTTTTATTAGAACCCAGTTTATAAGAACATTCAGGCTGAAATTCGT CGAAAAATTAAGAACGTCGCAAGAACATGCCCAGCCTCAGTTTGGAAAAT AATGACAAGAAACTACAATTTTTTTCTCTTTTCAAGCAGTTTCAACCGAA CTTAGAGATGGGTTTTCTAAAATCGAGAGTCAAATATTGTCCAAATTTTA CCAATTTTAAGTGCTCTTTATTTTGCATGATATTGTCGATTTAGAGTAGT CTGAGAAATTAAGAACGCATTTAAGAACATTTTAGGCTGAAAATTGCTTA AAAAAAGCACATCCAGGCTCAGCCAAATTTTAGGTGTTCTAATAAACAAA AAACGTGTACTCGATAGCCTCCCCATAAACCAAAAGTAACTGTGAATATT TAAAATATTATTACCAAACGAATCTTTAAAAATTAATTCTTGAAAAATAT CATTTTTGATGACGCAAGTTTTGATACTATTTTCATTCAGTTTTCAGTCG ATATAAAGATTTTTTGACAGGTTACACGCAGTGTCGGTTTTTCTTAACTC CCCTGTCACGTAGAAGGATCATTTTCTTTTTTGGGTATCAAATATTTAAG AAAAAGATTGAAGAATTTTGGAGAAAAAAATACTTTTGGGGTTTATCCAT GCAGAGAGTTTTAACAAAAATATCCATATTTTGTGGGTATATGTTAGTTT TAAGGCGGTACCAAAAGCAAAAGGTGTTTTTTTTCTTTTAAGTTTTATTT GGATTTTTCTCACCCTTCTCCAAAAATCTTTGACGATTCTTGTATTCATT ACTTATTTGTTCAATCATTAAATATTGAAATCTTCATTTTATTTGTAAAA GAATTTTGATAAAATATCATTTTGAAAAAAGGTTTATATAGCTGTCTGTT GTATGCCGGAGAAGGTTGTTTTTTTATTTTGAAAAGCTAAGCTTTGGTTT ATGAGCGACCATAAAGCTTTATAATTGATCGATCGGTAAGAAATCGGAAT CTGAGACTTGGGCCATTGGAACCTTATAAGGCTCTAAAAAGGATTCATGA CTTGAAATCGATGGAAAATTACCAATTTTATATTTTCTTCCAAAAAGTAC ACCAAAAACTTGTTAGGGAAAAATTGTCTGAAACCTTTAGACTTTGACAC TATAAATTTCATTACTGAACTTTTTTCATACCATAGTCCATCCAATTGGA GATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCA CGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAA GGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCT GGGTAAGGCATTCTTACACTTTTGATTCCGAATAGAACTCATTCATCCGT TCGTTCGGCTACGTCAAATGCACCCCTGTCTCACAGCCTCGGTAAAACTT TTTTCCTCACTGGGGATAAATTCCTTTTGAAATCCCAATGGGGATAGAAA TTCTATTGTAAAAATCCAGTGGATATGATTTTGGAGTACAATTTTCAAAC ATTGAAATTTCGAATAGGGATAAAATCAAAGTCAATTTCCCAGTAGGCTA AAATTCAAGGGTATCTTCCCACTGGGGACGAAATTTTGCAAAATTTTCCA GTGGAATTTTCTTGGGTCCCAGCGGGGACAAATCTTCCTTTGTTTCAAGC GTGACTCTTACTCTAGTAAGGCCTAAAAGTCTTAAGCTGTCNCGGAGAAG GTTGTTTTTTTATTTTGAAAAGCTAAGCTTTGGTTTATGAGCGACCATAA AGCTTTATAATTGATCGATCGGTAAGAAATCGGAATCTGAGACTTGGGCC ATTGGAACCTTATAAGGCTCTAAAAAGGATTCATGACTTGAAATCGATGG AAAATTACCAATTTTATATTTTCTTCCAAAAAGTACACCAAAAACTTGTT AGGGAAAAATTGTCTGAAACCTTTAGACTTTGACACTATAAATTTCATTA CTGAACTTTTTTCATACCATAGTCCATCCAATTGGAGATGTCAAACCGAC GTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGAC GACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAA AGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGGTAAGGCATTCT TACACTTTTGATTCCGAATAGAACTCATTCATCCGTTCGTTCGGCTACGT CAAATGCACCCCTGTCTCACAGCCTCGGTAAAACTTTTTTCCTCACTGGG GATAAATTCCTTTTGAAATCCCAATGGGGATAGAAATTCTATTGTAAAAA TCCAGTGGATATGATTTTGGAGTACAATTTTCAAACATTGAAATTTCGAA TAGGGATAAAATCAAAGTCAATTTCCCAGTAGGCTAAAATTCAAGGGTAT CTTCCCACTGGGGACGAAATTTTGCAAAATTTTCCAGTGGAATTTTCTTG GGTCCCAGCGGGGACAAATCTTCCTTTGTTTCAAGCGTGACTCTTACTCT AGTAAGGCCTAAAAGTCTTAAGCTGTCTATTGAGTAGACTACTGAAGGCT TTCTTATTCATTTGTTTGGCTAATCTCAAACGCATTATGCTTTAAAAAGT CAAAAGCAAACTGATTTCAACAGCGCTTAAGAGAATTTCCTCATGGAATT TGTTAATCCGAAAATAGATTTCTGAATTTTTTGCTCCAGGATTAATCAAA CGAGGCTTCTGTAGACTCCTATGTCGTCTTGTTTGCATTTCTATTTCCGC TTTGACACCACAGGCTTGTATGTTTAGGATTAAGGCTTTCAACGAACGAA TAGCTGAAGTATAAAGTTTGATATTCTGTCTATCCATTGATGAGTTGAAA TTGTGATCTCAGTGATAATACACAAAGATTTTTGTTGCTGTTTTTCATGA CTTGCATCATGTACTAATTTCATGCTAAATCAAAACCAATGAGTTGTTTG TAGTTATACCTGATTGATTGCCCTTTTAATCGTTTGGGTAATTTTTGATG AATTGATTGAAGCTAAACTAACTAATTTTTTTTTTTTTTTTTTGCTGATT TCTCTTAATTTCTTTTTTTTCTCTCTCTCCATACCTCTAGTTGATTGGCG TCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCCG ATATTCAATTGAACGAAAACCAACAGATTGGTACTACCGTCACCGAACTA GAAGCACAACTTGAAAAACACAAGGTGAGTAATTTTGTACTGCACCCTGT TTTTGTTCGGTTTTTGTGTTTTTATAGCGAGTTTATGTATTTGCACTTTC GAGGACGGTGGCAAAGCGACTGAAGCGATTTAGAATAACCTAACCCGGTT CTGACCCATAAAATCGAGGACGGTAAAAGTGCTGATTTACCATCGTCCTC AGTTCAGTTGATCAGGATCTAAACAAATCAGAAGCTAACCGTCTCTATTG CAGAAAAATATACAAACATAAACTCGCTTACATCATCAGGCTGTAAATTA ATTCTGGATAAAGATAAGACTTTTTTTTCTGTGGAGAATCAGTGCACTCT TACCTTCTTGGTAAGCTTAATATAAAACATTCCAAAAATAGTTATCGAAT TATGACCTAATGCACTCGTGTCATTTATACTGAAAGAAAAAAAACCACAA AGTCTTAATATTAAAGAGATCTGGGTCTGAACTACACTTCTCTATCTTTC CAAGCACACTCTTCGGTAAAATCAAGTTTGGAAGAGAGGTTACTACCAAG CAGTGTTGAAATCTTCTCTATCTTTCCAAGCATACTCTTCGGTAAAATCA AGTTTGGAAGAGAGGTTACTACCAAGCAGTGTTGAAATCTACTCTATCTT TCCAAGCATACTCTTCGGTAAAATCAAGTTTCGAAGAGAGGTTACTACCA AGCAGTGTTGAAATCTAAACTTGATATCTTTCTATCTGATTCACTCAGAA TTTGTTTTCCTCAGGACGAATTAAGAATTTAAGAGTTGTTGATGTCTTTA GACAAAGTAATGCTATGATGGTAACCTTTGGTGGATTTGTTAATTATTGC ATTTCTTGCGTATTTCCTGCTTATTGAGACTTAAAATATAAAAACTTGCT TTTAGTATTTTGGCAGTCGAAGCCTTACATGTTCGTGTATACACTTTTTT TAACAGAACCATTAACATTTTGCTGCAGCTTGGCTGTTCTTATTTTTTTG TCACTTTGAGCCTCAAATTTTTCTTATCCTGCTCTTATTTTTTGGAGATG TTGAGCCGTATTGTTCTTATGAAAAATAAAGTGTACTATATATCTCAATG TGGGGGTCCTATTTTGGAAGTCCTTCAAATGTGTTGAGTCATTTTCTGAG CAAAGATACCAGCTATTCCTTTGATTTGGACTATGTATCACCTCTTTCGC AGATGCTTTAACTATTATCAAATGTCATACCAGCAGACAAGATTTTGTTC GGAAACTCGAACTCCCTTATCATAATCTTGAGCTCAGCTATATCAGTTTC ATTGTTCCAATTTTTCGTCTCCCCTATTATTAGTATAAAGTNCTGATTTC AACAGCGCTTAAGAGAATTTCCTCATGGAATTTGTTAATCCGAAAATAGA TTTCTGATTTTTTTGCTCCAGGATTAATCAAACGAGGCTTCTGTAGACTC CTATGTCGTCTTGTTTGCATTTCTATTTCCGCTCTGACACCACAGGCTTG TATGTTTAGGATTAAGGCTTTCAACGAACGAATAGCTGAAGTATAAAGTT TGATATTCTATCCATTGATGAGTTGAAATTGTGATCTCAGTGATAATACA CAAAGATTTTTGTTGCTGTTTTTCATGACTTGCACCATTTACTAATTTCA TGCTAAATCAAAACCAATTGAGTTGTTTGTAGTTATACCTGATTGATTGC CCTTTGAATCGTTGGAGTAAATTGTGATGAATCGATTGAAGCTAAACTAA CTAATTTTTTTTTGCTGATTTCTCTTAATTTATTTTTTCTTTCTCTCCAT ACCTCTAGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATA ATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGC ACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGGTGAATAA TTTTGTACTGCACCCTGTTTTTGTTCGGTTTTGTGTTTTTATAGCGAGTT TATGTATTTGCACTTTTGAGGACGGCAGCGAAGCGACTGAAGCGATTTGG ATAACCTAACCCGGTTCTGACCCGTAAAATCGAAGACGGTAAAAGCTGCT TGTTTACCACCGTCCTCAGTTGATCAGGATCTAAACAAATCAGAAGCTAA CCGTCTCTGTTGCAGAAAAATACACAAACATAAACTCGCTTATATCATCA AGCTACCAAACTTATTCTTGATAAAGATAAGACTTTTTTTCTGTGGAGAA TCAGTGTACTCTTACCTTCTTGGTAAGCTTAATATAAAACATTCCAAAAA TAGTTATGGAATTATGACCTAATGCACTCGTGTCATTTATACTGAAAGAA AAAAACCACAAAGTCTTAATATTAAAGAGATCTGGGTCTGAACTATACTT CTCTATCTTTCCAAGCATACTCTTCGGTAAAATCAAGTTTGGAAGAGAGG TGTTACTACCAAGCAGTGTTGAAATCTAAACTTGATATCTTTCTATCTGG TTCACTCAGAATTTGTTTTGCTCAGAGCAAATCTAGAGTTTAAGAGTTGT TTTTTGATGTCTTTAGACAAAGAAATGTTACGATGGTAACCTTTGGTGAA TTTGTTAATTATTGGGTTTCTTGCGTACTTCCTGCTTGAGACTGAGCTTG AGTGGCTGAAGGAGGAAGTGTTTCTATCATTAAGAGCTGATATTTACACC CTTTAAAGCATGGCGTTCTAAATCTTAGAACGCTATGCTTTAAAGGCATG CCATTTTACCGATAGGCTTGCATCAGTGTAGTGGTTTGTTGTGTCTAGTA CTACTGATTTTTATGTAATCATGTTGGTTTTTCTGAGAATAGAATGAATA TTATATACTCTATTTCCTATAAGAACATCCAAAAATTTTAAAACCTTTGG ATTTTCTTAACCGTTTGAGATTTAAGCATGAAAATGTATTTATATATTTA TTTTTTTATCATAATGTATAAAGTGTTATAGGTGTAATTGTGGTGTTTTA AGTGTCCATTAAGCCTGAAAACATTCTTAACTTGCTTTTAAAGTCTGTCC AGATATAATTGGCAGTGGAAACAAGAATGCCTGTAACTTTTGATAGTCAA ATATAATTATGGAAGTTTTTTTTGCTTGTTTTAGAGAATCAAAAGCGCTT TATTTGAATGTATTTTTGGTTGAAAAATTCGCGATTTTTAGTGGTTAAAT TTGCGATTGCAAAAATTGAGCTTTTTTTCTACTTATGCTATAATGTTCAT TTTTACACCAGTGGTAGTCCAACCTTAGGTTAAGAAGTTTGACAAATTTC AAGGCAAACAGAAAAGTCCTTCGGAAGATATGGGACCCGAAATACCCCTT GGTAGCGCTTTTCTGTGAAATATCAAATCTCCAACTTATTACTAAAAACG GGGGTAGTGATATGATTGATAAAACAGTTTTTCGATCCTAACACATTTTA CGATCTTTTTAATGACCTCATAGCCAAACTGTGTTTAGTGTTTTGGGAAT TAGCAAAGTTCTTTAATGACTTAAAAATAACAAAGGCAATATAAGTTCAT GCTTATCTTTTCAATAAAAACAATTATACTGTGATTTCACNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNGCTGCGTTTAGACCAGCCTGGCATTTGTAATT ACTTGCAGTATTCTTTTGAATTCTATTGTTCCGTGCAATTGTTCGGTTTG TCAAATGCCTAATGATGCCAGCTTGTTGGTATTTCGTTGGCCTTTGAAAT GCCATTTTGAGCAAAGGAATCCCCTTTTCTGGCATTTCAAATCAAACAAA GGAACCAAAACAAAGAGAAAAAATGACATTTTTGATTTTTTANNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAA ATTCCATGCTTTTCATTGTTTGATCTGTCAAAGTTGAACTTGAGGGAATC ACCTTTTCAGTAATGACTCTAAAAAGACGATTCCTTAAATGCCATGACAG AAAATACAATGGAAAAGCTATTAAAATTGAATCCCTCATGAGCAAATGCC AAATTACAAATGCCAGTTGGTCTAAACGCAGCCAATGCAACACTTAACAT TTTCCAACTTTTAATTGCATTGTTCAAAAAAGATAACATATAACCCCCGT TTTTAGTAATAAGTTGGAGATTTGATATTTCACAGAAAAGTGCTACCAAG GGGTATTTCGGGTCCCATATCTTCCGAAGGACTTTTCTGTTTGCCTTGAT ATTTAACAAACTTCTTAACCTAAGGTTGAACTACCACTGGTGTAAAAATG AACATTATAGCATAAGTAGAAAAAAATCTCAATTTTTGCAATCGCAAATT TAACCACTAAAAATCACGAATTTTTCAACCAAAAATACATTCAAATATAG CGCTTTTGATTCTCTAAAACAAGCAAAAAAACTTCCATGATTATATTTGA CTATCAAAAGTTACAGGCATTCTTGTTTCCACTGCCAATTATATCTGGAC AGACTTTAGTATTTTGGTAGTCGAAACCTCACATGTTCGTGTATACTATA TCTCGATGTGGGAGTCCTATTTTGGAAGCCCTTCAAATGTGTAACTTTAA CAAGTCATTTTCTGAGCAATGATACCAAATATTCCTTTGATTTGGACTAT GTATCACTTCTTTCGCAGATGATTTAACTATTATCAAATGTCATACCAGC AGACAAGATTTTGTTCGGAAACTCGAACTCTCTTATCATAATCTTGAGCT CAGTGATATCAGTTTCATTGTTCCAGTTTTTCGTCTCCCCCTATTATTAG TATAAAGTGTAGTATCATAGTCGGTATAATTTTCTGATACCGTTTTAGAG TCACTATTACATTGTGGTTTAACAAGAAAAAAAGTTACGTTTGAGGGAGC TTATTTCATTAAAAATACCTGTGATTTAGTTATGATTTGAGTACATTTAT GGCTGAAAACATTTCTTGCTATTGGGCTTAGTACTAATCTGGCTTTTTGA TGCCATTTTTGCAAGTTTGTTTAGGTTTCTTTCCTGTGTTAAGTACTAAT AGCTGTCTCTGCTTTGTCACATCAAGTCAAATGTTATTTTATCTGCAAGT TGCGAATATCTTTCGTTTTGTCAAAATTTGATTTTGCATTCAATTTTTGA TCTCCTGTGCCAAGGTTGCTGTTATCTTATTCGACTCGCTACTATTTCTA TCGTTCATAACTCAAATAGTTTCTAGGTTCATAAAGAATTCTAGTACAGT TGACGCTCTCTAATTCGATTTTCAAAGGGAATCGAGCTTCAATCGAATAT CCCTATACGTATCGAATAGTAGAGCGTCGTTTACGAGTGTTTCTTGTTGA CGTTAACTTTCAATATTATCGAATAATGGAGCGTATCAAAAAGTAGAACT TCGAATAAAAGAACATCAACTATATCTGCAAACCTTCACTGCTTCTAAAT ATAACAGGAACAAAATCATCTAGCTTTTCTCTCTCGGTTTACCCAAAACA TTATAAATTGTCAAGGGGAATGATTTTGAAAATTCGCTTTTAAGAAGCAA TGGCTTCAGCTCTAAACCCTGTGTTATGCCATAAAGTTAGCATTGCTTCA CAGATCAAAATGCTTCTGTTTTGATGTTTAATGTTAGTCGAGACATCTTA CTTATACCTAATAAAACATGAACTATGATTTTTAATACATTACTTTCCTT ATGCTAATTTAAAATTGAGTGATATACAGCTTAAAGTCATCTCACAAAAT AGGTTTTTAATACGCGGATCAAATAAGCCTTTATAATGTGCATTGATTTC GAAGGGCTTATCTTAATTCGATTTTTGAGATATGTCCTTCTTTTGTGTGA ATGCTCTCTGATTTCAGTTAGTACGCATTTTAAAAATCTCAATTTGCTAT TTAGAAAAACCCTTGATAAAAAGGTTGTCTGGTCAAATAATTGATAAAGA CACGATTAAGTCGTTCTGTTGAAAAGCTTACGAGGAGCTCAGTTTAGTTT TAGTGGATTTCAAAGATCTCCTTCTCTCATAGATCACTTGGTCAAGTATT GATCAAGAGCTTGTCTTGTTCGCCGAAAGGTTCTTTTTTGTTGTGAAATA CTGTCCATCGCAGATAGTTGTGCAAGAGTGCAACAGAAAAAAAGTATTAG CAGACACTCAGACAGACAGACAGACAGACAGACAGATAGACACAGACAGA CAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACA GACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGA CAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACA GACACACAAAATGTTCTGTTATGGTCTGCGAAAAGAGTGTTGTGGAAACT TGTATTCATATAACTTTATTTCTTTTCCTTTTCAGAAATTCCAAGGCGAA TTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAAC CATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTG TCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGGTATGCATCT TTTATCCTTGTTTATTCTATCTTTTTTGAACAAATATTTCCTTTAATATG GAGAAGGTATACCCCTTTTATGAGGCTAAGATAAAATGTTTGGAGTTTGA GAACCCAGTGGCTTCAATTGTTGAAAGATCATTCTGGATTGAGGTTTTCA CTAAATGATTTGTGTGACACTGAATTTCGTCTCCCTTGCCCGGTACCGTT AGTTGGTCTAATGTCGACATCCCTCTTCTAATTCCGACACCCAGTTTTCG AGATAGGAATAATAGTAAGGTCTGAGTCACTGATAGATAAAAGATATTTT CCTCTCTGGTTGCTAAGCAAAGAAATATAGCTTCTATCAGCGATTCCAAC CTTCCTACTATTCTTACCTCTAAAAAAGGGTGTCAGGATTAGAAGAGAGA TGTCGACATTAGACCAAGTTACATTACCCATCCTGGTCTTCCATTCGCTA AATAGAAAAGCCTCTCATTAATCTTCCGGATTTATGTACCTCTACGTGTA TAAAAATTCCAGTTATCAAGTGGAGAAAAAATAAAAATGTCGGAATCTCT GACATGAATCTTTGCAATCTTGTTAGATACGAATATTTAATTGACCTTCT GTCATTTTTAATCCGTGTAGATAAACCATTGTCTAGTTGTCTGATCGGTT CTTGGACTTAATGTTTTTTATTATAATTTTGATTTTTAAAACAACATTTT TGGTCTTTCTTACCCGTTTCAACTTTTCTCCTTGCCGATGTATGAACTTG AATTGATACTTTTGAAAAAAGCTTGTGATAATTCTATTGCAAAATTGCGT GTGCAGCCACTTGAATTCTCAAAATAGTGAGTGAGTGTTCAAAGTTTTTT CAAATCTCTTTCTATCACACCGAAAAAGCACTAGAAACCTGCATTTTGTT GATTCAACATATTCCGTGACTTCTCAAGAGTTCTTAACAAAGAAGATTAG CCTGTACCTAACCAGAGATGGTCACGACTTAAATAAGATTCATCAAACAA CGATACAGGCTTGAGAACTTTTTCAAAACTTGATTCGCCTTTTGCTGACG GGTTTACTGATTGACACAAAGTCTTTTAAACATTCATAAAACGTCCATAC GAGCCGTAAGGGATTTAAAACTTCACACAGAGGCTGTTAACAGACTACAT GTTTTCTCGGCAGGCAGTTGTTTTCTTTGATGACAGGTACATCATCACTG GTTAATTGAAACACGATTTCTCAACTTTTCGATTGATTGTTTAAGAGACT TGGTGCGAAAAGCACGTGGTTCATTTATTCGTCCGCCTCGTCTAAATTTA AAGTCTTTTCACGATATGTAAAAAACGTGAATTTCAGTTACGGTTTGGCT TTCAGTTACAGTTTGGCTTTTAAACTTGCTGAGTTTTTTCGGAGATACTT GGAAAAATGAGTAAACATATTATTTATGAGTTGGCTCTCCACAAAGATTT TGACCCTTCCAAAATATAACTATTATACTGGTTTGTGAAGGCTATAAAAC TAAGTCTTAAAAGCTCTCGATATATTGTATATGTTTTGTGTAGAGAATAT ATTTTGTTGGACTACTGTAATTCGACGTGGGCAGAAGATTGACTGTATCG TGAGAACGTGAACCAGTTTACCGTGAGAACTTTGTGAATTGAATCACCGC AAACGTTGCCAACTTCTCTGATGAAAGTTTACTTTATAATTTTGTAGAGT TTGCAGAATTCCTTTTGGAGTGAGGACAAAAATGACTTCGTGGTTTTGTT GTGTTTTTTTCCTTTTCTTACAAATGATACAGACCTCTCGAGTCTTTTGG CATCTGATGGTATCTGAAAGAGTTATTTTTGCGTAATATCGGTTGACTTT TCCCTCCCCCTCTGCTTCCTTCTAGAGGTATTTATATATCTACTTGATAG ACATTGGAAAATTGGTTTGAATCAAGTTTGAAGTTGAAATTGAAGTCGTG TACTGTAATATTGTTTCAGATTAGTTTTTAAAACATTATGTAGTTTTTAG TTTGTTTTACTAGAGTTTGGTTTGTGCTCAGGTCTCAAAGTCTTTAAAAT ATTTTCTCATGGTTTTTCTAAGATCCATGAGACTTACAAAACCTGTATGA AAACCACAAAACTAAATACCAATGGTTTTTCTCCTACTTGTGTTTCATAT ACCATATAAAGGATCTTTGTCTTTTCTTTTTGAAAGCCAAACATTCTAAC TTGTTAAAGTTTAGAAAAACCATTAAATACTTTAAGCTTTGGTATATACA GTTTCTCTCAGCCATACAAAAATGGTAGTACTTGGCTGCTTTCTGGACTT TTAGTTAACTTAATCTCAATTGGTCACCTAATTTTTCCTTTATCCTGGAA AAATTAGGTGCCAATTGAGATTAAGTTAACTAGAATTACCAGTTAGTTGA TCAATAAGAGAAACCGAAAATCAGTTTATGAATTTTTCTTGGGAGTGCGG TACTTGCTTTTACAGAACGGGACATCGGAAAATTCCACCATGCTTCCCTG TTATGATAGTTTTACTTAACTTGGTTACTTTCCGCTTGGTGCTGTAAAAA TCTTGACGGGAAGAATGACGTTATGGAAATGACGTTTATTGTAGAAGTGG TACCCTCGAGAAATATTTTTTTCGTTGAATTTAGCATTGTTTACTTTTCA CTCTAATAATTGATTAGATTGACATTTTGATGTTATGTTTATGTTTTGTT TGTAGTAGTAATGTATTTATGTTTCAAAAGGTTGCATTGTTATATGAAAT CTCGGCAAGCACCGTTCTTAGTGACTCGATTGCTTGTTAAACTGGGTCCA GTTGTCTCTACTGATTATACTTTAACAAGAATAGTTAAGTTTGTGGAAGA AATACTTTTTTCAGGCAAATAAATTGCTTTTCTTATGATTCTCAGTATCT TAAACTACATCTGTTCACTTTAAGAAAATTGTGGTTAATTTACTATCCAG TCAATTTTTGTCGGTCAGCCGGGCTTTGTAACGATATGAATCTTGATGAC ATTATAAGCTTTAAACGTATTAACCTTTTTATGATCGTCGTCTGGAAAGT GATTTCATTTTAGTTTGTATGAATTTTTGCATTTTGTCATTTCTGATGAT GCTTTTTATCATGATGCCCTTCAAAAAGCTTTTATAATACAGCTCTCTGT GTAATTTAACTTTGCAGTTATTAGCATATTTAGAAATTTTCTTCATCGAG TTTTCTCTTCCAGTTAGAATTCAGTCAGTTGACCAAGAAACACAAAACGT AGAAAAAGCTCGAATGTCTTTAAAGGTTCTCCCGGTGATTGTGTAACTGA ACCATTTTCAATTTCTGGTATTTGAGATGTTCAATAGCTAAAGGTAGATA GTGATAGAGAATGTTGTAGTAAGCACTGGGAAAGTGAAAGTATAGGGAAA TTGTTATGTCGTAGTTTGTTTTCAACTCAAAAAATTATTGTTGGTGGTTT TTACACTTTATACCTGGTGGTTGTTGGACATAAGTTTTTGCAAAGAGAAA GATATCAAATTTTACTGTAAAATAACCATTTCTCAACAATTATTCCATTC TATTTCAAATGGTTTTAATATTAGTATTGCGGTCATGGGGTCTTATAGAT ATAAAGTGTAGTTTTAGTACAAAAAGCTTATTTTGTCTTGGTGAAGGGCT TAATATGCAAGGTGCCCCAGTTTTGCTTGGATATAAATAATGAGTGATTC TGATAGATGCTTTAGAATATCTTTTAATGATTTTAGTTTTAGACTGGAAA GTGCGAGGTTGAGGTAACACCATTTTAAAAGAAATGTTTACTAGTCATAT GCAAAAAAATGTTTCAACCTTTGGTAAACATTTTTATATTTGAAAGTTCA GAAGATATTTTAAAATAATATTAAAAAAAGAAATATATAGAATTAAGATA AAGTTTGCGGAGAATCTAAACAATGGGTGAGATGTTATTGGATTATTCAA TGGACCAATCACAGAGCGGTGATACCTCAATGCATGACGGGAAGACTCCG TCTCCGTTAATGCCCGGTACACACTTTGTCATGTTTCTATTCGATAAGTA AGTATCTTCGCCATTTTCTTTCAAGCATTGACAGGATTTTTCTCATTATT TTTGGACAAAAATTTCGATTTCATTTTTCAGTATTCTCGAAATCGTTCGT TCTTTCCTTCGTTCGTTTCTAAATCAAAAAGCGAATCGATTTTTTATGGA AACCTTAGACATTCCTGTGTCTAATTATTTTGTAACATTTCAACCAGCAG CTATGGTTGATACTCTAAAAGAAAACTTTGTGGTTTGATTTGATTTATAA TTCAATTGAATAATTTGTCACTTTAAGATTCCCTCACACCACACTGTCTT ATTTATTTTTTAATTTTATAATTTATTAGTACTATTTTGACTGATTGCTT TTCCCCTAGAATATTTCAACCAGCCCTCATGTCATACATCGGGAAAGTTA CCCACATTCTTTAAAATCCTAATATTTTTTTAAATTAGACTACTGACCTT TAAAAAAGGACAAAGCTATATCCGTCATTTCTGATCGGAGTTTTTTTTGT ATTAAACGGTGCTAGATCATCAAAAGTATCCAAGGGGGGGGGGGTACATC TAGCGCACTCGATGCATTTACACCGTTAGTGAAAATTGCACCTAAAAAAA CTACAATCAAAGATTTTGGTTGGCCGGTATTGAGAAAGATCAGTGAATTA GAACCTTAATTTCTTCAATGAGGAACTAGAGTGGTAAAAGCGGTGTTGTT TTTTCGCAAACGGGTATCCTGCACAGGAACACATCTTAACCTGTTCCTTA AGGTTTACAACAAAAAGAGATTAATCATAGTAAATAACATCCTTATTACA TATCCTTCAGCGTTTAAAACCATAGATTCCCTTTTTCTGGTTGTCAGTCC TCATCCTTGATGCACTTCCCGAAAAAAATTGAGACTCTTCTCTTATTCGA CTTATGTTTCTTGTAAGCATGCAGATTTCTCACTAACTGAAGTTAAGGTG AATATGTTTGATATAGATGTACGGCCAATCTTAGCTCTGATTGGTAAAAG AGTGACTTTCAGTATACGATTTTTAAGATTCAGGATATGGCTTTTCTTGT TAATATGGCATGTTTCTTATAAAAGAGATGACAAGTATTCCTGTCTTGAA GTCCATTGTTATTTTAAGTAAACTCTCTGAATAGATCATCGGAAAAGTGT CTCGGTTATTTTTTTACCGTTTCATTACAAACTTAAACATAGATGAGGTA TCTTTATCGGGAAATTATTAACAATAGAACGTCAAAATTTGTTTTTCGCG TATTCTTTCTTATAAGAACATACTCACAAGAACTAAGTTTAAGACTACCG AGTGTTGAGTGCCATACTTTTTCGAGTGGCGTTTTTTAAGAACTAAATTT AGTAGTATTACAATTCACGCTGCATGCCTTTAACATTGCACTAACACTAA CTGTGTCCCGTGAGCCCGTTTATGGATTGAATTCTCTGTCCGCAGGAAAT GTCAATGTTCTTCAAATGTTCTTATAAAGTTCTTAAATTGTCAAGACTCG ACGTTGTTGCTTTTCCATAATGAAAACAAACTTATGAATACCCCGGTCGT CGTCAACTTGTTACACCTTCATGTTGTTGTTGTGTCGTTTTAATAAAAAG AAGGGTCATTTATTTTCGTTTGTTGAGACTTGACTCTAAGAGTAGTCTCT CCTTAAAAGTGAAATCAAACCGTTATTTAAAAGGGCATTTTAAGCAAGGC ATTTTTTGATAGTTCGATTTTAATGTTGGTTTTGATTTTATTGATTGTAT GAGTCTTAGTTTTCACTAATTCGTTTCTCTTCGTGATATCACCATTGCTG ACCTTTTTGTTATGAACTGATTGCGTAATTATTATTATAACACACATACA AAATGAAGGATTATGACGTTTTTCGAAGAATTTAATGTGGTAACACAGTG GCATCGATAATATGAGATGAACATACTCATCCGAAATCTAGAAAACTCTT TAAAATTTTATAAACCGTTTTCAATCAAGTTTGTTTTGAAAAGTAACTTT TTGTTCTCCTTTTGCAAAATATGCGTGTCTGCTGCCTTGCTGAGGCTTCT TGCTGTGAAGAAAAGAAAAACTTCAACCTTTTTTGCCACAACGACAGTGA ATAGAAATAATCTTAAGATTTTTACTGACATCTTTTGTCTTTTACGAGGT GTCATACTTGTTAAATTGCCTTACGATACTCTTTCTCATATTTGCAAGAA TTATCGTTTAAGCCAAGTTTTTTAAAGTTTAAAATTTCAATGAAATAGTG GTAAAAATCGCCGTAAATTCAATATATTCATCTGTCGTAAATATGCAACT ACTTGTCGATACCTTCGTACAGAAAGTCGTAAATCGAGTGACCAAAACTC GATATGGATTCAAATTCTCGTAAGTATTGAAAATCTTCGTTTGAAATCTG TTCATCATTGATCTAAACAAATTTTGCTGACAATCACTGTTTGATTTTGT CTCTGACTTAAGGGCTCTGACCATAGTCCAAAAATTGATTTTGGTATTTG AACATAAAAGTTATATTTCAGGTTCCTTAACACTTTTAACAAAGAATTGC CTTTATAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNCAAAAGTCTTCATTTTCTTCTTCATCAAACTTTTTCAATGCA AATTTTGAATTTTCAGATTCAGGAATAGTTTGTCTAACAGAAAATGTGTA ACATGCCATAGTTTTGTTGGTTACATCAGTCAGAAAACACATTTTAAACA CGGCAATTATGAAAAATTCACTATGGTCAGAGCCCTTAATGTACTCGCGT ATATCTTCTGTCTGCTCTTTCTATCTATATTATGTTTGTGTCCTTTTCAT TGATTTTGTATTGGTATTATTGATTATGGACTTTTACCATTGACTTCCAA ACCCGAAGAGCTAGACTTGAGACTCCTGGATAGGAAATGAAGCCACTTAT TTCCCATCCAGAACGCCCGTGCGTGGTTTTTACTCAAACGCCGGATCGAA AGTAAAATATATCACTAGATTTCAAAAAATGCAGTCCTCAAAAACAAAGG AACCGCTAGTTACAATCCTCCGTCATGATAGCGGCGCGTTCTAGACGCGT TCTGGATGGGAAATAAGTGGCTTCACTTTTTCTTGCCACTCTAGCCCTTC GGGCTTCAAACTCAATGACTTTTACAATGCTGTTTTTTCGAAGTTTTTGT CATGCTAATGAAAATTAGTGAATCTTACTCTTTTCGACGTGAGTCAACGC AAAAAGAATCTAAATGTAGTGTGTCTTGAATGATATGAATCTCGAATAAG GGAAAGTCTAATTGTTATGTTATTTTGCTTGATCGCAGTTTTTTAAGATA ACATATTTTTCGTGTTCTTAAAACAGTCGACATAAATATCCTAAAAAAAT CGTCAGTTTTCTTATTTCCTTGTTCTAGTTTTTGTAATGATGTGGTTGTG GTGGTTAGAAATGTCAAATTTTTTTTTTATATAGATACGCCTTTTAGGAA AACTTAGTTTTCGGGTAATTTCAAGGGGATGAAATTTGGTGATCAATCAA ATGTTAAATCTCTTTTAGGGTTTTTAGGATCCTTAGACTTTCAGTATTGT TATTTAAATAACGCTATTAATACACTGCTAATTTTTTTAACGTATTTTTT GAAGTTATTTTTAGCGAACGGAATGGTTCAATTGCCTGCGAACTAAATCG TTTTGAATTTTATTTTGCTGGTGCTTTTGATTGATTTGATGAAATGTTAA ATGAAGTATTTTTGCTTGTTGTTCTTAGTTGGTTTGTTACGAATGACAGT TTCAACAATACGAACGTTCACACTTCATAATTTGATTGTCATATTTTCGG CATCGGTGTTGATGAAGCGTGACAGCCCTTGATAAATCAAAATGAAACGT CTTTTTAACCTAAATCTTGCTCAATCTTTTTATTAGTCGGTCTATAACCA ACTAATGTCTAGCTGTTATTTATAGAATCTGTCTTTTAGGCCAAGTAGCT CATGAGGAGCGACTTATATTCTATATTATTCGTACTACAATCTACCTCAG GGTAAGAATATTAGAAAGTGCGTTTTTCTCAGATTTTTTTGACGTTTCAA ATACATCTTGCGCGCTTTTTGATGAAAGTAACTAATACCCTTATCTTTAA AATTCGACGAAAATAAATCATATGGTATGTTACCAAATTGGACCGATCAA AAAGAAAATACCTAATAAATCATATTACTTTTCAATCATCCCATGAAAAG CAGAATTGGTATATAATTGGTCAATTTTATGTAGAAGGAAACTAAAACAT GCATTGCACGTTGAACTTTGAGACAGATTGATTTACATTACAGACATTTT GTACGTTCTCTCGCTTATTGGTGGAGATTAAACGGATAGACTTTTTGATG TTAGTTTATTGACTGCAATATTCTATACTTGTCGGGCTTTTAAATGTTGT TTTTACGTCACAGTCTATTTTTATTGTAAATCTGGCTGACTCAAAGTTTT GATCATTTATTTTTAAGATATTTTTTTTGCTTTGGATCCTCTCTCTTCGC GCACTATCCGGGTTTTGGTAGTTGAAGTCTAGAAAGCATTTTATGGTGCT TAGAAGGCGCAAAAAGTGAAACATTTTCTTCGTGGCTAAATCGTGTGAAC GACAATTTTTTCCATCCCTTCAAACGGCTAACCGGGACCCATGATTTTGA GTAAGATCTTTATACAACTCTATATTTCGGAGAAACTTTAGCATATCGGT AAACGTTTAGGAATCAAAAACTTGTGTGTATTCAATAAATACCATCGTGA CTGACTGACTGACTGGCTCTACACGGGTAAAAATCACTACCCGCGTCATA AAATGTGATTCTCAATGTATGACCTTTAGCCCGCCTCTAGCTCGATCAAA ATAAAGATCTGCTGAACTCATTTTATAAAGTGATAAATACAATTTTAAAA AGGAAAAAAAATATTGAGCTTTTTCGTATCTTGTTAACGTACAAGCCACG TTTTTAATAGAAAATTTTCGTGCGCATGTGTCGAAATTTCACTCACGACT TATGTCCATTCGTTTTTTGACTGATAGTGGCGAATTTGAAGTTACCTTGT TGAGTTAGTCAAAAACCTGGAAAAACCGTGCTCTAAATAAGGTTTAGAAT TCTAATATTGTGAAATCTCTTAGTGTTTGTATGATGGAGGATTTTGGGTA AGGTTTTTCTATTGTATTCACGTCTTTTTTGTCCACATTTTTATTGGTAT GTTTTCGTTCATAAAGAGCACTTGATAATATTTTTGACGGTTAAGAAGGG GTTGTCTTTCTTTGGTTTGTTTTGGTCTAAAGTTATCTGTCATGAAACTA TCTAGCTCTTGAATTTGTTCACGCCAAGGGTTTAGACTGAATTTTAACCG AAAAAAGTCTTTCGGAAGGTGGTTACGCTGTGTACTGTTCAGATGACTAG CTTTCGTTTTGATCAAAAAGTTGCGAATTGCTCGGGGGGAGGGGGTTCTT TTTGTGTCTGTCATCCATGTTATTTTTGTTTTGTTTAACAAAAAAGAATG AGTCAACGTTTGCGCTTTAAGAAATGACCTATTTTTGAAGTCATTTATCA TCGATATTCTTATGTATAACAATGTCTTTTTGTGCTTTAAATGACCGAGT CGAATGTTTCGAGAATTTTGGATTTGAGTTCATTTATAGTAGTTACTTTT TGTAAAAGGGGTTAAGCGGGTTTTACTTAGGTAGATAAGTTCTGTCACAA ATCGTTGCTGATATCGGGCGATGAAGAGAAAGTGCTTATATGCTAGACTG CACATATTGTCGCATAAGATTATGCCTTGATGGTCGGTGTTGTGTCTGTT TTTGAATTTGAAATTGTTATATTTTTCCGTTGGAAACGCCAAAAATGGTG CACCTACCATGGTGATCCCACTCTTCGCATCCGGTCGAAAACGTTGTATG GCTTTGTGACATGTTTGAACAAAATTGTAATATTACCTACCTATAATAAA CCTTCTCTCTCCACAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCA TTGGATCGCCTCTTACAATTTCACAAGAACATGATTTCAGCATTGACATG GTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGT CATCGCAAGCTGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATG CAGGTATGCCACTATCCTTTTTGTTTCCAGACTACTGGGACTGGGTTTCA GATTACAGACAGGTTAGGATCGACGTCAAATATCTGAAGTCGTTACATTG ATTTTTTCATTCTTGATATGCACAATTGCAATGTCTTCCACCGACCCAAC AGCTGATTGGTTGAAAGTGACGTATTGACTGATTTACAGAACGGAATGTT CACGATTGACGATTTGTTACAATTGCNATCAGGTAGATAAGTTCTGTCAC AAATCGTTGCTGACATCGGGTGATGAAGAGAAAGTGCTTATATGCTAGAC TGCACATATTGTCGCATAAAATTATGCCTTGATGGTCGGTGTTGTGCCTG TTTTCGAATTTGAAATTGTTATATTTTTCCGTTGGAAACGCCAAAAATGG TACACCTACCATGGTGATCCCACTCTTCGCATCCGGTCCAAAACGTTATA TGGCTTTGTGACATGTTTGAACAAAATTGTAATATTACCTACCTATAATA ATCCTTCTCTCTGCACAGCTCGAACGCGCACCAAGATTCATTACAAGAAG CATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACA TGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGA GTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAA TGCAGGTATGCCACTATCCTTTTTGTTTCTAGACGACTGGGACTGGGTTT CAGATTACAGACAGGTTAGGATCGACGTCAAATATCTGAAGTCGTTACAT TGATTTTTTCATTCATGATACACGTTTTTTTTTTTATAAGGAACACGTTT ATAAGGAACTCGAGGCTGAAAATGGTTCAAAAAATAAGGAATTGTTAAGG AACTGCTCAGGCTGAGANNNNNNNNNTGTGGATTTGAAAATAATGTACCT TATTGGGACTTATTTGACCAAATTTNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN AAAAAAAAAAACGTGTATGCATCATTGCATAATGTCTTCCACGGACCCAA CAGCTGATTGGTTGAAAGTGACGTATTGACTGATTTACAGAACGGAATGT TCACGATTGACGATTTGTTACAATTGCTTCGAAATTTACACTCACTTTTT CATTCGAAATACTTAAAAAATTGGTTGTCTTTTTTAGGGGGTTCTTCATC ACTCATTGTCAAACTAGCAGTTTTTGCTGTAACTTTACCCCTTTTTTTAT TTAAAGTAAAACTTTACGTCCAAAACACAACAGTGATTCCATTGTGAATT CTGGAGTCTCTAACCTACAACCCCTACGCGATCCTCATAAGTCACCAAAG CCAATATTTGATCATTTCATTTCCTTGTTTGTTTAAGAATCTGATTAAAA TCCTAATTTCTTAAAAGAACGAAACAATTATCAAAATGTCAATTGGAAAC ATTCCAAATCCTTAATCTCTATAAAAAAACACGATTTTTATAAATTCACA AAATGGTGTTTATTTACTTTGTCAACTTTTTTTGTATTTGTTTTTTAATA TTTCGACGAGCTGCTTTTAATTTTCCATGTACTTTGAGTTAAAAAAATTG GGTAATCCCTCACCCATAAGTTTTGGTCATCTGCCCTCGACTGTTTCCAA AATACGGTTAAGTTTCTTTAACTCGGACCTTTATAAGTCGGACCTTTATA ACTCGAATGTCTCCTTAACTCGAACAAGGATTATGGCCCCTTCAGTTAAC AATGACTTATAAACCTTACTCCATAAATCGGAAATTTCCTTAACTCTAAC AATTTTGTGTTCCCCGCGCGTATTCGAGAGTTATTGTGACTCCACAGTAG TAAATTTGATAACCTTCTATTTTATCAATCACTTGGTATAATTCGAACCA ACTGGGTCACATAATCACCCTTGTCTGTCACAATAAGATAAACTGTTTGC GCTTAGTTACAACTTCTTTCAAACATTCGCTTCATCATCATTGTTCAATG TCCTACGCCAACGCAAAAAGTCTTCAAATTTCACGCTGATATTATTGGAT TCGTTTATTCTTAATGAGACTTAACGAACGGAATTGGCTAATTAGTTAAT TAATTCCGGAAAAGGCTAAACCAAAAGTTTTTTCTGCACCCACATTTTCG TCACATTCAGCTTGTGTGCCCCATAAAATCAACTAAAAAGTCTGAGGTTA CGGGCTAACAAATTGACTTTTACACGTTGTTATAAGAACAAATTATATCG TTTGCCAAAATATCAAGAATAGGTTAAGAACAATTCAAGGCTTCGTGTCC TTCATGGACTCTAAAACACCAAATTTCTTAGGAAATCGCAAAACGGTCAA AATAAGAACATTATAAAACATATTTTTAAGGTTTAAAACTTAAAATGTTA AGAACATCCCGAGGCTTCAAAAAATTTGGATGCTCTTCTAAAAAACGTGT ATTTGTGACTCTTTATTATTTCTATAAATCCCCGTTACAGGAACTCGAAG ATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGC AAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCA ATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAG TCGTCGATATCAGGGATAGGTAAGACTTCAAAAATGGCAATTTCAGTAAA AACCTGGTGGTTTTTTTTATCAATTCATCGATTCTAGGAGTTAAGTATTG TGCTTTGGAGTATAAAAAGGCGATCTTTTTAGGCATACATGTGAAGCTTC ATTTTGAACGCGTGCGAATTCAAGTCTCGTGCAGAATAATGTTCTGCTAA TAGCCATCACTCCTGTGTGAAAGATGATACAGCATTTAAATCATTATTGA ACCAAGCACCTTCCTGTTGGATGTTACAATGTCTTCTTCTTATCTGATCA AACCACATATATTAATAGTAGGTTAGAGGTTGCGGATACCTCAAACAACA TAAGTACAGTCTATGTTTCCTGTTTCATGTTCTGATATAAGATTACCCAT CTTTCCCTTCTCTCCATCCAACAACAGAATGTCATATGGTACTGGTGAAT GGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGA GCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAA AGTACAACAACAGAATAAACACCATCAGGTACCATTTTGAATTTACCTCA TCACTGAAGGTCATATCTTATTCTGTATTTTTGGATACTCTTGACTTGAT TTGATTTGATGTTTCAAATTCGCATAAAATAACGAGAAAATGTTTTTTTT TTTGCTAATATAGGTATCAACGACATGTTTTTTTTCGAATTTTCTTGTAG AGTTCTATTTAGATACGATTACAATAAGGTTATCCAAATACATTTATTAG TCGCTGAAACTTACCAAATCTTTTTGCACTTGCAGGAATTCAAAGGCAAG CTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAA CTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAG GAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACC CACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGA GAAAACTATCAGCCTTGTATTAGAGGTAAAATCCATTTTTATTTTGCTAT TTTGCCAAAGGTTGACTGATTATCTATATGTTAGGTGGTATTTCAAATGC TTAATCTCTTTTGACAGCGGGTTTTGTACACCTTTAAACAATTTTATAAG GTATTTTCTTTCTTACGTTGTAAAGACGAGATTAGAAAAACTAGAAAACG TTCCTTAATAGTTCTCATATACTCATCAACCTTATTTTTTTGGCTTCATT GCCAAAATATTATTGGACTCGATCCGATCAATCAGTCCATCATATTTAAA GATTATTCATGATCATTGTAATGACAATGTAATTCTGCATCCTTCCAGCA ATCCCAGGCTAAATAAACGAATCGTAGTTCCTTTCCCATCAGTTGAAACA GCATGTTAAAATTGAACCAGACACTTCTATAATAGATTTTTTCGAAATGA CCGTGTACACACATCACAATCAGATTAAGAACTAGTTTACACTGTGCAGA GAACAATTAGATGACAGCGAAAATGTTTTATCGCGATATAAATAGGAGAT TAAGGAAAAATAGATGATATACTCTTTAAGCTCTCCCTTATGAATCAGTA AGCTAAACAACTAATTTATTGATGGGTTGTTGAAGAAAAACTAATGAGCT AGTATTTGTTGTCCTGAAGGGTTTGAAGTGTAAAGTTGTAGACAGATCTA ATTGTTTTGAAAAAAAGAAATGGGTACTACTGTTAATTTGAATAACGAGG TATATCACTTTGGAACTTCTTTGATAATTACCGATATTTGGGGTTACTTT CATAAGAGAGGGGTTGCTTTTGTGACCCCCAAACAGCTGACACTTTTGGT CTACAAGCTAAAAAAATTTCTAGCTGGTTGGAATGGACTGAAACTATTTT CGACTTGAAGGCTCTGAAAGTTACCTACCTTAAGGGAAGAAATTTTCGCG AGAAGAAATTTTCGCGGAATTTAATTTCGCGAATCAGAGTTTCAAAATGG CAACTTTCGCAGAATTTAATTTCGCGAATGAGCCGATTTTAAAAGTTTCA CGGAATTTAATTTCGCGATTGAGAAGAATTTATCAACTTAGATTAATTTT TAAGCATCACAGAGTTGTTTATATTTGATAAAAAATACACGTTATAATGC TTCAAAATCAATTGTTCATGATTGTGTCCATCTTTTTTGGTAATACCTGG TCAAAAACAACAAAATAAAAGAAAGAGAAAAAAAATCGAATTTCGCAGAA TTTAATTTCGCGATTTAACAATTTTGGTGTGTTTCGCGGAATTTAATTTC GCGAATTACGCCCAAATTCGCGAAATTAAATTCCGCGAAAATTTCTTCCG CGGAAATTTCTTCTCGCGAAAATTTCTTCCCTTAAGGTAGCACTTATGAA AGTAACCCCAATCGTGACATATATTGGAGAAAGGTGTACATAGTAGCTCA AAATCTTTTCACTTCATTTTGATATATGAGGGTGATATTGTTTGAACTTT TTTCAAAGCTTTCGTGGCCTGGTGTTACTATAACTTCAAACTACAAAATA TACAATACACCTTTTCGACCGTAGCCGCCAATTGCCGTGGGGGCATATTT TTTCACACCTAAAGACAATAGAAAAAAGTTTGAAAAAGGATTGGCTCGAG TTTAGGGTGGTAAAACGGACAAAAAAATGCCCGCGTGGCAATTGGCGGCT ACGGTCGAAAAGGTGTATTGAATTAAATTAAAAAGTGACGGCTACATCCT CGGCTTATCATCTATCTGAAGGAACTTTTCTAATCAATTGCATACTGTGA AAAATTAATCTTAGATTCTGATCTATTATCTATTTTTGTTTAAAAACTTT CTTCACTGGTTTAATTAACAAGCTCTAATGGTTACCTTACCTATTAAGTT CGACAAGCGTAAGTTCAACTAAATTATTGGAATGGAAGATAAAAGTGAGA GTAAAGGCCAGTCTCCACTTGCGCGTGCTGCGATCGCACTTTATGTAGCA AAGCTTCCACGCCAAATATTGCCATCGAAGCGTGCGTAAGTGGAGACCGG CCTTAAAGTTACTTTTAGTCTCTTTAAAAATCGAAAGAATACCAAAATAT GCTTAAATTACGTGGAGAGTCCCATTAAATATAAAAAATCTTCTCCTTTT TAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTT GAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATAC CTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGTATGTTTTCGA TTTGATTCTGAATTGCTTTATACTATCTGTGAACACATCAAACCTTAACA AATTCTACATTTTGAGACAACGATATTTCGTCCCCTCTCCGCAGAAATAA AGTAGACGGTTTTCCATTATGTGAGAGCTAGGTTGACCAAATATGTCTTA AAATATTTTAAATTATTTTTCTTTGTAAATTATATCAGAGAATGCAAGAA CAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAA AGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAG TGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAG ATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATC AGTTATGTTACAAGGTTTGAGAAAAAAGTTTTCTTAGGATTACTTTACAC TTTTCAAAACTTCAGAATAATCTTATTTGGAATACATTGACTTCGTAGGC TTCTGCTCACCCTCCAACAAAAAAGTTTCTTATGTGAAGGAAGAGTGTAC ATAGAGTATAGAGTTCTGTTTTTGGGTTGGAAAGGCATGACATATCTCTA ACTATTCTAACCCTACCAAAATTCTTGTTAAATGCGAGAGAGAATAGCCA CAAAAGTTATATTTTAATGAATTGAAATTTCATAATTCGTTACAGAAAGC GTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTT CATCAAGTAAGTGTGTAGCTCCCAGTCCCCTTTAGTGATGGCCGTCCGTA ATTTTCTTTTTTTATTCTTTTATAATTACAGTGGAGTTTCCATAGCGGAA AACTCTGTTCGAGTTATGGAGTAAGGTTTATAAGGCATTGTTAACTGAAG GGACCAGAAAACATATCCGTCTCAAGGAGACATTCTTCGAGTAATGAAAA CTCTACTGTACACGTCAATAGCAATTTTCTAACTTTAAAGATTGAACAAC ACTGCCAATTGTGTCTGGCTCTTTTGAGTTTGAATTTTGTAAGCTGGACA CTAGATTTTGATGTTTGAGCCGTCTCAAAATCTTTTACAATCGAAAAATC CAAGTCTTATCGATGCGACGTCACCTTGTATCATATTTATCATCTCCTTA ATTGTTTTATTTCAGTCATACCACAAAAACGACACAATGGGATCACCCAA AGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTT GCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTG TCGTAAGTTTTTGTTATAATTTTGAGAGAGAAAAAACCAAAAGGAAATTG GAATGAATTTTTTTTTTTAAATCGCCAAAATTTGTTTTTGCCAAAATTGA ATAAATCCTAATTTTTATCTCAAACGCTCATTAGTGGCTGAAAATAAAAA AAAATTGCTACTCGTGAAAATAAGTTTCTTGCCAAATTTGATTTTTCCGA TCTTTACTGTTCATCAAGATTCTTGTTCTTTTAAGGTCACCTGCATCTTA CCTTCCCTTATAGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGC ATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCG GAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAAT CGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTG GTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTAT CATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAA TGGAAATGTAAGTAGGGTTNTATCACTTTGATGTCACGTGCTAAACTGGA AGATAAATGGAAATGTAAGTAGGGTTAAAATTCATCCACTTTAGACTTTA ACTAATCTTTTAAAATTAACGTGTCAACTTTCTATAATATAGCAATTAAC ACATATAACAGTTTCTTCACTCTTCTTTCGCTACCAAGACGTATACATTC CTAATTCAGAATCTTTACTTGATTTTGATGCAAGTGTACAGTTCAGCTCA TTTTATGACTTTCGTTTGCTATTTTTTCCTAGATTTATTCCGTCAAATTT CGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACAC GATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGG TAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGGTAAGTTCTT TGTTTGTTATAAATCCTGTAAGTGTATTCAGAGTTGAGGTTTTTTATTTA CTTTTTTTAAGAGGCAAAATTTACAAGTGAACGAGAACCGGACCTTGAAA ACTGCAGAAAAATAAGCTTCAAAAAATTACTGTTTTTGTATATTGTTAGG GTTAGATTTTATAAATTTTCTAATTTTGTCATTCGTCTTCATTTTCTAGG CTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAAC GCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTC CGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACC CGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTT TGTCAGGTAAGGAAAAGTTTGAATGCTGTGGCGAAAACTTCATTCAATAA CATTTTCAAAATGATACAAATGATATTTTTGTTCACAAAATATCTTTTGC CCAGATATAGTAAAACCCTTTAATTTAAATCAATTTAATTTGATTAGAGA ATCCCACCTAATTTCAACAAATATTTGAAAATCATTAGCTCGTTTGAAGT AGCAAAGCAAGCTTGACATTCTCAAATGCTACTTTCACCATGTCTTTATA ATAGCCGTTAGCTTACGCTTGAAGTACTAACCTTTTTTACTTTTGTTCAT GTGGTTTGATTACTATCTACCAATCAATTAATTATTTAGACTTGCTTCTG GTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAAT ATAGCTTAGCGGTAAGTCTCATTTGTGTTCCACGGAAGCTCCATAACCCC AATTCTTCTTAGCTCTCTATGTTCCTCGTGCGTGTTCGAGTTGAAGGACT CTATTATAGGTTCTATTAAGGTTTTTCGTGAAGTGACCTTATCACGCCCT TTCCCGAAAACGAACATCGTCTCTAGCGGATATTCTTTTATGAAGGTCAC TGTGTTTCACACCGTATTTTCCATCGTATTTTCGATATGATTTATAAAGC AGGAGCCTTCTTAAGGTTATTTTGCACCAATCATATCCATGGTTTCCTTG GTTTATCGTTAATAATTTGTGCTGTGCGTAAAGATTGGACTTATTTTTTC TGATGCACGTACAATATGTTTTATTCTCCTCTTTTTTCTACAGACGACGA CGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAA TCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGT GCAGACCATCATGGAAGGAAGTTCCATTGAAACGTATGTTTACTCCTTTG ATTTCACTCTCCACTATCATCTACAGCATGGCTTTTAACAAAGCTTGTTT CGAAAGTGCTTCATTTTCATGGCTATTGGTAGGACTTATCCTTACCAAGA TGGTAGTGGGTGGACCAAATCCATGATTCCGAAAAAAGGTTATTATCCTT CTGACGTGAAGCACATTACGCAAAATATGTTGTTTTTATGAAGTAACGGT TTCTGATGAACGACTTGCTTTGATGGACGATGACCAAATGGTCTAAGGCT TCACCAGTGCAAACCAGGCGGCCGTAGTTCGAATTCTTGTTTCTTCCAAT GTTGTGTTCAGCTCATAGATTGAGCTTGCCGACAGTGGACCCTGTGAAAA CAATCAAAAGGGTGTCTAAAAGTCCTAGATTACTCGGTTATCCACGTAAA ATATCTATGGGATTATCTCCGTGCAACTTTTTATTACTTTTTATTTTTCT TAACAGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCG ACTCGGCGTAAGATCACAGTTGTTTTCCTATTCAATCGTGTTGTTTTTCT ATTCAATAGTTTCAATCACCATGTTTTAGTATTTTACCTTTTAACACTTC CTACATTTTCAAGATGCAATTCTATCTAGCCTCAGAATAGACTGGAGTCG TTTATAATGTGTGTAATACAGTAGCATAGGTATTATATGATAATACGATT ATTGTTACAGGATTTAGCTATATTTAGTATAAACTAAAAACATTTCCCTC CATCATTTTTTGCTTTATTTTTACCATGTCTAAATTAGTCGTCTAGCTTG CTAGACCAGCCTCAGAATAAAATAGCCTATTTTACACCAGGCTGAATAAG TCAGAGATCTTACAAATCAGCATGCTGAGATTCTTGTTTTGAAAATCCAA TTCTACATTTATATTATCCTCCAGAATGAACGGTCACCACGATTCGACAG ACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAA CATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAA CAATAACACAACGGTGTGTAATTTTTCATGCCTTTTTTGTTCATCATTTT CACTTTCGATTTTCGCTCAGACAAGTCTCCTTCATAGGTTATCTCCCGGT GGATAGGAGTCATGGGGACAAGCTGGAGTTTTTACAAGCTCTTACGTGAT TTGGTTGGTCGTTAAGTTAATTTCATTACTTTTTCTAAAGAACGCGTCAT CTCTATTACTTCAAATGACCAATTAGTGAAGTATCTTATAAAAACTCCAG CTCATCCCGAATCATGGGAAACATGGGGAAAATGCTCCCTTTCTATTGGT CAAACCTTTTGAAGATGACTAAAGGGACATCATTATTAGAGGGCAGTCCT GATTACCCATGATTCATTTCGAATCATGGGTAAAGAGAGATTTGCGAAAT AAAAAGTATCAACTAATCGTGGTTTGCAATCAATAATTACATTTTGCTTA AACCCTGAGCACGCCGTTTTTATCCTGTATTTCTCATTTCTTTCTTCAGC CGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAA GATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAGTAAGTAAT GTTGAATTTTTTACCTATCAGTATTGAGTTTGAGACATTTAAGGAATCAA TATTTGATGAGCTCATCCCGAATTTAAGCACTGGATTTGTATTATTTTTG AATAAAATCTGTCTAAAGGATTGCCAACGTTTTTTCCGATAGTATGTCTA TAATCACTTTGGAATTTTACTTATGCGAGATTTTATATTCAAATGAGATT TTAGAAATATATATGTTAAATCTAAGATCTGTTGAAATTAAGCCCGTCAA GTTGGTGATCTTGATCTTGATATGATTAGTATGTTTCTCTTATATATTCT CTTTGCTTTCTTCTCTAGATCTCTAATGGAAGAATACACCCGACTGAAGG GAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAAT ACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAA AGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAAT TAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGGTTAGTGAA GTTCCATTCTACTTGTTACCGTAAGTTGGTCTAATACCGACATCCCTCTT CTAATTCCGATGACACCCTTCTTTACAGATAGGAATTATAGGAAGGCCGG AATTGCTGATGGAAACTATTTCCCCTTATTGCTTAGCTATCAGATTGGAA AAAGTCCTTTGTCTATCAGTGATCTAGACCTTTTGACCATTCCTATCTTT AAAGAAAGGTGTCGAAATTAGAAGAGGGATGTCTACAGAACAACTTACGG TATGATTCTCTAGCTACTCTGTATCAGAGTGTATCAAATTTATAACGTAG CGTAGTACAGTAAAGTGCGTCAAATGGGCGAAGTTTTGTTTGCAGACAAA ACTGAACCGTCCTGAGTTGCATTATGGGCTTCACATTTAGAATCAGGAAA GCTGTATGTTTGTATATGGGAGTTTCTAATTAAAATCTATTTTCTTTCGT TAAATTATAGCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTA CGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCG TCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGA TGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCT TCCCAACATCAAGTTATGAGGATTAACGGAGGAATGGAAATTTTGTTCTA TTAGTGTATTGTTCTGCTTTTTCTCTTGTGTTAGTAGTGTTTATATGAAA GATTGAATCTTTTAGAATTAGCGCTTTATTGTTAATACACAAAGAAATAA TGTCATTTTTCTATCTACCCATTTTCAGAATCAGAAATAAAGTTCTAGGA ACACCGGACGGTTTTTAGATCCCTGGAGGACCTAAAGAAAATATCCGAAA CCTTTTCTGCTACTGAAGGTTTGGTTTTTGTAAAATAGAATACCAGTCTG GACAATTAGGTTGATAGATACATGAAATTATTTATTTTGAAATTTAAAAG AAATATTTATAGCTTATATATATTTTTATATTGTACCTTGTCCATATAAT AATTTTTTTTGTCTTTTCTGTTGTCTTTCCTTGTCCTCCCTGAATTCTAT GTTGTGTTTTTGTTTGCCTCCAGAAAAAACGAGGTCGCTTTATTTTCGCG TATTATTTTGCTTTTTGTAAATAAGTTTTTTTTGTTTTGTCTTATATTTT TTGACAGAAAATCTTTTTTATGGATAGAAATAATTTTATACAATTGAAAA TACCTTTGCGTTCATTATCAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000749XLOC_000749Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001415-exon-sc0000010-1575043694:305133..305170TCONS_00001415-exon-sc0000010-1575043694:305133..305170Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:304642..304860TCONS_00001415-exon-sc0000010-1575043694:304642..304860Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:302804..302908TCONS_00001415-exon-sc0000010-1575043694:302804..302908Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:300771..300956TCONS_00001415-exon-sc0000010-1575043694:300771..300956Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:299999..300076TCONS_00001415-exon-sc0000010-1575043694:299999..300076Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:294516..294735TCONS_00001415-exon-sc0000010-1575043694:294516..294735Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:291980..292098TCONS_00001415-exon-sc0000010-1575043694:291980..292098Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:290122..290409TCONS_00001415-exon-sc0000010-1575043694:290122..290409Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:289428..289608TCONS_00001415-exon-sc0000010-1575043694:289428..289608Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:288420..288806TCONS_00001415-exon-sc0000010-1575043694:288420..288806Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:287724..287947TCONS_00001415-exon-sc0000010-1575043694:287724..287947Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:287246..287412TCONS_00001415-exon-sc0000010-1575043694:287246..287412Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:286702..286828TCONS_00001415-exon-sc0000010-1575043694:286702..286828Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:285501..285673TCONS_00001415-exon-sc0000010-1575043694:285501..285673Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:283863..284013TCONS_00001415-exon-sc0000010-1575043694:283863..284013Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:283347..283512TCONS_00001415-exon-sc0000010-1575043694:283347..283512Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:282884..283032TCONS_00001415-exon-sc0000010-1575043694:282884..283032Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:282271..282583TCONS_00001415-exon-sc0000010-1575043694:282271..282583Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:281398..281549TCONS_00001415-exon-sc0000010-1575043694:281398..281549Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:276419..276584TCONS_00001415-exon-sc0000010-1575043694:276419..276584Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:274497..274630TCONS_00001415-exon-sc0000010-1575043694:274497..274630Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:267631..267785TCONS_00001415-exon-sc0000010-1575043694:267631..267785Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:257018..257204TCONS_00001415-exon-sc0000010-1575043694:257018..257204Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:254102..254280TCONS_00001415-exon-sc0000010-1575043694:254102..254280Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:253543..253693TCONS_00001415-exon-sc0000010-1575043694:253543..253693Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:253046..253285TCONS_00001415-exon-sc0000010-1575043694:253046..253285Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:250783..250917TCONS_00001415-exon-sc0000010-1575043694:250783..250917Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:250357..250582TCONS_00001415-exon-sc0000010-1575043694:250357..250582Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:250015..250075TCONS_00001415-exon-sc0000010-1575043694:250015..250075Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:249469..249605TCONS_00001415-exon-sc0000010-1575043694:249469..249605Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:248914..249207TCONS_00001415-exon-sc0000010-1575043694:248914..249207Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:248481..248638TCONS_00001415-exon-sc0000010-1575043694:248481..248638Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:248065..248271TCONS_00001415-exon-sc0000010-1575043694:248065..248271Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:247660..247731TCONS_00001415-exon-sc0000010-1575043694:247660..247731Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:247138..247277TCONS_00001415-exon-sc0000010-1575043694:247138..247277Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:246614..246664TCONS_00001415-exon-sc0000010-1575043694:246614..246664Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:246058..246196TCONS_00001415-exon-sc0000010-1575043694:246058..246196Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:245480..245571TCONS_00001415-exon-sc0000010-1575043694:245480..245571Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:244930..245152TCONS_00001415-exon-sc0000010-1575043694:244930..245152Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1575043694:243650..244460TCONS_00001415-exon-sc0000010-1575043694:243650..244460Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:305133..305170TCONS_00001415-exon-sc0000010-1510915933:305133..305170Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:304642..304860TCONS_00001415-exon-sc0000010-1510915933:304642..304860Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:302804..302908TCONS_00001415-exon-sc0000010-1510915933:302804..302908Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:300771..300956TCONS_00001415-exon-sc0000010-1510915933:300771..300956Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:299999..300076TCONS_00001415-exon-sc0000010-1510915933:299999..300076Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:294516..294735TCONS_00001415-exon-sc0000010-1510915933:294516..294735Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:291980..292098TCONS_00001415-exon-sc0000010-1510915933:291980..292098Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:290122..290409TCONS_00001415-exon-sc0000010-1510915933:290122..290409Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:289428..289608TCONS_00001415-exon-sc0000010-1510915933:289428..289608Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:288420..288806TCONS_00001415-exon-sc0000010-1510915933:288420..288806Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:287724..287947TCONS_00001415-exon-sc0000010-1510915933:287724..287947Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:287246..287412TCONS_00001415-exon-sc0000010-1510915933:287246..287412Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:286702..286828TCONS_00001415-exon-sc0000010-1510915933:286702..286828Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:285501..285673TCONS_00001415-exon-sc0000010-1510915933:285501..285673Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:283863..284013TCONS_00001415-exon-sc0000010-1510915933:283863..284013Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:283347..283512TCONS_00001415-exon-sc0000010-1510915933:283347..283512Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:282884..283032TCONS_00001415-exon-sc0000010-1510915933:282884..283032Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:282271..282583TCONS_00001415-exon-sc0000010-1510915933:282271..282583Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:281398..281549TCONS_00001415-exon-sc0000010-1510915933:281398..281549Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:276419..276584TCONS_00001415-exon-sc0000010-1510915933:276419..276584Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:274497..274630TCONS_00001415-exon-sc0000010-1510915933:274497..274630Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:267631..267785TCONS_00001415-exon-sc0000010-1510915933:267631..267785Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:257018..257204TCONS_00001415-exon-sc0000010-1510915933:257018..257204Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:254102..254280TCONS_00001415-exon-sc0000010-1510915933:254102..254280Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:253543..253693TCONS_00001415-exon-sc0000010-1510915933:253543..253693Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:253046..253285TCONS_00001415-exon-sc0000010-1510915933:253046..253285Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:250783..250917TCONS_00001415-exon-sc0000010-1510915933:250783..250917Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:250357..250582TCONS_00001415-exon-sc0000010-1510915933:250357..250582Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:250015..250075TCONS_00001415-exon-sc0000010-1510915933:250015..250075Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:249469..249605TCONS_00001415-exon-sc0000010-1510915933:249469..249605Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:248914..249207TCONS_00001415-exon-sc0000010-1510915933:248914..249207Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:248481..248638TCONS_00001415-exon-sc0000010-1510915933:248481..248638Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:248065..248271TCONS_00001415-exon-sc0000010-1510915933:248065..248271Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:247660..247731TCONS_00001415-exon-sc0000010-1510915933:247660..247731Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:247138..247277TCONS_00001415-exon-sc0000010-1510915933:247138..247277Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:246614..246664TCONS_00001415-exon-sc0000010-1510915933:246614..246664Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:246058..246196TCONS_00001415-exon-sc0000010-1510915933:246058..246196Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:245480..245571TCONS_00001415-exon-sc0000010-1510915933:245480..245571Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:244930..245152TCONS_00001415-exon-sc0000010-1510915933:244930..245152Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1510915933:243650..244460TCONS_00001415-exon-sc0000010-1510915933:243650..244460Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:305133..305170TCONS_00001415-exon-sc0000010-1491911889:305133..305170Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:304642..304860TCONS_00001415-exon-sc0000010-1491911889:304642..304860Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:302804..302908TCONS_00001415-exon-sc0000010-1491911889:302804..302908Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:300771..300956TCONS_00001415-exon-sc0000010-1491911889:300771..300956Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:299999..300076TCONS_00001415-exon-sc0000010-1491911889:299999..300076Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:294516..294735TCONS_00001415-exon-sc0000010-1491911889:294516..294735Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:291980..292098TCONS_00001415-exon-sc0000010-1491911889:291980..292098Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:290122..290409TCONS_00001415-exon-sc0000010-1491911889:290122..290409Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:289428..289608TCONS_00001415-exon-sc0000010-1491911889:289428..289608Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:288420..288806TCONS_00001415-exon-sc0000010-1491911889:288420..288806Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:287724..287947TCONS_00001415-exon-sc0000010-1491911889:287724..287947Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:287246..287412TCONS_00001415-exon-sc0000010-1491911889:287246..287412Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:286702..286828TCONS_00001415-exon-sc0000010-1491911889:286702..286828Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:285501..285673TCONS_00001415-exon-sc0000010-1491911889:285501..285673Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:283863..284013TCONS_00001415-exon-sc0000010-1491911889:283863..284013Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:283347..283512TCONS_00001415-exon-sc0000010-1491911889:283347..283512Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:282884..283032TCONS_00001415-exon-sc0000010-1491911889:282884..283032Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:282271..282583TCONS_00001415-exon-sc0000010-1491911889:282271..282583Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:281398..281549TCONS_00001415-exon-sc0000010-1491911889:281398..281549Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:276419..276584TCONS_00001415-exon-sc0000010-1491911889:276419..276584Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:274497..274630TCONS_00001415-exon-sc0000010-1491911889:274497..274630Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:267631..267785TCONS_00001415-exon-sc0000010-1491911889:267631..267785Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:257018..257204TCONS_00001415-exon-sc0000010-1491911889:257018..257204Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:254102..254280TCONS_00001415-exon-sc0000010-1491911889:254102..254280Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:253543..253693TCONS_00001415-exon-sc0000010-1491911889:253543..253693Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:253046..253285TCONS_00001415-exon-sc0000010-1491911889:253046..253285Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:250783..250917TCONS_00001415-exon-sc0000010-1491911889:250783..250917Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:250357..250582TCONS_00001415-exon-sc0000010-1491911889:250357..250582Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:250015..250075TCONS_00001415-exon-sc0000010-1491911889:250015..250075Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:249469..249605TCONS_00001415-exon-sc0000010-1491911889:249469..249605Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:248914..249207TCONS_00001415-exon-sc0000010-1491911889:248914..249207Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:248481..248638TCONS_00001415-exon-sc0000010-1491911889:248481..248638Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:248065..248271TCONS_00001415-exon-sc0000010-1491911889:248065..248271Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:247660..247731TCONS_00001415-exon-sc0000010-1491911889:247660..247731Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:247138..247277TCONS_00001415-exon-sc0000010-1491911889:247138..247277Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:246614..246664TCONS_00001415-exon-sc0000010-1491911889:246614..246664Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:246058..246196TCONS_00001415-exon-sc0000010-1491911889:246058..246196Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:245480..245571TCONS_00001415-exon-sc0000010-1491911889:245480..245571Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:244930..245152TCONS_00001415-exon-sc0000010-1491911889:244930..245152Clytia hemisphaericaexon
TCONS_00001415-exon-sc0000010-1491911889:243650..244460TCONS_00001415-exon-sc0000010-1491911889:243650..244460Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:243650..305170 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.83376 2.92197 2.17199 1.39023 12.2072 6.89286 11.1005 16.0357 8.21384 6.14355 9.2439 8.67712 21.8159 27.2174 8.43939 8.78907 19.8264 21.577 35.4192 35.9922 34.8633 32.5254 10.6319 16.8268 20.5629 11.3697 12.1005 10.869 6.3268 5.27933
Blast
BLAST of TCONS_00001415 vs. Swiss-Prot (Human)
Match: DMD (Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 533/1625 (32.80%), Postives = 865/1625 (53.23%), Query Frame = 3
Query: 1935 DIQDVIREIEEIHAVFNDECFSKKPFDQLAQQQELLKEMETRMDSVSPSVTSLMMVQQAYINQTTPEEMHNIDVHLTTMCARWNALDKEFRHRYVSVEKNVGEWQQFTDDCNSLMLFLTKAENQLRENQNDD---------VEKDLYDEINRNEFKXXXXXXXXXXXIALSTDSNAE-LKDKLESVNRRWKEIMSGLNSRKLGSLMDDPKIKEFVNKSDQIKTQLDAIFKLVFHTKPH----PVDAGSLQKYRDDLKKCE---NDLTDRRDEIGRLTDDADRLLERPDLSANQLDEI--KSRSTSMQ----------------AQVQDLTTGHSKRFDVVENNLARATRFLDELDGLSSWMSKTRDLLEGHKENKPGYNVDPEIMKKSLETRKCNVLSINDLLKDFKAEGELASGNFP--QAVGEKIGQLNVDWQIIIRLALALKERPVSEEVVVAETVQERQDAPVTFDSLQTSLSFTTTETSKYKYEMYSSTN-ENSIGGEGETA--QLHDWLRLVEQKIKSLNVTLGDEDEMAAAVQKQNSIQLEMSNRRKEYDDAISMA-----TTSPQD-----DEKINKLKEHWEGVWGKVLNKKSLINQALVDWRRYNELRLQLDNYVYKADIQLNENQQIGTTVTELEAQLEKHKKFQGELSTWANTYNTLRQLAETILSTYVNEDLNDFKTTVNETNTRWNSLETRSNAHQDSLQEALDRLLQFHKNMISALTWLSSAESKVAEL-DSLVESSQAEDTSNVDELQGEMQELEDDIASHQAMFNGLNETGKQILMDLEVGEVRTALQSKLDDMNDRWNSLGVRVVDIRDRMSYGTGEWRQLLLDMQEIVDWLSRAGQELMSQQPIASDVEKVQQQNKHHQEFKGKLNARRVVIEQALEQGHNFLLKHQSAQDESFIQRGDKL-----VVRVASSLREQLTHIQSQWLDLQNNSDKWEKTISXXXXXXXXXXXDIEKINKTLNESEEIVNHWVLTQDIPVDSVASYLGDTRRMQEQTQSMETQFDSMDGTVKELRHIHGVLLAKPTEGVIDQLHDRWKHLLNDCQIRQENLQNLMSGSDAGSV---MLQESVPTPWERGQALNKVPYFINHTTKTTQWDHPKMTELYHTLSELNDVKFAAYRTSMKLRCLQKACCLDLCELNLNIKKAFEQHNLRLSNDNLVDVGEIINVLSTIFESIDTNRKESINVSQCIDMTLNWLLNVYDSGRIGKLRVLSFKAAITLMSRAKLEDKWKYLFRQISDNTGHADSKKLGLLLHDCVQIPRQLGEIAAFGGSNIEPSVRSCFEMAKNNSAIDSNNFVAWTNAEPQSLVWMPVLHRLASAETAKHDAKCGICKEYPIVGFRYRCLKCFNFDLCQTCFWSGRVSKSHRVTHPMHQYSLATTTGEDLSDFVKLMRNXXXXXXXXXXXXXXLGYLPVQTIMEGSSIXXXXXXXXXDLSNF-TFDSAMNG----HHDSTDFHPNHHG--------------NDEEIGNE----EHHLIKLMCQSLNGEITNNNTTPKSPSQILATLDSSQQEDIGEMIRGLEEEHQSLMEEYTRL------KGIKPSNS-FENGQIVPENTQDTVLIAEAKSLREHKGRLEARMQILEDHN 6542
            +I  V + + E+  + N      K F+ L +Q+E LK ++  +   S  +  +   + A +   TP E   +   L+ +  +W  ++K ++ R    +++V +W++F  D      +LT+AE  LR+ Q  +           K+L D I + +  +  LN TG  +I  S+ ++A  L++KL S+N RW+E+   L+ RK        +++E  N   + +  L+  F L      +    P++ G  Q+ ++ L++ +    +L  R+  + +L +    +L    +S  + D++  K + T++Q                AQ++DL     K  D+ E           +L+ L  W+S  R+ LE + +       D +  + +++ ++ +V       ++  ++G+      P  Q V  K+  L+ +W+ + RL   L+    +++  +A  +     +P    +L T     T ET+  K EM SS   E     +   A  +L DWL L++Q IKS  V +GD +++   + KQ +   ++  RR + ++ I+ A      TS Q+      ++I +++  W+ V   + N++  +N+ L D  ++ E + + +  + +A  +L   ++   TV  ++ ++ + K+   +L  W    +    LA  +L  Y  +D           N  W S+  R +  + +L+E    L QF  ++   L WL+ AE+    L D+  +    ED+  V EL  + Q+L+ +I +H  +++ L+E  ++IL  LE  +    LQ +LD+MN +W+ L  + ++IR  +   + +W++L L +QE++ WL     EL  Q PI  D   VQ+QN  H+ FK +L  +  VI   LE    FL +      E   Q   +L        V   LR+Q   + ++W  L  +S  W++ I   LE +  L E  ++++  L ++E I   W    D+ +DS+  +L   + ++ +   ++     ++   ++L  + G+ L+      ++ L+ RWK L    + R   L    +  D G      L  SV  PWER  + NKVPY+INH T+TT WDHPKMTELY +L++LN+V+F+AYRT+MKLR LQKA CLDL  L+     A +QHNL+  ND  +D+ +IIN L+TI++ ++      +NV  C+DM LNWLLNVYD+GR G++RVLSFK  I  + +A LEDK++YLF+Q++ +TG  D ++LGLLLHD +QIPRQLGE+A+FGGSNIEPSVRSCF+ A N   I++  F+ W   EPQS+VW+PVLHR+A+AETAKH AKC ICKE PI+GFRYR LK FN+D+CQ+CF+SGRV+K H++ +PM +Y   TT+GED+ DF K+++N     +       ++GYLPVQT++EG ++ETP       L NF   DSA        HD T     H+               ND    NE    EH LI+  CQSLN +  +  + P+SP+QIL +L+S ++ ++  ++  LEEE+++L  EY RL      KG+ P  S  E     P++ +D  LIAEAK LR+HKGRLEARMQILEDHN
Sbjct: 2003 EITHVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKNIKDSLQQSSGRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSVEKWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRTLNATGEEIIQQSSKTDASILQEKLGSLNLRWQEVCKQLSDRK-------KRLEEQKNILSEFQRDLNE-FVLWLEEADNIASIPLEPGKEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPISPEEQDKLENKLKQTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEE-----------QLNHLLLWLSPIRNQLEIYNQPNQEGPFDVKETEIAVQAKQPDV-------EEILSKGQHLYKEKPATQPVKRKLEDLSSEWKAVNRLLQELR----AKQPDLAPGLTTIGASPTQTVTLVTQ-PVVTKETAISKLEMPSSLMLEVPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDLALKLLRDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEKFLAWLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKILRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTL-GIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHE--AHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACD-ALDQHNLK-QNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKN-KFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVT-----LINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQD--SPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHN 3583          
The following BLAST results are available for this feature:
BLAST of TCONS_00001415 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DMD0.000e+032.80Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3[more]
back to top