Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001414 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001414
Unique NameTCONS_00001414
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length7400

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001414 ID=TCONS_00001414|Name=TCONS_00001414|organism=Clytia hemisphaerica|type=transcript|length=7400bp
GCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGAGTGTCATTGAAG
ACGTCACGAAGAAAGCGGAAGACGTGCAACAGTTAGTCAACAATGCTTCG
TCACTCGGACAAATGTCGGATGAACCGGCTTTCCGTGCCATGGAGCAACG
TGTTCGTGACGTTCACGAAGTCTATCAATCGCTTTTGACGGACGGCGACG
AGAAATTGGACACACTGAAACAATGGATACAACAGTTAGATGAATACGAG
AAAAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGCATGCT
TGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGAAACAC
AAAAATTCGAGaGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACTTA
GATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCAAG
TGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCTGG
AGAAGAAACTGACCAGTATTGACGTCATgcttaaattgaaattgaagGAG
TTTgatgacaaagaaaaagaacaagaaaTCATGAGATTGCAAGAAGAAAA
GAAACGACTGGTTGCCGATGAAGAGGTCATTCTAACACAATCTAGTCGTG
TGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAATTAGATTCT
GGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTCTTCAACTCC
TACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTGTTTCTGTGG
TAACAACGACAACGACGACTAAACGATATGAACGAGAAGAGAAAGTGAGC
GTCGAACGTGACTTGGATGAGATGATCACAGAAATCGAATCCATTGAAAC
GATGTTGAAAGATTTAAAAGCTAACGATGAAAACGAATTCAAAACTACAG
AAGAAAATGCACAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGAC
TTTGAAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACA
TATCGAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTG
CTCACGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTcc
agatatttcaaaatgaagaatGACTTAACAAACGTACAAGTTTGGTTGGA
AGAGACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGA
AGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATGGAAGGTGTT
AACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTCTCTCATCCC
CAAACGACAAATCTCAttattgaacaaaaaattcaaattggtTTCTTACC
AGTTGGAACAAGTACAAGCACCAGAAGAAAAAGAAACCACCTACAAAATC
AGCGTCGAGACAGGAGACGTCGAGAGCGCTGACACGCGGGCTAGTGTCAA
CATCAAATTATTCGGCGAATACGGGAACAGTGATCAGCTCCAGTTACGTC
AATCCGAAACAAAACGTAAAAAATTCCAACGCGGACAGGTGGATTTGTTT
ACGTTCCGTTCACAACCATGGCTtggaaaactttccaaattACGCGTCTG
GCATGATAACGAGGGTTCAAACCCTCAATGGTTTCTAGCCAGTATTTATA
TACTGGATGAACTGTCAGGACGCTTGTTTTGCTTTGTCTTCGATTCATGG
TTGAGCAAAGACGCAGGTGCCGTTCTACGTGAAATCCCTGTTGGTGCTAT
GGCCCTTTATAAAGAAACTGCTCCAGATATCTTGGCCCGTAAACACAAGT
TCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATGAG
AACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTGAT
CagagaaattgaagaaattcaTGCCGTTTTCAATGACGAGTGCTTCTCAA
AGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAgAAATG
GAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGTCACTAATGATGGT
GCAACAAGCATACATTAACCAAACCACGCCTGAAGAAATGCATAATATTG
ATGTTCATCTCACTACCATGTGCGCTCGATGGAATGCGCTGGATAAAGAG
TTTCGTCACAGATACGTATCGGTGGAGAAGAACGTCGGTGAATGGCAACA
GTTTACGGATGATTGTAATTCACTCATGCTATTTTTAACCAAAGCTGAAA
ACCAACTACGAGAGAATCAAAATGATGATGTTGAAAAGGACCTCTATGAT
GAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAATACTGGCAC
GACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAAAGATAAAT
TGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGATTGAATAGC
AGGAAGTTGGGATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAA
TAAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCT
TCCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGG
GATGACCTCAAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGAT
AGGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGT
CCGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCT
CAAGTACAAGATCTGACCACAGGACATAGCAAACGATTTGATGTTGTTGA
GAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCGATGGCCTTT
CCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCACAAGGAAAAC
AAACCGGGATATAATGTCGACCCTGAGATCATGAAGAAATCATTAGAAAC
ACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAGACTTCAAAG
CTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTTGGCGAGAAG
ATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCTTGCGCTAGC
GCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAGAGACTGTTC
AAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAAACCAGTTTA
TCTTTCACAACGACTGAAACttcaaaatacaaatatgaaaTGTATTCTTC
AACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGGCTCAACTACACG
ATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTGAACGTTACCCTT
GGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACAAAACTCCATCCA
ATTGGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGG
CAACCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACAT
TGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCA
AGCTCTGGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATA
ATTATGTGTACAAAGCCGATATTCAATTGAACGAAAACCAACAGATTGGT
ACTACCGTCACCGAACTAGAAGCACAACTTGAAAAACACAAGaAATTCCA
AGGCGAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAG
CTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAA
ACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGCTC
GAACGCGCACCAAGATTCATTACAAGAAGCATTGGATCGCCTCTTACAAT
TCCACAAGAACATGATTTCAGCATTGACATGGTTATCTTCAGCAGAATCG
AAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCAAGCGGAGGATAC
TTCAAACGTGGATGAACTACAAGGTGAAATGCAGGAACTCGAAGATGACA
TTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCAAACAA
ATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAATCAAA
GTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGTCGTCG
ATATCAGGGATAGAATGTCATATGGTACTGGTGAATGGCGCCAATTATTA
TTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGCTGGACAAGAACT
CATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAGTACAACAACAGA
ATAAACACCATCagGAATTCAAAGGCAAGCTGAACGCGCGACGTGTAGTC
ATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTTGAAACATCAATC
TGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAATTGGTCGTTCGCG
TTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAGTCGCAATGGCTC
GATTTACAGAATAATTCGGATAAGTGGGAGAAAACTATCAGCCTTGTATT
AGAgCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTT
TGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATA
CCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGAGAATGCAAGA
ACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCA
AAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGA
GTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCA
GATTCGACAGGagaatttgcaaaatttgatgTCTGGTTCGGATGCAGGAT
CAGTTATGTTACAagAAAGCGTACCGACACCATGGGAACGTGGACAAGCA
TTGAACAAAGTGCCATATTTCATCAATCATACCACAAAAACGACACAATG
GGATCACCCAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATG
ACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAA
AAGGCTTGTTGTCTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGC
ATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCG
GAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAAT
CGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTG
GTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTAT
CATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAA
TGGAAATATTTATTCCGTCAAATTTCGGATAACACCGGCCACGCAGACAG
CAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGATTCCTCGACAAC
TTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAACCTAGCGTCAGG
AGCTGCTTCGAAATGGCTAAAAACAACTCAGCGATCGATTCCAACAACTT
TGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCTGGATGCCAGTAT
TACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGT
ATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCgctgtttgaaatg
ttttaacTTTGATCTTTGTCAGACTTGCTTCTGGTCTGGACGTGTCTCGA
AGAGTCATCGTGTCACTCATCCTATGCATCAATATAGCTTAGCGACGACG
ACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAA
ATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAG
TGCAGACCATCATGGAAGGAAGTTCCATTGAAACGCCAACGGAACCAACG
ACACCTGATCTATCCAACTTCACTTTCGACTCGGCAATGAACGGTCACCA
CGATTCGACAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTG
GTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGT
GAAATCACAAACAATAACACAACGCCGAAAAGTCCGTCACAAATTTTGGC
GACGTTAGATTCATCACAACAAGAAGATATCGGAGAAATGATTCGAGGTC
TTGAAGAGGAACACCAATCTCTAATGGAAGAATACACCCGACTGAAGGGA
ATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATAC
ACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAAG
GTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATTA
GAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGCCGCCCTCCGA
ACGTGAACGACATAATTCAAGCGGAAGTACGAATCCACCCTCACCTAAAG
GTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCACGGCTCGCCCGAA
TTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGCGATGGATATACA
TCATGTGACCGCAGAAATCGAACACGCCTTCCCAACATCAAGTTATGAGG
ATTAACGGAGGAATGGAAATTTTGTTCTATTAGTGTATTGTTCTGCTTTT
TCTCTTGTGTTAGTAGTGTTTATATGAAAGATTGAATCTTTTAGAATTAG
CGCTTTATTGTTAATACACAAAGAAATAATGTCATTTTTCTATCTACCCA
TTTTCAGAATCAGAAATAAAGTTCTAGGAACACCGGACGGTTTTTAGATC
CCTGGAGGACCTAAAGAAAATATCCGAAACCTTTTCTGCTACTGAAGGTT
TGGTTTTTGTAAAATAGAATACCAGTCTGGACAATTAGGTTGATAGATAC
atgaaattatttattttgaaatttaaaagaaatatttatagcttatatat
atttttatattgtaCCTTGTccatataataattttttttgtcttttctgT
TGTCTTTCCTTGTCCTCCCTGAATTCTATGTTGTGTTTTTGTTTGCCTCC
AGAAAAAACGAGGTCGCTTTATTTTCGCGTATTATTTTGCTTTTtgtaaa
taagttttttttgttttgtcttatattttttgacagaaaatcttttttat
ggaTAGAAATAATTTTATACAATTGAAAATACCTTTGCGTTCATTATCAT
Run BLAST on NCBI

transcript from alignment at sc0000010:243650..305169-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001414 ID=TCONS_00001414|Name=TCONS_00001414|organism=Clytia hemisphaerica|type=transcript|length=61520bp|location=Sequence derived from alignment at sc0000010:243650..305169- (Clytia hemisphaerica)
GCCTTCAACGCCTGAAGAATCCGTCGAAAAAGTCAAGGTTTGACTTATAT GATAATTACATATTTTGATTCTTGTATAACTGACTTTTACATCGTAAAAT ATCGAATCTACTAAGATAAGTATATGATAAGGCTATCATTGTGTCTCACT AACATTCTGCCGATTGGTAGTGTGAAGGTTTCGGTCACAGACTTGCACTG CAATGGACTGTGCTCGAATTCCAAGTACTTACAGGCAGTATGTTAGGGAA GCATAGTGATAGACTCTCTACCTTCACTCGTACATCGAATCTGCTCTTTC CTTTTTTAGAGTGTCATTGAAGACGTCACGAAGAAAGCGGAAGACGTGCA ACAGTTAGTCAACAATGCTTCGTCACTCGGACAAATGTCGGATGAACCGG CTTTCCGTGCCATGGAGCAACGTGTTCGTGACGTTCACGAAGTCTATCAA TCGCTTTTGACGGACGGCGACGAGAAATTGGACACACTGAAACAATGGAT ACAACAGTTAGATGAATACGAGAAAAAGGTGACTGAATTTGTGGCGCTCA TCTTTTTTTTGCTTTAAACTATCTATAATGGACTCTCACTGATTCGAACT TCCTTTGTTCGAATTTTTTTATCATTCCAACAAAGTGGGTTCCCGACATT AGAGTTCGAATTAGCGAGAGCCAACTGTACCTAAAGTCTATTCACGATAA GTGTGCACTCTTTTTTCTTTTACCTATAACTTTTGAAGGAATTCTTCAAT CTTTATAAATTTGGTATCATTGGAAAGATATTANNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAT CATTTTCACTGGAGAGATTCTTTGATCTTAGGAGATCATCACTGTGAAGA AATTTCATTAAAATGTTTATTCAATATAAAGTTATGATACAAAGTTAATA AGTGATTGACCCCAAAAAACAGCAAAAAACTGCAGAAAACAGCGTTTTTA GACGTCAATCAGCTTATAACTTTGTTTGATATCTTTTGACTGAATAAATA TTTTTGAGAATTTTTTTCACAGTGATGACGTTCGATGATTAAAGATTCAC TTCAGTGAAAATGATAGTTATAGCACTTTTCTACAAGATCTTAATTTTTT TCTTCTTCTTTTTCATCTTCATTTTTAGAATTTTTTTAAAGATTTTTTTA TTTGAAATTGTTCCACTCACTAATATCTTTCCAATGATACCAAATTTATA AAGATTGAAGAATTCCTTCAAAAGTTATAGGTAAAAGAAAAAAGAGTGCA CACTTATCGTGAATAGACTTTAGTTTATGGTTTATAGTTATTTGACTAAA ATTAACGTCTTTTTTTTCCCTCAAATAAAAAGTCAGCGTGCTCTGTTAAA TTGTTTTATAATATCATTTGATATTTAGACTCACAAGTTGAATTTTAACT AAATACGTCATTTTACCTTGTGCAAGGCAGAGTACCTAGTATTGAACGAT ACTTTGAATTCTACTAATTTCCCTAAATGTAGTAGTCTACCACTTGAAAA GTCACGCCGCCACTTTAGGCTGACTTGTTTTAATCAGTAGTGCGGTCACT CTTAATCACCTGCAATCATTAGAATATTAAAAATCTACCAAAAATATTTG TTTCATCATTTTTTGAAACCCGCATGCTACACACCGTGTAGAGAGTTGCG TGTGTTTTGGAGAAGTTTAATTTATGGTAAGAGAAGAACATACAACGTTA GTAATACTTTGTTATGTTTTGAAAAGTTTGCAAATTTACTCTGGAGTGTT CTTTATATAATAGTACAGTTGAGTCTCCATAACCCCTGCGGGGAATACAC AAATTTTTTGCAAATTTTGAGATATAGAGTAAGGTTTTTTTTATGGCATT GTTAACATTGAAGGGACCAAAAAACTTGTTTGAGTTAACGATACAAGTAA TAAATAGAAGTTAGAGTTAGAGGGACTGTAATACAAGTCATGAATAAAAT ACTGTCTCCCTTTGATTTCCGTTGCCATACCCTTTGCATTCGAAATCTAA CTTGGAAAATATTATAAACCGGATTTTGTTCTCTAATATCTCTAATATCT TTAAACACAAGGTTGACGATTTGAACACGTGGATCGATGGCCGAATGAGC ATGCTTGAGAGCATCGGTGGAGTCACCAACAAATGGGAAATTGAAATGGA AACACAAAAATTCGAGGTAAATCATGTAAATTTAGATTGATTTTGGGTTG TAACCTAAGAATACCGTATGGATATCCATGATGAAATGGAAAAATACCAT TCTTATAAAAAATAGCGTGTAATCACTTCGATCAACTTCGACGATTGGAT TGTTTGATCAACATCTCTTGTTTCGAAGGGTCCTAAACTTAGGAATTATT TTTGAGTTGAGGCAGCTTCATATATTCTTGCACTTGAACCTTTAGCTTAG GGCAAAAAATAAACTCTCCTATAAATCGAGGCTTGCGTCTGCTTATCATA ATAGTTCCCTTAATTAGTTTTTACGTGTCACTTTGTCAAAATCTAAGGTT CTCAAGTAAGCATCTTATACCTAGATATAGTCGCTTATAAAGATACAAAA GGGTATTCTGATAATTATAGGGTATTAACAACTATCATTAATGGATAAAA AAGTAGGATCAATTTGTTTACTGAAAAATAAATCATTAATTGATAAAAAC AACATTTGTCTTTTATAGAAGAGCTTACCTTTTTGCAAAGAATAACGCTT TTAATGATTGATTAAAAACAATTTTTTTTGTAGAGCTTGAAATCCATGGT AAATGCAAAGGACGCTGACTTAGATCAATTGAAAGCTATCGGCGACGAAT TAGTTCAAAAGGGGCGTTCAAGTGTTGTGGAACCATACGAAAGACAGATC TACCAACGTTGGGATGATCTGGAGAAGAAACTGACCAGTATTGACGTCAT GCTTAAATTGAAATTGAAGGTTTGTGTGGNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTCGAGT CTCCATAACCCCTGCGGGGAATACACAAATTTTTTGAAAATTTTGAGATA TAGAGTAAGGTTTTTTTTATGGCATTGTTAACATTGAAGGGACCAAAAAA CTTGTTTGAGTTAACGATACAAGTAATAAATAGAAGTTCGAGTTAGAGGG ATTTGACTGTAATACAAGTCATAAATAAAATACTGTCTCCCTTTGATTTC CGTTGCCATACGCTTTGCATTCGAAATCTAACTTGAAAAATATTATAAAC CGGATTTTTTCTCTAATATCTCTAATATCTTTAAACACAAGGTTGACGAT TTGAACACGTGGATCGATGGCCGAATGAGCACGCTTGAGAGCATCGGTGG AGTCACCAACAAATGGGAAATTGAAATGGAAACACAAAAATTCGAGGTAA ATCATGTAAATTTAGATTGAATTTGGGTTGTAACCTAAGAATACCGTATG GATATCCATGATGAAATGGAAAAATACCATTCTTATAAAAAATAGCGTGT AATCACTTCGATCAACTTCGACAATTGGATTGTTTGATCAACATCTCTTG TTTCGAAGGGTCCTAAACTTAGGAATTATTTTTGAGTTGAGGCAGCTTCA TATATTCTTGCACTTGAACCTTTAGCTTAGGGCAAAAAATAAACTCTCCT ATAAATCGAGGCTTGCGTCTGCTTATCATAATAGTTCCCTTAATTAGTTT TTACGTGTCACTTTGTCAAAATCTAAGGTTCTCAAGTAAGCATCTTATAC CTAGATATAGTCGCTTATAAAGATACAAAAGGGTATTCTGATAATTATAG GGTATTAACAACTATCATTAATGGATAAAAAAGTAGGATCAATTTGTTTA CTGAAAAATAAATCATTAATTGATAAAAACAACATTTGTCTTTTATAGAA GAGCTTACCTTTTTGCAAAGAATAACGCTTTTAATGATTGATTAAAAACA ATTTTTTTTGTAGAGCTTGAAATCCATGGTAAATGCAAAGGACGCTGACT TAGATCAATTGAAAGCTATCGGCGACGAATTAGTTCAAAAGGGGCGTTCA AGTGTTGTGGAACCATACGAAAGACAGATCTACCAACGTTGGGATGATCT GGAGAAGAAACTGACCAGTATTGACGTCATGCTTAAATTGAAATTGAAGG TTTGTGTGGTCTTTTTTACATTTCCTTCATAGTTCAACTTACTTTTTGAT TTGCATTACTGCAACTGTAAGTGTGCATTTTTTTGTTGCTACCATAAAAA AACCATCTTCAAGGGAATTAGCAATCTTTTACCCAGAGCCACTTGAATCA CTTGTTAATTTTATTAATTTCATATGATGTTACAACCTTTCGTGAGCAAT CATAAAAAGCGAACTAAGGGACTGGTTTTGAGTTTGGGGAATTAGACTAA TTACGCTGGTATGGAATGGCCTTATTTTTTCTGTTGATTTCTGACGAAAT TTGCGTTGACGTAAAATGATGTGATTTCCTTCTTTTGCTGGTTACTGTAT TAAAACTTTAACTTTATGGCTACGTAATGGTTTCTTTGCCTTATTGAACG CTGGGAGTCCTTCACTCTAAGCTACCTGTCTGAACAAAGGTGTCACTCAC AAGCATAGATATTTTATACAAACATGAGATGGAACTTTTTCGTCTCGAGC TGAAGCAAAAAAATGCAGGTCGTTTGCTTTGATTGAAAAAATCGTCAGTC TATTCAACAAATATGGTGCATTATTTTTCTTGACTGCTTTTGATTGGTAA ATACAGAGTAGTTCTATCTAGTGTTTTATGTAAGATATCTGTGGTCACAA GGCATTTTCTATTCATGATTCTTTTTCTATTTTCTTTAAATAGGAGTTTG ATGACAAAGAAAAAGAACAAGAAATCATGAGATTGCAAGAAGAAAAGAAA CGACTGGTTGCCGATGAAGAGGTACGATTAACTTACAGTTGACGCTCTCT AATTCGATTTTTAAGGGGAATTGGATTTTCGTCGAATAAGAGAACGTATC GCATCGTAAATGAGAGTTTCTTGTTGACCTTAACTTTCAATATTATCGGA TAATGGGGCGTAACAAATCGTGGAACGTCGAATTAGAGAGCCTCAAGTGT ACTTTACTTTTTTCATCGCAAGTAAACTGAACCAAAAAGAATTACAGTTA ACATTCTTCCTAATTATATCAAAGGATCGAGGGGATCATCCAATGATTTT CTTTGAAATAGAGGAAGGTTCGGATTTGATGAAGTTCAAGACTTTCCAAG CTGAGGTGTGTCCAAGTGTGTCAGTTGTGATATCTAAACTTCGATCCACA AGGCTTACTAATGAATCCTTAGTGTTAGTTAGCTAAAGGATTGTGTTTGT TTTTCTTGAGGAAAAGAATATACCGGTTCAAGATCGTTCGAAAATCGTTC AAATTGCGACAAAGACACATTGATTTCCAATGCTAACATACACGTTAGAT AATTAGTTTTTTAGAGGATACTAATTAATAGTAATAGCTTTTCGAATGCA ACCAGCTAATTAAGAGTATATAGGTTTAGCATTGAGATGTAAATTTTTTG TATCTCAGAGAGAAGGTAGTTGAAGAATCGAGTGCATTTTTTTTTGTTTT CTGAAATTAATTTTGTTACATGTAGTTGTTCCAATAATGGTTTGGATTGG GTTCTGGTTTTCCTAAAAATTTCAGTATTATTTGGACGCAACATTTTAGG GAGCTTTTCTGAAAGAATGGAAAGCCTTTCGGTTAAAGGTATAAAGGTTA AAGGTTATTTAAATTAATGGTGGGGGAGAATGGGCGAATCGATTGTTACT TGTTATTTGGTATTTGAGGTTTTGAGTTTTCAAGTATAGTTTGATCTGCG TGGATAACTTTCTTTGCATTCGAATTAATGGTGCTACAGTCTTCTTGAAG AAAAACACACACTTTTTAAGCTTTTTTTACGATATAATTAACCAAGATTA TGACATTTGTATGCAAGCAATTTCCGTGAAACAAGTTTGCATTTCCTTTG CGAAAAAAAACAATGAAATTATACTCGCACAAGTAAAGNAATTTCCGTGA AACAAGTTTGTATTTCCTTTGCGAAAAAAAATTGAAATTACACTCGCACA TAGCAAGTAAAGAAGTGAAGGAGTTAGAAAGTTAATCCTCTCCACTTCTC AGGACACAATATTCATTCAGACAGCATTTTTAATTTCGCTTAGCGAAAGT ATTACGATAGCCTTCCGTGTATGTATGTATGTGGCGAGACATTTTTTGGG GCGCAAATTATGGCGTGGNCGTACAAAGGACATTTAGATCCAGCCCACCA TACACCACTGCACAATATGCAGCAGTCCCTCTTTAAAATGATGACAGTTT TTTATCCGATGAATTTTGATTGGTGCTAGATGAGTTTGGTTAGTAAAAGT TCCAGCTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNCTTTATCACAAGTTCCTTCAAAGCACAAAAC GAGGTTTCTGGCATCAAAGAATGAAAAGTTCATTTTTTCTTTTTCATTTT CAAAAAAAATTTTAATTATTTTTCTCAAGTATATTGCAGTTCTCTGAATT ATTCTGAATTGAAAGATCTTGTTTACGCTTTATAGTATGGAATTCTTTAG TCGCATTTTTGAAGGAATCTTTTTTTTAATGGATTGAGATTTTTCATTAA AAAAAAACAGGGTATCTATGACCTGTGTGTACAATATATNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTG TGTACAATACATTGTGTATATTTTGTGTAACGCTTCATTCAAAATGCATA ATGCTGCAGGAGTCACGTTTCACGCGTCTTCGTCGTTGATGTTCGAGTAT TATGCGAAATTTTCGACTTCAAGTCGTCTTGTTTGTATGTCAACGAACGC TTATAATCCTGTCTTTTTCAAAAAATCTTTCTTCTGGGATAAGCAACAAG ATTTTCGAGTTGTCCTAAGTAGCACTTAATAAAAATAGGATTTCAGCAGG ATTTCAATTTTAAAGACTGTTTGTCTGCGTCTTACACGGGAGAAAGTAAG GTTTATTCATTTTATGTTTTTTTTATCATCTACAGTGGCTCGTTTTGTAT GCTCTTGACTCTATGACGAATAATAGTAACCACTTCTGCTGATATTTTCT CCAAAAGTATTATAAAGTTTAGTTACATGGTTGGACTTCGACAGTACGTT AGACGCTAGTACAGTGGAGTCTCCATATTCAAAAATTTGTTCGAATTATG GAAATCTTGAGTTTTGGAGATTGGTATATAAGGCATTGTTAGTTAACTGA AGGGACCAGAAAACTTGTTCTAGTCAAGGAGACATTCGAGTTATAGAGGT TTGAGTTATGAAGACCCCACTGTATAAAGATTTTGAGGTGTACATTTGAA TCGTGCAATCTTTCCGAAGCAGTAAAAAATTGTGTTTATTCTGTTGTTTG CTTATTTTTCCTTTCATTGGCAGTGTTGTACTACAACTAGTTGATATTAA TGTGTTATTTGCCCATTCAAATTTTTGTACCCTAGTTGTTACTAAAAAAA AACATTTTGCAAATCTATTTGAGGGTTCATTTTTAAGGCCTTGTTGCAAA TCATTTTTAGAATGTTTTGATATATTTTTATATATTTTTTTAGCTTTTTC TCATTGCAGCTTGTTCTGAACTGAAAAAATTTCTTTTACACGAACATAGT TGAAATCTCTTTACAACAGTACTGGTATCTCCATACTTGTCTTTTAAGAT TGTATTTTGAGGGATAAGAAGCATAAAGTGAAAAATTACTCTAGTTAATT ACAGAAAGTTTTTTTCCCTTTATACAGAAAAATGTCCTTTCCCTAAATGG TAGCCAGGAGAAAGATCAAAGCAGTTGATGATTATGATTTTAATTCAGTA GAATAACTAGAGGTTCTTCATTTTGCTTTTTTAGGTCATTCTAACACAAT CTAGTCGTGTGGTGGAAGTCCACGCAGGCGTTGATATTGACTTCGACCAA TTAGATTCTGGCTTACCCCAACCCGAAACTAAAACCGATATTTCGATTTC TTCAACTCCTACCGATGTCATCATTAGCAAGCAATCAACAAATGTTTCTG TTTCTGTGGTAACAACGACAACGACGACTAAACGATATGAACGAGAAGAG AAAGGTTGGTCTTTTTAACATTTTTACTGTTCCCCTGTTCTGTAATTCGA TCACATGCTAAGAGTAGTTCGAGATATGGAGAGCTCGAGTAAAGCTATTT TCGGATGCTTAGTGCAAATGATAGTTTACGAGTCTAAGGGAGAGTTCTAC TTTTTTGGTTGGCATGTTGTCACAGTCTTTTTGGGGGACACAGGGCCCAT GCCACCAAGGCAACAAGGGCTATGTTTACTTGGAAGGGACTTGGAGTAAG TTCGTTGCTTGCAGTAGTAGAGTGTCTACTATAGAATTTAGAGTCAAAAG GATGGCCCCAATGACAATCATCTTCAGGAGGTATTAGGCGGGACACAATT ATGAGAAAGAATCACCCAGGTTATTTACAAGAAGGAAAAATCACTTAGAT TTTTTGGTCACCGTTGGAAACACTTCAAGCATTCATTGAGAACAAAAAAG TATGAAAAAGGAAGAAAGAAAAAATTGAAATCCTCAGTCCTCCTGTGCTT TGGGTTTAATCCATATCAATGAATGAGATTTATTAAGTAAGCAAGCAGTG TAATCTCTCATCTGTTTTCAAATGGTATCTGACAAGATTACATAAAAAAT GGATCAATACGATACTTTTTCATGTTATGTTTGTTAAGGATTCAAAAGGG ATAACATACGATTATAATTTAGCTTCAATAATTTAATGAACAAGTTTATT GCTCATTTGGCTCTCCTTGAATGTAATATCAACTGTGCTGCACTGTCGGG CTCAATCGAACTTGCTTTCGTTTTCAAAAATAAAATGGACATACCTATCT ATAGTACATTTTTCCTATAAGAACTTTAATCAAACATTGAGGCAGATTTT TGTCAATGTAACATTGAAATGTCGATACAAGTAAGGTGAAGAAGTAAGCT GGACATGTTTTGGATAACCAAATTGATTATTTCGAAACTGCAAACTTTCC TTATTCCTATACTGGAAGGTGTCATAAACCTTCATTATCCCTTAGGTTGT TCTTATAGAGCTAGTTTTTTGTGTTTTCTATCCTTTAACATTGGACAACT GAGTGTCAAACTGTTCAAGAGAAAGTCTCCCAAGAAACAAATTTTAACAA AGTTTATGCTATATGGGCTGCTCGTTTTTTATTTTCATACTGTAGTTCTT ATGATGAGATTTGGAGAGATGTATTTCTATCAAAATAGAAGATTTTTAAT GAAAATTTTTTTTATATCAGTGCCGGGAGACAGACAACATATAAGTGATA TTTTTCATACGTTTATTTCTGTTCATAATAATCAAAGTTTTACTATGTTA TTATTACACACTGATGATTGAAAATGAAGAATTTCGCATTGGTGATTGAA AATGAAGAAGAGAAATTTACTTTACTTTAGAGATTCCAAAAGCAGAATTA TATACTGTTATTGAAAACAAGAAATCGTATGGAATCATTTTTTCACCAGT ATTATAGTTATAGATTGGTGTTATGACGTGTTATGAAAATATCGAAGAAT TTTTTCAAGAGGAGATTATTATGATATTTTGAAAATAAAGAACCCTAGAG AACCTCTTTTGCTATTTGGGGACCAACAAGGACAGAAATAAAAAGGGGAA ATTAATTCAAGAAATAGAAAAGAATTAAAAGGACAACAATAAAAGGACAA GGAAATCTTAAAACAAAAATGAAAATCTTATCGAAACGTATTTTCAACAA AGTCTTTCAAGCTCATGGTGTGTTTCGTTCTTTGTTCGATCTCATTTCTT ACAGTTGACTCTCTCTAATTCGATCTTCAAAGGCACCAAAGATTTTCTTC GAATAATAGAGAGTATTTTGCATGGCTTCCCCTTGACGGAAACTGGGAAT CATTTCGAATTACAGAAAGATTCGAATAATAGAATTTCGAACTGGCGAGA GTGCATTATATTTCTTATTGAGTACTTTTTCTATACACAGAAGGTCTTAT TCGATGGGCAGGGCATGTTGTGCTGCATTTTTCCAAGGAACTAAGTGATT TAATCAAGTCAACTAAAACTCCCTGAGCTCTCTCTAGAAAGACCCGTCGT TTGTTAAACCTAATATTTGATCCATTCTCATAGAGACCCCAAGGTAACTT ATAGATGCTTTCTCTAGATTTTAGCTAATGCGATGGAGAGAAGTTAATAC GATAGTCCACCTTACTCCAAGTCAATCTTCTGCTTTTTGCAATAAGTTTT AAACCGAACTCTGAGGTCAATGATATGGCAATGTTGTTTGGGAACCTTGT CACAAACTCGTTAACATAGTTGTAATAGTTTTATCCTCTTTCCCTTTCCC CGAAACTAAATGGTGGTCTAGTCGAAAATATTCTTAACAACGTAAACTCA ACGAGATTGTCTCCTCCACAGATAAACTTCATGATTTTTCATGCATCTTT GTTTGCTTTTCTTCATTGCAGTGAGCGTCGAACGTGACTTGGATGAGATG ATCACAGAAATCGAATCCATTGAAACGATGTTGAAAGATTTAAAAGCTAA CGATGAAAACGAATTCAAAACTACAGAAGAAAATGCACAGGTATGTATAG CCTAGAAATCTAACCCAGATTGATTCAGTCACTTAGTAAAATCTGATGGT AAATTGTGACTGAATATCTGTTTTTCGAGGCAAACTTAAAATTCCGTACG TATCATAAAAATCATTAAAGCGCCGATAACGCTATATTGCCTTCAGCCGT ATCTTAGCCTTATAGAAACTGGCTTGGTTAACCAGGCTAAGGTATATAGA GAAAAGAAGAAAGGAATACAGTGTTTTTTTTTCACTTTTGCACTTTTAAA TAAAAGAGACAACATTTATTGTCCACTAGTTTTCCCTTCCCTTATTCATT TTCTAGAAAATTCTATACCCCTCATTGTATTCCTTGACAGTATTTTCAAC AAGTCTATAGCCCTCTTTACATTCTTTGAGAGGATCTTCCACACCTTGAT ACTTTAATCGCCATCCATGAGAAGCTTCTTTATTTGTAATGCAAATGACT TGNAATCTTCAACACCTTGATACTTTAATCGCCATCCATGAGAAGCTTCT TTATTTGTAATGCAAAAGACTTGCTTTATTCTGCTATCTGGCTATGTGTC AGAGGTTTGGTACAAGGAAATTTGAATTCTCCTAATAAAGTCAGCTTAAA GTCGATTTATTAACATATGAAGCTAGACAAGCTGGCTGATGTTTTTAAAA TGGTATCTTCCTTTCATTTTTTATTCACTAAAGCTCTTCAAAAAAAATTA TTTTAAATTTACAAAAAAGTCTTCTATGAACGAATAAAAAAGAAATTTTT GATATGTGCCCTAGCAGACTCTCATGATACTTTTAGTGGGGCTTTGGGAT TTTTTGTGATACAGTTGGCTCTCTCTAATTCGATTTTCAGGGGACCAAAA ATCTTCTTCTAGATAAAGAAAGATTCGAATTACAGAGAGTATTTTATACT ATTTTTCAGCTGAGGGAACCAATATTTTAGTTCAAATTGTAGAAAGCTTC AAATAGTAGAGGATCGAATTAGAGACTGTTGTTTGTAATATCAAACCTGG TTATTTATAAATTTTGAGCGTCAGAGAGTATGAATTTTAAAATGGATCGC AAGTTCGATTTCATCTTTAAATTAAAAATGATGCTTGTCATCTACCTTAA GGTACCTTTGTAAAATGTTTTCTCTTTTTCAATTATTTACTTCATCAAAA GCTAATATTGCATTACTGCCGCTTTCTGTGCGATTACCTGCTAGTAGCAT CCCTTTGCTAAGACATTCCTTCCGTCCGCGCGTCTAAAAAATCATTTTGA TAAAATACTTCCGCGCGTGCGAAATTTGATTTCAAATTTTGTTTCACGAA TAAAATTCTTAAGCAAACAATTGATGTTTAAATGTTGCGTTAGATTAGAA TATCGTGTTTGGCTAAGAAAGAAAAAAAAGAATAAGATATTTTTGAAAGT AAAAACTCACATGAAATGAAAATATTTTAATGTTTTATCGTTTGTCAAAG GTCAAAATGATAATTGTATATTAAGCCTCGTTTTGATGTAGCCTCGTTTT AAAAATATATAAAGAATGCCAGGAAGTGAACGTCCGTGCTCCATTGATCT CTATTTTCAGAAACTGGAAGACCAACTCAACTCGTTGCAACCCGACTTTG AAAGTTTAATGACAGATGCTAAAGAGCTTATCAAACAGTTAGGACATATC GAAAAGAAGGGACCCATTTTGGACCTGTCACGTCGCATGAGTGGTGCTCA CGCCAGTCTGGCGATCCGCAAGAAAAGCTTAAGGAACGCAGATTCCAGAT ATTTCAAAATGAAGAATGACTTAACAAACGTACAAGTTTGGTTGGAAGAG ACCGAGAAAGCGTTGAGATCAGGAGACCACGATCCTAATAAAATGAAGGT ATGCCCGTAAACACGTGTTTGCGCTTGTGGTGAGCGGAGAAAAATAGACT ACTCCTCAACAGGGTCTTAAGAATAGACCTTTTCATAAATTACTTTACGG ACATCACTTGCCTCGTTTTGAAATTATTGCCATGTATGGTGATTAACTCC CGGCAGATTTTATTAAAACTACTTTCTATCTGTTCATTAAAAAAATCGTT TATGTATCATGAATACGAGGCAAGTGATGAAAAGGTCTATTCCAAAGAAC TAAAATTCTGAGCGTTACTTCTATCCGCAGACACGTGTTTCTCCCTTCCC AGTACTCATCAGTGTGGCTCCGGTAAGCGAGAACATATATAAATAAACGG ATCCGTCCCTCGTAACTTTTGGTTTGACAAACTAAATAGTTCTCTAAAGA TATCTTTTCCTTACCTTAAATTTTCCTGTCCCTTCCTATCCTATGTTTGA GTTTCCCCTACAGTATTCATCGTTGTTCGTTACTTATTTTGTACACAAAT CTTCATTCCAGTTCATTGAAGAAAACATTGAAAGATACGCAGCCGAAATG GAAGGTGTTAACATCCGTGCTGAACAATTGTCAGACATATGTGCCGATTC TCTCATCCCCAAACGACAAATCTCATTATTGAACAAAAAATTCAAATTGG TTTCTTACCAGTTGGAACAAGTACAAGCACCAGAAGAAAAAGGTTTGGAA GTGTTTTCGTCTATTTCCTCCATGCCGTAGATCACTGACCTTTATATACC CTGGACCAAGCAAAATCTTTGATCGGAGTATTTTGAAAAGTGGTACCCTA ATGGCGGCACTACTCAATAGCGGTGTAAATGCATCGAAAGCGCCGCTAGG TCTACTTTACCTCTAGACTAGAGTCTACTTCTGGCTGAACTTTGCTTTTT GATAATTTTTGATGACGCNTAGGTCTACTTTTCCTCCAATACTTTTGATG ATGTAGTGCCGTTAGACGTTAATTTTTAACATCGGGTACCAATTCCAAAA AAACTTCGATCAAAGATGGCGGATATAGCTAGGTCCAGGGATATATAAAG GTCAGTGCAGTAGACACATCCTTAAGGGAATTTTGGTTTAGTATTTTTAC CCTTGTATCTCTCAATATATTCTTTCAATGATATCCTGCCTGGAACTGAA TGGTTGGGATAGAATTGTCTAGAAGTTGATCAACATTTCTGATGGTTGTT GACAGAAAGGGGACCGTAGATTTCACTTAAAACTAATTTTCAAAATAACA TTCTTGCCCTTTACAACATATTTCAAGGCCTTTTAAATTGATTTAACTTT TTTTTCTCCATAGAAACCACCTACAAAATCAGCGTCGAGACAGGAGACGT CGAGAGCGCTGACACGCGGGCTAGTGTCAACATCAAATTATTCGGCGAAT ACGGGAACAGTGATCAGCTCCAGTTACGTCAATCCGAAACAAAACGTAAA AAATTCCAACGCGGACAGGTGGATTTGTTTACGTTCCGTTCACAACCATG GCTTGGAAAACTTTCCAAATTACGCGTCTGGCATGATAACGAGGGTTCAA ACCCTCAATGGTTTCTAGCCAGTATTTATATACTGGATGAACTGTCAGGA CGCTTGTTTTGCTTTGTCTTCGATTCATGGTTGAGCAAAGACGCAGGTGC CGTTCTACGTGAAATCCCTGTTGGTGCTATGGCCCTTTATAAAGAAACTG GTGCGTTACTTTANAGGTGCCGTTTTACGTGAAATCCCTGTTGGTGCTAT GGCCCTTTATAAAGAAACTGGTGCGTTACTTTAAGATTCCATTTTTCAAT TTTTTTTTAATCTATCACAATGTCGAGTCTCTTACCTCGGACTACAACTC GAATGTCTCCTAAACTCAAACAAGTTTTCTTGTACCTTCAGTTAACAATG CTTCCATACTCCATAACTTGAAATTTCTATAACCCGTGTAAATTTGTGTT CCCCGTGTGGGCTTGAGTTATATAAACTCAACTTTATATACGATGGGCGT GTATTAGTAAAATACCACAGGGGATATTTTTTAGAGCCCCCTTCAAGGTC TTCTAAAAGTAACCGTAATATTGTTACAATTGCTTCCTCTAAAGAATGCA TTGTTTTGAAATTGGTCCCTTCACCGGCTACAGTGACGATTACTTTCAAC AAGTTCGATCATTTCTTTTCAGCTCCAGATATCTTGGCCCGTAAACACAA GTTCACAGAAGTACAATGGTTATTCGACACTTTGAAATTGACCTCATATG AGAACAAGATGAGAACAGTTGAAGAACTTGTACAGGATATTCAAGATGTG ATCAGAGAAATTGAAGAAATTCATGCCGTTTTCAATGACGAGTGCTTCTC AAAGAAACCGTTCGACCAGTTGGCTCAACAACAAGAACTTTTAAAAGTAA GATGATTTTTTAACATAGCATGTCGGGTCTTCCCTTATCTAGCCCGGGGC CACTTATAGCTTTTTGATTGACTTGAGAGATCCAAATTTCGGTGGTGTTT TCATATTTTTACTATATTTTTATAAACTTGGGGTTTAAGATTACTATTTT ATTGCTTTGATTGATGTTTTTATATAATTTTTGAAAACGAAAGTGAAAAA TTCCAAGATGTCGATATCCTCTATTCTACTTAGCTGGACCCGTTTGGAGA TTCCTCGAATCACCAATATTTGAGATGAATTTTTTTCATTTTAAATTTGT TCTTAAGGAAATGGAAACCCGTATGGACAGTGTCAGTCCTTCGGTGACGT CACTAATGATGGTGCAACAAGCATACATTAACCAAACCACGCCTGAAGAA ATGCATAATATTGATGTTCATCTCACTACCATGTGCGCTCGATGGAATGC GCTGGATAAAGAGTTTCGTCACAGGTATGAGTTCAAGCCATTTTGGTCAA ACTCAGCTTTAAGAAAGCGCGGAGACAAAACCCTATCTTTTTAAATCTAC GCTTTCTGTCTGCATACTTCTTATAAATTTCAAAAATTGGAATATGGCAA AACCATTGCGTTCTAATAGATTTAGAACGCCATGGGCAAAACCAAAGTTT GGCCTTTTTAAAAAGACATTCAAAATTTTTGAAACCTTCGGATGTTCTTC TTAAATTGTTTTTATTTTCACCAGTTTTGGTGAGTATTTTTATATTTTCT TAAGAAATCAGTTTTCAGAGTTCGCAAAGCCTCAAAATGTTCTCAACTTG TTCTTAATATTTTGGCAATCAAAGCCGTATATTCTTATATAGTTTGTTCT CATATATAAAAACGTTTACTAACGTGTACATTTCTTTCTAGATACGTATC GGTGGAGAAGAACGTCGGTGAATGGCAACAGTTTACGGATGATTGTAATT CACTCATGCTATTTTTAACCAAAGCTGAAAACCAACTACGAGAGAATCAA AATGATGATGTTGAAAAGGTTTGCCAACTTGTTTTGTTCTCTTTTTCAGA TGGATTTCCGATTCAGCGAAGTAAATAATTAGGCTTTCCCGTCTCAAAAT ACTGCATAACTAACTCGCTCAAGTCTCAAGAATATATGCAAATTTGCTGT GCAAAAACCATTTTTCGGGCTCAGACAGGTAGAAAACCCTGCTTTGACCA CTGATTGTGTTTTCCTTTTTTCATTATTTTATCTTCACGGTAGGCTAGGG GCTCAAGTTGTGCTGCTGAATCTGTAACATCATCGAGGAACCATTAAGAT AGTGACACCATTAGATTCTCTGACTACTTCTAAAGACTTATTTTTAAACA ACAAAGTAATTCAATAAAAGTTTTAACAGTGATGTTTCAAAATATCAAAA GAGACTTCACTTTCAGACTACAATGCAATGGCTGAACTTGTTTCAGAAGT AGAAAGAAATCTTAAAACATTCTACGATTTCATTGAGCTTCATTTGGATT CAGAATATAGTATTTTAATAGTCTATAATATTAGCGGGATGCTAGTTATG GAAGCTTATTTCAGATCACAAGACTAGACAGAGTCTTAGAACTAAAAATC ATCTTGTCTAATCATGATTCACAAAGATAAAAAAGAAAGCTTAAGATGAT GAATTAATCATTCTATAGACTAGAAAGAACCGAGAGGATGATCACTACTT TGGTCATTAATTGTCCATTCTGCAAAATTTAAATCTCACTTTTATATCTT CTACAGCACGCGTGGTTTGCTATTTTCTAAATCAAATAATTCTCAATTCA TACGAAACAAAGACTTTTAAAAGTCGCCGGTTTTAAAAATTAAAACAAAT CGATTTGGTCCCAAAAATGCAAAACTTTAAACTTTTAGGCTCGCAATTTG TTAACTTTGTTTACCATTATGTAATTGCAATAATTTGGCATTAGTCAGTT TAGAAAATTTCTATATTCTTATAAAACATGTCTACTCTATAAAGAATACG ATGACATCATTTTTCATTAGTTTTGTTTGTTTGTTTATCTACACAGGACC TCTATGATGAGATCAATCGCAATGAATTCAAACTGAATAACCTCAATAAT ACTGGCACGACGCTCATAGCCTTGTCCACAGACTCAAATGCTGAGCTGAA AGATAAATTGGAATCGGTAAACAGACGTTGGAAAGAAATCATGAGTGGAT TGAATAGCAGGAAGTTGGGGTAAGTCAGTTTCATTGTTGTATATTTTGTA TTGATATTTGAACGTTTGAAAAAACTTGTGAACTAAAGATAAGCTAATCC ATTGGTTTCAACTGATGATTTTCAACAAACTATCTTAGAAAGAGAAGAAA AAAGTTTTTTTGAAGTGAACCAAGAAACATTCTACTAATTACTCAAGTAT AGAATAATTTAGGGATCGGGCTATTCCAGAAATAGTCTGTACCCCCTATG TTGAGGTCCAGGGCAGTCTGGGAAATGAAAAATCTAGGGTTTTCTGGTTT TTTCGAGTTTACAAATCCAGGGTGGTCCAAAAAATAAGTACAAAAATCCA GGGGGTCACCTTCCCCAAAAAAGACCTCTTCGACATAGGGGGTACAAATC TTTTCTGGAACAGCGAATTCCTAATTTAGTATTGGAAGTGACGCCACGAT TGCACTCTCTTGTCATTGACCTAGAAATTTTTATATGTCAAATTTCCTTT CAGTTCGCTACTCAAAGCTGAGCTGATCAAGTGCTTTAAATACAGCAAAG TGAAAGCTCTTAGAGCTTTGTCCTATATAGTACTAGCTTTACTCGTTAAG CCTATCATCAGCTAAAATATATGTAATGGTTGTAAAGAAAAAATTCTGAA TATTTTTATAAAAGTGATTTTATAAGAACAATCTTATAAACAATATTTCA AAGGTTTTGATTTAGTTCTTTCAATAAATCCTGAAGAAATATTTCTGGAA ATTTATGTTTGGTAAAATGTCACAAATTCCTAACTCTTATATCGTATAGA TTATTAGTTTAAAACCAACAAAACTATTCTTGGGCCATTCCACATTAAGT ACTTACATACCTTCATGACTGATATACGTCAAAACCTTTGGCAAAATGCG GGGGCGAGCTTATTGTTCTTAATCTGCACTTAAGAGTGTTTTCTCCCTGC TTTTTTTGATTTTGTTGTTCTTGCTCGAGAGCTTTTTTCAGCTATGCAAT TTTTTTTGTAGAGTACAATTTTTTTAGTAGAGTTCACTTTGATTTAGCTG TATACACATTTTTACTGGAGAGGACTTTAAATTAGTATTCGTTTAGATCT TGTTGGTATGCGAATAAAGGTTATTATGATATTTGTTCGTTTTTCATTGT GTTTAATCACACAGATCGGCATTCTTGACTACACTTTTTTTTACAAGAAC CAGGAAATTTTGACAAGGCTCGTTTGTTCTTATTTTTTGGTACTTTCAGC GTCAAATTGTTCTTATCCTGTTCTTATTTATAGTGTGAAATTGAATTATT TCATGATGTATACCCAATGTTTACTACTTTGACCCCTAAATTGCTTGAAA TTGAGTCAGTGTTCAAGCATTGTTCTTAAATTGTTCTTATTTTTGGCGAT TTTGAGCCTCGTTGTTCTTATAAAATTGTTCTTAAAAAAGGAAAAAAAAG TGTATTAGTAACATATCATATATTTCATATTCATTAACTTTCATCTCTCC CTTTAGATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAATAAAT CGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTTCCAT ACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGGATGA CCTCAAGGTATGTGCTTTTGTACTTTTAATCTTTTGCTGTTGTAGATCTT TTGCGGAAAACCTTGGACAGCCATCCTATAGAACAGGATGACTAAATCAA GGAACTTTAATAAAACAGATTAAATTGGAAAATAAGCTGAATTTTGCTCT TCTTTTGTCTAAAATGATTTATGATAATTTCAAAGTCTGTTCTCGTTAAC GGTGTATTTCTTTATGGCCTTCATACGAAAACTTTGTCAATGCCAGTAGA CTAACACCTTCGAAAGTGGTTAATATGTGGTATGAAGAGAAATACACAAT TTGTGAATAGACTTAGCTACTAGCTAATATTTTGCGATTCTTTTTCTCCT TGCACAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATAGGAC GTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTCCGCC AACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTCAAGT ACAAGATCTGACCACAGGACATAGTATGTCTCTTAGTTTTTTGGTTGTTT GTTTTTTCTGGTCATTTTGAATGCATTGCTCCCTTTTTTTATCCAGTAAT TCAGTTTTCAATTCCGTTAACCTTAGAAGATCATTTCCTCTACTTTACCA TTACTGAATTCAATAATTCCAAATTATTTTAGTTTTTTTATGTTATTTTG ATTCATGCCGTCCGTATGAACTAGAATTATCAGCCAAAACTTCTAAAAAT TCAGAAAATTGATTTATCAAAATATAAATGATTGTTTTCTCGAGCATTCA AAATTTCATTCATTGTTTTTTTTCTTCAAACTTTCAGGCAAACGATTTGA TGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAACTCG ATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGCCAC AAGGAAAACAAACCGGGATATAATGTCGACCCTGAGGTATTGTTGACATT GTTTTTTTTGACTCGTAACTCTTTTTTTTCTGATGATCTTATAAATTTTA ATTAACTCTGATAACTGGAGATATTGGTCGTGAGATCTTTCAAAGAACCA TGAATTTTCTTAGTGTTTTTAATTTAAAAAAGGAATAAGCACTGTATTAA ATGAATGAACCTGAGAAATATTATCTCGCTCAATTTACCTTGATTACCCT GATTACCCAGATCACAGCGATCCGCCAGTCTCTCGTATCTTATCGCATCA AGCCTTTCATAATCTCAACAATTTCTCTCATCACAGATCATGAAGAAATC ATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGAAAG ACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCCGTT GGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACGTCT TGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCGCAG AGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTACAA ACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATGAAAG TAAGAGAATTTTTCCCAAAGTGAGTGTCTAGGATAGGAAATCTTGGTCAA AATTTTAATGATACCCTCGGACACCCTATGGTTTTGATCATAATTCATGT TATGCACTATTGCAATGTCTTCTGGTATTATATCACGGACCCAATAGCTG ATTGGTTGTATACGTAAAATCAGTCAATACGTCACTTTCAACCAATCAGC TATTGGATCCACGGAAGACATTGCAATGGTGCATAGCATGAATTCATTCA GTTAAGCCGTCTGTAATATTTGTACATTATATTGTATCAATTAATCTGAG TTGCTCGTATTGTCTCTTCTTAGCAGATTCATTGGTAAAAATAGAAAAGC CCGGGAAACAATTAATCTTAAGTGATTTCCTAACAGTATCCACTTCCAGA AGCAATAACACCAGGCCTTCAGCGATTCGAAATAAATGGTGGTGGCTCGA TCTAATACGCTTCATTGGAACTCTGCGATCCTTTCTTGGTACTTCAAATT TGGTTACCCATGAGTCTACATGGGCTACCTTATCTTTGAAAAAAATGAAA CGATAGGTCGCTTTTGTCGTAGTGCGTTTTATTACCTAGTATTATATATG CTTATAATAAAAATCAACAAAAAGTCATCTAATTAGACCCATCATTATCA CTTAAGATTGTTTTCAACGGTAGGAGGTAGTTATAGTAATTATTTAAAAA AATTTTTTTCCCTTTTACAGTGTATTCTTCAACGAACGAGAACAGTATCG GTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGTCGAA CAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAATGGC GGCTGCCGTACAAAAACAAAACGTAAGTTGGTGCTGATTTATGGGATTGA AGAATTTTAAAACCCTTTTTCATTAGGTCTTGTATTGGTTCAGTGGATCC TCTCTGTGTCAAAGATTTTTATAAATTGAAGTTTGGAATTTCTCTTTGAA TCTACCTTTCAAAACAGTCCTTTCTATGGGCGAAAGTTTAAATTTGAAAA GGTATTTCAGCTGACAACGTTCTTCCCTTTTTCGTTCTCTGCATTTTAAA GACTATCATGTCTAGTGTTTTTACAAGTTCTTTATAAATCGAGTCTCGTC GGTTTGTCAAGCCCTGCTGTGATGAACCTACCGAGTTAAACTATCGGTCC TTGATGAAATAGAGAGAGATCACTGTACAAATATTTGACCAATCAAATTG GGTTTAAACTAGTCATAGCTTTCACTAAATGCCCACGCAGAAGATCATGT CAAGCACTTAAAGCTTTTAATGCTTTAAAGATTAAAGTAGTAAAAATAAT CAGGAATAATTGATTGATTTAATTATTGAATGATTGATTAATTAATTGAT TGAGGCATTGTTTGAAAAAAACATTATATTCCATTAACACAATAGACCTT TTTTTAAAGAGGCAGCCATGTTGAATAATTATGTACTCCAGCATAAAAAC AATGATACAGCCATGCATAATTTTTGAAANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATATATTTCAAAAATTA TAGTATCATTAGCTTACTGGTTTTCACATCTTGTTTGTTTTTTTTCTCCC AGTTTCTTTCTTACAACAATATATGTCATTATTATTATTATTCACAATAG ACCTTTTCTGATAATGCCGCAGACATCTTAGATTGTAGGCAAAATATATA GCGGTGACTGAATAAATAAAAAAGGCAACCAATCAGAAATAGCTTGTTTT TTTTTTCATTGGCTGCTATAGTTCAACATTTCTCTGTTGCTACTTTGCCT AATAAACAATAGTCAAGAATACTGCGTATAAAATTTATCAAAAAGTTCTG CGCCATCTTAAATTGGGTGAAATAGAAACCAATCCTAGTTAAGGCCCGGG CTCCACTTGCGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNGACTAAATTACAGTAGTTAGTATT CAGTTTCAAAGACAAGAAACTAAATTTGACATACCAAACACTTTTTCCAG TCAATGAATCAGCTCATCATTATAACCTTCCATTATAACCAGTCTGCCAT TTTGTTTGTTTTGATTCGCACAAGTAATATTGTAATTTGTGTTATATCAT ACACCTGTTATAATTTGCATTTATAACACTNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCT ATGAGTGCCTCCTCGTCGCTGCGCTCCTGCGGGGGCAAAAAATTTAGTCG GAAGAAAAAACTTTAGAAATTAGTTAAAGAAATTGAAAAAATTTGTGATT GTGGTGACTTTTTATTTGGTTTTGAACATAAAGAAATGGTACGTCAGCAG CCCTCCGAAACACTTCAAACATCAGGTAAAACTAACTAAGAATCAGAATA TGTCTTTTCCACGTCTCTATAGAGGACGTTACCAGTCAAAAATAAAACCT CGAGCTTATGAATCTTTCTTAATTCTATGCTTGCGTCGATTACAGCATCT CAAATTCTTCTGAAATTTGGTACGAAGATTTGTCAAGATTTTAGCTACTG TATTGAAAAAATGTTTTTAAAATATTTCCGGGACACCTACTAATGGTTGC TAGTCATTTTAGGAAAATAATGATAGCATGTACCAAACTTTTCTTAATGT CGTAAAGGAATGGTCAAAAAATCTAATTTTTTTTTAGATTCTACACGTTT TTTTTTTTATTAGAACCCAGTTTATAAGAACATTCAGGCTGAAATTCGTC GAAAAATTAAGAACGTCGCAAGAACATGCCCAGCCTCAGTTTGGAAAATA ATGACAAGAAACTACAATTTTTTTCTCTTTTCAAGCAGTTTCAACCGAAC TTAGAGATGGGTTTTCTAAAATCGAGAGTCAAATATTGTCCAAATTTTAC CAATTTTAAGTGCTCTTTATTTTGCATGATATTGTCGATTTAGAGTAGTC TGAGAAATTAAGAACGCATTTAAGAACATTTTAGGCTGAAAATTGCTTAA AAAAAGCACATCCAGGCTCAGCCAAATTTTAGGTGTTCTAATAAACAAAA AACGTGTACTCGATAGCCTCCCCATAAACCAAAAGTAACTGTGAATATTT AAAATATTATTACCAAACGAATCTTTAAAAATTAATTCTTGAAAAATATC ATTTTTGATGACGCAAGTTTTGATACTATTTTCATTCAGTTTTCAGTCGA TATAAAGATTTTTTGACAGGTTACACGCAGTGTCGGTTTTTCTTAACTCC CCTGTCACGTAGAAGGATCATTTTCTTTTTTGGGTATCAAATATTTAAGA AAAAGATTGAAGAATTTTGGAGAAAAAAATACTTTTGGGGTTTATCCATG CAGAGAGTTTTAACAAAAATATCCATATTTTGTGGGTATATGTTAGTTTT AAGGCGGTACCAAAAGCAAAAGGTGTTTTTTTTCTTTTAAGTTTTATTTG GATTTTTCTCACCCTTCTCCAAAAATCTTTGACGATTCTTGTATTCATTA CTTATTTGTTCAATCATTAAATATTGAAATCTTCATTTTATTTGTAAAAG AATTTTGATAAAATATCATTTTGAAAAAAGGTTTATATAGCTGTCTGTTG TATGCCGGAGAAGGTTGTTTTTTTATTTTGAAAAGCTAAGCTTTGGTTTA TGAGCGACCATAAAGCTTTATAATTGATCGATCGGTAAGAAATCGGAATC TGAGACTTGGGCCATTGGAACCTTATAAGGCTCTAAAAAGGATTCATGAC TTGAAATCGATGGAAAATTACCAATTTTATATTTTCTTCCAAAAAGTACA CCAAAAACTTGTTAGGGAAAAATTGTCTGAAACCTTTAGACTTTGACACT ATAAATTTCATTACTGAACTTTTTTCATACCATAGTCCATCCAATTGGAG ATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAACCAC GTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAG GAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTG GGTAAGGCATTCTTACACTTTTGATTCCGAATAGAACTCATTCATCCGTT CGTTCGGCTACGTCAAATGCACCCCTGTCTCACAGCCTCGGTAAAACTTT TTTCCTCACTGGGGATAAATTCCTTTTGAAATCCCAATGGGGATAGAAAT TCTATTGTAAAAATCCAGTGGATATGATTTTGGAGTACAATTTTCAAACA TTGAAATTTCGAATAGGGATAAAATCAAAGTCAATTTCCCAGTAGGCTAA AATTCAAGGGTATCTTCCCACTGGGGACGAAATTTTGCAAAATTTTCCAG TGGAATTTTCTTGGGTCCCAGCGGGGACAAATCTTCCTTTGTTTCAAGCG TGACTCTTACTCTAGTAAGGCCTAAAAGTCTTAAGCTGTCNCGGAGAAGG TTGTTTTTTTATTTTGAAAAGCTAAGCTTTGGTTTATGAGCGACCATAAA GCTTTATAATTGATCGATCGGTAAGAAATCGGAATCTGAGACTTGGGCCA TTGGAACCTTATAAGGCTCTAAAAAGGATTCATGACTTGAAATCGATGGA AAATTACCAATTTTATATTTTCTTCCAAAAAGTACACCAAAAACTTGTTA GGGAAAAATTGTCTGAAACCTTTAGACTTTGACACTATAAATTTCATTAC TGAACTTTTTTCATACCATAGTCCATCCAATTGGAGATGTCAAACCGACG TAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAAGACG ACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGGCAAA GTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGGTAAGGCATTCTT ACACTTTTGATTCCGAATAGAACTCATTCATCCGTTCGTTCGGCTACGTC AAATGCACCCCTGTCTCACAGCCTCGGTAAAACTTTTTTCCTCACTGGGG ATAAATTCCTTTTGAAATCCCAATGGGGATAGAAATTCTATTGTAAAAAT CCAGTGGATATGATTTTGGAGTACAATTTTCAAACATTGAAATTTCGAAT AGGGATAAAATCAAAGTCAATTTCCCAGTAGGCTAAAATTCAAGGGTATC TTCCCACTGGGGACGAAATTTTGCAAAATTTTCCAGTGGAATTTTCTTGG GTCCCAGCGGGGACAAATCTTCCTTTGTTTCAAGCGTGACTCTTACTCTA GTAAGGCCTAAAAGTCTTAAGCTGTCTATTGAGTAGACTACTGAAGGCTT TCTTATTCATTTGTTTGGCTAATCTCAAACGCATTATGCTTTAAAAAGTC AAAAGCAAACTGATTTCAACAGCGCTTAAGAGAATTTCCTCATGGAATTT GTTAATCCGAAAATAGATTTCTGAATTTTTTGCTCCAGGATTAATCAAAC GAGGCTTCTGTAGACTCCTATGTCGTCTTGTTTGCATTTCTATTTCCGCT TTGACACCACAGGCTTGTATGTTTAGGATTAAGGCTTTCAACGAACGAAT AGCTGAAGTATAAAGTTTGATATTCTGTCTATCCATTGATGAGTTGAAAT TGTGATCTCAGTGATAATACACAAAGATTTTTGTTGCTGTTTTTCATGAC TTGCATCATGTACTAATTTCATGCTAAATCAAAACCAATGAGTTGTTTGT AGTTATACCTGATTGATTGCCCTTTTAATCGTTTGGGTAATTTTTGATGA ATTGATTGAAGCTAAACTAACTAATTTTTTTTTTTTTTTTTTGCTGATTT CTCTTAATTTCTTTTTTTTCTCTCTCTCCATACCTCTAGTTGATTGGCGT CGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAGCCGA TATTCAATTGAACGAAAACCAACAGATTGGTACTACCGTCACCGAACTAG AAGCACAACTTGAAAAACACAAGGTGAGTAATTTTGTACTGCACCCTGTT TTTGTTCGGTTTTTGTGTTTTTATAGCGAGTTTATGTATTTGCACTTTCG AGGACGGTGGCAAAGCGACTGAAGCGATTTAGAATAACCTAACCCGGTTC TGACCCATAAAATCGAGGACGGTAAAAGTGCTGATTTACCATCGTCCTCA GTTCAGTTGATCAGGATCTAAACAAATCAGAAGCTAACCGTCTCTATTGC AGAAAAATATACAAACATAAACTCGCTTACATCATCAGGCTGTAAATTAA TTCTGGATAAAGATAAGACTTTTTTTTCTGTGGAGAATCAGTGCACTCTT ACCTTCTTGGTAAGCTTAATATAAAACATTCCAAAAATAGTTATCGAATT ATGACCTAATGCACTCGTGTCATTTATACTGAAAGAAAAAAAACCACAAA GTCTTAATATTAAAGAGATCTGGGTCTGAACTACACTTCTCTATCTTTCC AAGCACACTCTTCGGTAAAATCAAGTTTGGAAGAGAGGTTACTACCAAGC AGTGTTGAAATCTTCTCTATCTTTCCAAGCATACTCTTCGGTAAAATCAA GTTTGGAAGAGAGGTTACTACCAAGCAGTGTTGAAATCTACTCTATCTTT CCAAGCATACTCTTCGGTAAAATCAAGTTTCGAAGAGAGGTTACTACCAA GCAGTGTTGAAATCTAAACTTGATATCTTTCTATCTGATTCACTCAGAAT TTGTTTTCCTCAGGACGAATTAAGAATTTAAGAGTTGTTGATGTCTTTAG ACAAAGTAATGCTATGATGGTAACCTTTGGTGGATTTGTTAATTATTGCA TTTCTTGCGTATTTCCTGCTTATTGAGACTTAAAATATAAAAACTTGCTT TTAGTATTTTGGCAGTCGAAGCCTTACATGTTCGTGTATACACTTTTTTT AACAGAACCATTAACATTTTGCTGCAGCTTGGCTGTTCTTATTTTTTTGT CACTTTGAGCCTCAAATTTTTCTTATCCTGCTCTTATTTTTTGGAGATGT TGAGCCGTATTGTTCTTATGAAAAATAAAGTGTACTATATATCTCAATGT GGGGGTCCTATTTTGGAAGTCCTTCAAATGTGTTGAGTCATTTTCTGAGC AAAGATACCAGCTATTCCTTTGATTTGGACTATGTATCACCTCTTTCGCA GATGCTTTAACTATTATCAAATGTCATACCAGCAGACAAGATTTTGTTCG GAAACTCGAACTCCCTTATCATAATCTTGAGCTCAGCTATATCAGTTTCA TTGTTCCAATTTTTCGTCTCCCCTATTATTAGTATAAAGTNCTGATTTCA ACAGCGCTTAAGAGAATTTCCTCATGGAATTTGTTAATCCGAAAATAGAT TTCTGATTTTTTTGCTCCAGGATTAATCAAACGAGGCTTCTGTAGACTCC TATGTCGTCTTGTTTGCATTTCTATTTCCGCTCTGACACCACAGGCTTGT ATGTTTAGGATTAAGGCTTTCAACGAACGAATAGCTGAAGTATAAAGTTT GATATTCTATCCATTGATGAGTTGAAATTGTGATCTCAGTGATAATACAC AAAGATTTTTGTTGCTGTTTTTCATGACTTGCACCATTTACTAATTTCAT GCTAAATCAAAACCAATTGAGTTGTTTGTAGTTATACCTGATTGATTGCC CTTTGAATCGTTGGAGTAAATTGTGATGAATCGATTGAAGCTAAACTAAC TAATTTTTTTTTGCTGATTTCTCTTAATTTATTTTTTCTTTCTCTCCATA CCTCTAGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTGATAA TTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATTGGCA CTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGGTGAATAAT TTTGTACTGCACCCTGTTTTTGTTCGGTTTTGTGTTTTTATAGCGAGTTT ATGTATTTGCACTTTTGAGGACGGCAGCGAAGCGACTGAAGCGATTTGGA TAACCTAACCCGGTTCTGACCCGTAAAATCGAAGACGGTAAAAGCTGCTT GTTTACCACCGTCCTCAGTTGATCAGGATCTAAACAAATCAGAAGCTAAC CGTCTCTGTTGCAGAAAAATACACAAACATAAACTCGCTTATATCATCAA GCTACCAAACTTATTCTTGATAAAGATAAGACTTTTTTTCTGTGGAGAAT CAGTGTACTCTTACCTTCTTGGTAAGCTTAATATAAAACATTCCAAAAAT AGTTATGGAATTATGACCTAATGCACTCGTGTCATTTATACTGAAAGAAA AAAACCACAAAGTCTTAATATTAAAGAGATCTGGGTCTGAACTATACTTC TCTATCTTTCCAAGCATACTCTTCGGTAAAATCAAGTTTGGAAGAGAGGT GTTACTACCAAGCAGTGTTGAAATCTAAACTTGATATCTTTCTATCTGGT TCACTCAGAATTTGTTTTGCTCAGAGCAAATCTAGAGTTTAAGAGTTGTT TTTTGATGTCTTTAGACAAAGAAATGTTACGATGGTAACCTTTGGTGAAT TTGTTAATTATTGGGTTTCTTGCGTACTTCCTGCTTGAGACTGAGCTTGA GTGGCTGAAGGAGGAAGTGTTTCTATCATTAAGAGCTGATATTTACACCC TTTAAAGCATGGCGTTCTAAATCTTAGAACGCTATGCTTTAAAGGCATGC CATTTTACCGATAGGCTTGCATCAGTGTAGTGGTTTGTTGTGTCTAGTAC TACTGATTTTTATGTAATCATGTTGGTTTTTCTGAGAATAGAATGAATAT TATATACTCTATTTCCTATAAGAACATCCAAAAATTTTAAAACCTTTGGA TTTTCTTAACCGTTTGAGATTTAAGCATGAAAATGTATTTATATATTTAT TTTTTTATCATAATGTATAAAGTGTTATAGGTGTAATTGTGGTGTTTTAA GTGTCCATTAAGCCTGAAAACATTCTTAACTTGCTTTTAAAGTCTGTCCA GATATAATTGGCAGTGGAAACAAGAATGCCTGTAACTTTTGATAGTCAAA TATAATTATGGAAGTTTTTTTTGCTTGTTTTAGAGAATCAAAAGCGCTTT ATTTGAATGTATTTTTGGTTGAAAAATTCGCGATTTTTAGTGGTTAAATT TGCGATTGCAAAAATTGAGCTTTTTTTCTACTTATGCTATAATGTTCATT TTTACACCAGTGGTAGTCCAACCTTAGGTTAAGAAGTTTGACAAATTTCA AGGCAAACAGAAAAGTCCTTCGGAAGATATGGGACCCGAAATACCCCTTG GTAGCGCTTTTCTGTGAAATATCAAATCTCCAACTTATTACTAAAAACGG GGGTAGTGATATGATTGATAAAACAGTTTTTCGATCCTAACACATTTTAC GATCTTTTTAATGACCTCATAGCCAAACTGTGTTTAGTGTTTTGGGAATT AGCAAAGTTCTTTAATGACTTAAAAATAACAAAGGCAATATAAGTTCATG CTTATCTTTTCAATAAAAACAATTATACTGTGATTTCACNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNGCTGCGTTTAGACCAGCCTGGCATTTGTAATTA CTTGCAGTATTCTTTTGAATTCTATTGTTCCGTGCAATTGTTCGGTTTGT CAAATGCCTAATGATGCCAGCTTGTTGGTATTTCGTTGGCCTTTGAAATG CCATTTTGAGCAAAGGAATCCCCTTTTCTGGCATTTCAAATCAAACAAAG GAACCAAAACAAAGAGAAAAAATGACATTTTTGATTTTTTANNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAAA TTCCATGCTTTTCATTGTTTGATCTGTCAAAGTTGAACTTGAGGGAATCA CCTTTTCAGTAATGACTCTAAAAAGACGATTCCTTAAATGCCATGACAGA AAATACAATGGAAAAGCTATTAAAATTGAATCCCTCATGAGCAAATGCCA AATTACAAATGCCAGTTGGTCTAAACGCAGCCAATGCAACACTTAACATT TTCCAACTTTTAATTGCATTGTTCAAAAAAGATAACATATAACCCCCGTT TTTAGTAATAAGTTGGAGATTTGATATTTCACAGAAAAGTGCTACCAAGG GGTATTTCGGGTCCCATATCTTCCGAAGGACTTTTCTGTTTGCCTTGATA TTTAACAAACTTCTTAACCTAAGGTTGAACTACCACTGGTGTAAAAATGA ACATTATAGCATAAGTAGAAAAAAATCTCAATTTTTGCAATCGCAAATTT AACCACTAAAAATCACGAATTTTTCAACCAAAAATACATTCAAATATAGC GCTTTTGATTCTCTAAAACAAGCAAAAAAACTTCCATGATTATATTTGAC TATCAAAAGTTACAGGCATTCTTGTTTCCACTGCCAATTATATCTGGACA GACTTTAGTATTTTGGTAGTCGAAACCTCACATGTTCGTGTATACTATAT CTCGATGTGGGAGTCCTATTTTGGAAGCCCTTCAAATGTGTAACTTTAAC AAGTCATTTTCTGAGCAATGATACCAAATATTCCTTTGATTTGGACTATG TATCACTTCTTTCGCAGATGATTTAACTATTATCAAATGTCATACCAGCA GACAAGATTTTGTTCGGAAACTCGAACTCTCTTATCATAATCTTGAGCTC AGTGATATCAGTTTCATTGTTCCAGTTTTTCGTCTCCCCCTATTATTAGT ATAAAGTGTAGTATCATAGTCGGTATAATTTTCTGATACCGTTTTAGAGT CACTATTACATTGTGGTTTAACAAGAAAAAAAGTTACGTTTGAGGGAGCT TATTTCATTAAAAATACCTGTGATTTAGTTATGATTTGAGTACATTTATG GCTGAAAACATTTCTTGCTATTGGGCTTAGTACTAATCTGGCTTTTTGAT GCCATTTTTGCAAGTTTGTTTAGGTTTCTTTCCTGTGTTAAGTACTAATA GCTGTCTCTGCTTTGTCACATCAAGTCAAATGTTATTTTATCTGCAAGTT GCGAATATCTTTCGTTTTGTCAAAATTTGATTTTGCATTCAATTTTTGAT CTCCTGTGCCAAGGTTGCTGTTATCTTATTCGACTCGCTACTATTTCTAT CGTTCATAACTCAAATAGTTTCTAGGTTCATAAAGAATTCTAGTACAGTT GACGCTCTCTAATTCGATTTTCAAAGGGAATCGAGCTTCAATCGAATATC CCTATACGTATCGAATAGTAGAGCGTCGTTTACGAGTGTTTCTTGTTGAC GTTAACTTTCAATATTATCGAATAATGGAGCGTATCAAAAAGTAGAACTT CGAATAAAAGAACATCAACTATATCTGCAAACCTTCACTGCTTCTAAATA TAACAGGAACAAAATCATCTAGCTTTTCTCTCTCGGTTTACCCAAAACAT TATAAATTGTCAAGGGGAATGATTTTGAAAATTCGCTTTTAAGAAGCAAT GGCTTCAGCTCTAAACCCTGTGTTATGCCATAAAGTTAGCATTGCTTCAC AGATCAAAATGCTTCTGTTTTGATGTTTAATGTTAGTCGAGACATCTTAC TTATACCTAATAAAACATGAACTATGATTTTTAATACATTACTTTCCTTA TGCTAATTTAAAATTGAGTGATATACAGCTTAAAGTCATCTCACAAAATA GGTTTTTAATACGCGGATCAAATAAGCCTTTATAATGTGCATTGATTTCG AAGGGCTTATCTTAATTCGATTTTTGAGATATGTCCTTCTTTTGTGTGAA TGCTCTCTGATTTCAGTTAGTACGCATTTTAAAAATCTCAATTTGCTATT TAGAAAAACCCTTGATAAAAAGGTTGTCTGGTCAAATAATTGATAAAGAC ACGATTAAGTCGTTCTGTTGAAAAGCTTACGAGGAGCTCAGTTTAGTTTT AGTGGATTTCAAAGATCTCCTTCTCTCATAGATCACTTGGTCAAGTATTG ATCAAGAGCTTGTCTTGTTCGCCGAAAGGTTCTTTTTTGTTGTGAAATAC TGTCCATCGCAGATAGTTGTGCAAGAGTGCAACAGAAAAAAAGTATTAGC AGACACTCAGACAGACAGACAGACAGACAGACAGATAGACACAGACAGAC AGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAG ACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGAC AGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAG ACACACAAAATGTTCTGTTATGGTCTGCGAAAAGAGTGTTGTGGAAACTT GTATTCATATAACTTTATTTCTTTTCCTTTTCAGAAATTCCAAGGCGAAT TATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGAAACC ATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGACTGT CAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGGTATGCATCTT TTATCCTTGTTTATTCTATCTTTTTTGAACAAATATTTCCTTTAATATGG AGAAGGTATACCCCTTTTATGAGGCTAAGATAAAATGTTTGGAGTTTGAG AACCCAGTGGCTTCAATTGTTGAAAGATCATTCTGGATTGAGGTTTTCAC TAAATGATTTGTGTGACACTGAATTTCGTCTCCCTTGCCCGGTACCGTTA GTTGGTCTAATGTCGACATCCCTCTTCTAATTCCGACACCCAGTTTTCGA GATAGGAATAATAGTAAGGTCTGAGTCACTGATAGATAAAAGATATTTTC CTCTCTGGTTGCTAAGCAAAGAAATATAGCTTCTATCAGCGATTCCAACC TTCCTACTATTCTTACCTCTAAAAAAGGGTGTCAGGATTAGAAGAGAGAT GTCGACATTAGACCAAGTTACATTACCCATCCTGGTCTTCCATTCGCTAA ATAGAAAAGCCTCTCATTAATCTTCCGGATTTATGTACCTCTACGTGTAT AAAAATTCCAGTTATCAAGTGGAGAAAAAATAAAAATGTCGGAATCTCTG ACATGAATCTTTGCAATCTTGTTAGATACGAATATTTAATTGACCTTCTG TCATTTTTAATCCGTGTAGATAAACCATTGTCTAGTTGTCTGATCGGTTC TTGGACTTAATGTTTTTTATTATAATTTTGATTTTTAAAACAACATTTTT GGTCTTTCTTACCCGTTTCAACTTTTCTCCTTGCCGATGTATGAACTTGA ATTGATACTTTTGAAAAAAGCTTGTGATAATTCTATTGCAAAATTGCGTG TGCAGCCACTTGAATTCTCAAAATAGTGAGTGAGTGTTCAAAGTTTTTTC AAATCTCTTTCTATCACACCGAAAAAGCACTAGAAACCTGCATTTTGTTG ATTCAACATATTCCGTGACTTCTCAAGAGTTCTTAACAAAGAAGATTAGC CTGTACCTAACCAGAGATGGTCACGACTTAAATAAGATTCATCAAACAAC GATACAGGCTTGAGAACTTTTTCAAAACTTGATTCGCCTTTTGCTGACGG GTTTACTGATTGACACAAAGTCTTTTAAACATTCATAAAACGTCCATACG AGCCGTAAGGGATTTAAAACTTCACACAGAGGCTGTTAACAGACTACATG TTTTCTCGGCAGGCAGTTGTTTTCTTTGATGACAGGTACATCATCACTGG TTAATTGAAACACGATTTCTCAACTTTTCGATTGATTGTTTAAGAGACTT GGTGCGAAAAGCACGTGGTTCATTTATTCGTCCGCCTCGTCTAAATTTAA AGTCTTTTCACGATATGTAAAAAACGTGAATTTCAGTTACGGTTTGGCTT TCAGTTACAGTTTGGCTTTTAAACTTGCTGAGTTTTTTCGGAGATACTTG GAAAAATGAGTAAACATATTATTTATGAGTTGGCTCTCCACAAAGATTTT GACCCTTCCAAAATATAACTATTATACTGGTTTGTGAAGGCTATAAAACT AAGTCTTAAAAGCTCTCGATATATTGTATATGTTTTGTGTAGAGAATATA TTTTGTTGGACTACTGTAATTCGACGTGGGCAGAAGATTGACTGTATCGT GAGAACGTGAACCAGTTTACCGTGAGAACTTTGTGAATTGAATCACCGCA AACGTTGCCAACTTCTCTGATGAAAGTTTACTTTATAATTTTGTAGAGTT TGCAGAATTCCTTTTGGAGTGAGGACAAAAATGACTTCGTGGTTTTGTTG TGTTTTTTTCCTTTTCTTACAAATGATACAGACCTCTCGAGTCTTTTGGC ATCTGATGGTATCTGAAAGAGTTATTTTTGCGTAATATCGGTTGACTTTT CCCTCCCCCTCTGCTTCCTTCTAGAGGTATTTATATATCTACTTGATAGA CATTGGAAAATTGGTTTGAATCAAGTTTGAAGTTGAAATTGAAGTCGTGT ACTGTAATATTGTTTCAGATTAGTTTTTAAAACATTATGTAGTTTTTAGT TTGTTTTACTAGAGTTTGGTTTGTGCTCAGGTCTCAAAGTCTTTAAAATA TTTTCTCATGGTTTTTCTAAGATCCATGAGACTTACAAAACCTGTATGAA AACCACAAAACTAAATACCAATGGTTTTTCTCCTACTTGTGTTTCATATA CCATATAAAGGATCTTTGTCTTTTCTTTTTGAAAGCCAAACATTCTAACT TGTTAAAGTTTAGAAAAACCATTAAATACTTTAAGCTTTGGTATATACAG TTTCTCTCAGCCATACAAAAATGGTAGTACTTGGCTGCTTTCTGGACTTT TAGTTAACTTAATCTCAATTGGTCACCTAATTTTTCCTTTATCCTGGAAA AATTAGGTGCCAATTGAGATTAAGTTAACTAGAATTACCAGTTAGTTGAT CAATAAGAGAAACCGAAAATCAGTTTATGAATTTTTCTTGGGAGTGCGGT ACTTGCTTTTACAGAACGGGACATCGGAAAATTCCACCATGCTTCCCTGT TATGATAGTTTTACTTAACTTGGTTACTTTCCGCTTGGTGCTGTAAAAAT CTTGACGGGAAGAATGACGTTATGGAAATGACGTTTATTGTAGAAGTGGT ACCCTCGAGAAATATTTTTTTCGTTGAATTTAGCATTGTTTACTTTTCAC TCTAATAATTGATTAGATTGACATTTTGATGTTATGTTTATGTTTTGTTT GTAGTAGTAATGTATTTATGTTTCAAAAGGTTGCATTGTTATATGAAATC TCGGCAAGCACCGTTCTTAGTGACTCGATTGCTTGTTAAACTGGGTCCAG TTGTCTCTACTGATTATACTTTAACAAGAATAGTTAAGTTTGTGGAAGAA ATACTTTTTTCAGGCAAATAAATTGCTTTTCTTATGATTCTCAGTATCTT AAACTACATCTGTTCACTTTAAGAAAATTGTGGTTAATTTACTATCCAGT CAATTTTTGTCGGTCAGCCGGGCTTTGTAACGATATGAATCTTGATGACA TTATAAGCTTTAAACGTATTAACCTTTTTATGATCGTCGTCTGGAAAGTG ATTTCATTTTAGTTTGTATGAATTTTTGCATTTTGTCATTTCTGATGATG CTTTTTATCATGATGCCCTTCAAAAAGCTTTTATAATACAGCTCTCTGTG TAATTTAACTTTGCAGTTATTAGCATATTTAGAAATTTTCTTCATCGAGT TTTCTCTTCCAGTTAGAATTCAGTCAGTTGACCAAGAAACACAAAACGTA GAAAAAGCTCGAATGTCTTTAAAGGTTCTCCCGGTGATTGTGTAACTGAA CCATTTTCAATTTCTGGTATTTGAGATGTTCAATAGCTAAAGGTAGATAG TGATAGAGAATGTTGTAGTAAGCACTGGGAAAGTGAAAGTATAGGGAAAT TGTTATGTCGTAGTTTGTTTTCAACTCAAAAAATTATTGTTGGTGGTTTT TACACTTTATACCTGGTGGTTGTTGGACATAAGTTTTTGCAAAGAGAAAG ATATCAAATTTTACTGTAAAATAACCATTTCTCAACAATTATTCCATTCT ATTTCAAATGGTTTTAATATTAGTATTGCGGTCATGGGGTCTTATAGATA TAAAGTGTAGTTTTAGTACAAAAAGCTTATTTTGTCTTGGTGAAGGGCTT AATATGCAAGGTGCCCCAGTTTTGCTTGGATATAAATAATGAGTGATTCT GATAGATGCTTTAGAATATCTTTTAATGATTTTAGTTTTAGACTGGAAAG TGCGAGGTTGAGGTAACACCATTTTAAAAGAAATGTTTACTAGTCATATG CAAAAAAATGTTTCAACCTTTGGTAAACATTTTTATATTTGAAAGTTCAG AAGATATTTTAAAATAATATTAAAAAAAGAAATATATAGAATTAAGATAA AGTTTGCGGAGAATCTAAACAATGGGTGAGATGTTATTGGATTATTCAAT GGACCAATCACAGAGCGGTGATACCTCAATGCATGACGGGAAGACTCCGT CTCCGTTAATGCCCGGTACACACTTTGTCATGTTTCTATTCGATAAGTAA GTATCTTCGCCATTTTCTTTCAAGCATTGACAGGATTTTTCTCATTATTT TTGGACAAAAATTTCGATTTCATTTTTCAGTATTCTCGAAATCGTTCGTT CTTTCCTTCGTTCGTTTCTAAATCAAAAAGCGAATCGATTTTTTATGGAA ACCTTAGACATTCCTGTGTCTAATTATTTTGTAACATTTCAACCAGCAGC TATGGTTGATACTCTAAAAGAAAACTTTGTGGTTTGATTTGATTTATAAT TCAATTGAATAATTTGTCACTTTAAGATTCCCTCACACCACACTGTCTTA TTTATTTTTTAATTTTATAATTTATTAGTACTATTTTGACTGATTGCTTT TCCCCTAGAATATTTCAACCAGCCCTCATGTCATACATCGGGAAAGTTAC CCACATTCTTTAAAATCCTAATATTTTTTTAAATTAGACTACTGACCTTT AAAAAAGGACAAAGCTATATCCGTCATTTCTGATCGGAGTTTTTTTTGTA TTAAACGGTGCTAGATCATCAAAAGTATCCAAGGGGGGGGGGGTACATCT AGCGCACTCGATGCATTTACACCGTTAGTGAAAATTGCACCTAAAAAAAC TACAATCAAAGATTTTGGTTGGCCGGTATTGAGAAAGATCAGTGAATTAG AACCTTAATTTCTTCAATGAGGAACTAGAGTGGTAAAAGCGGTGTTGTTT TTTCGCAAACGGGTATCCTGCACAGGAACACATCTTAACCTGTTCCTTAA GGTTTACAACAAAAAGAGATTAATCATAGTAAATAACATCCTTATTACAT ATCCTTCAGCGTTTAAAACCATAGATTCCCTTTTTCTGGTTGTCAGTCCT CATCCTTGATGCACTTCCCGAAAAAAATTGAGACTCTTCTCTTATTCGAC TTATGTTTCTTGTAAGCATGCAGATTTCTCACTAACTGAAGTTAAGGTGA ATATGTTTGATATAGATGTACGGCCAATCTTAGCTCTGATTGGTAAAAGA GTGACTTTCAGTATACGATTTTTAAGATTCAGGATATGGCTTTTCTTGTT AATATGGCATGTTTCTTATAAAAGAGATGACAAGTATTCCTGTCTTGAAG TCCATTGTTATTTTAAGTAAACTCTCTGAATAGATCATCGGAAAAGTGTC TCGGTTATTTTTTTACCGTTTCATTACAAACTTAAACATAGATGAGGTAT CTTTATCGGGAAATTATTAACAATAGAACGTCAAAATTTGTTTTTCGCGT ATTCTTTCTTATAAGAACATACTCACAAGAACTAAGTTTAAGACTACCGA GTGTTGAGTGCCATACTTTTTCGAGTGGCGTTTTTTAAGAACTAAATTTA GTAGTATTACAATTCACGCTGCATGCCTTTAACATTGCACTAACACTAAC TGTGTCCCGTGAGCCCGTTTATGGATTGAATTCTCTGTCCGCAGGAAATG TCAATGTTCTTCAAATGTTCTTATAAAGTTCTTAAATTGTCAAGACTCGA CGTTGTTGCTTTTCCATAATGAAAACAAACTTATGAATACCCCGGTCGTC GTCAACTTGTTACACCTTCATGTTGTTGTTGTGTCGTTTTAATAAAAAGA AGGGTCATTTATTTTCGTTTGTTGAGACTTGACTCTAAGAGTAGTCTCTC CTTAAAAGTGAAATCAAACCGTTATTTAAAAGGGCATTTTAAGCAAGGCA TTTTTTGATAGTTCGATTTTAATGTTGGTTTTGATTTTATTGATTGTATG AGTCTTAGTTTTCACTAATTCGTTTCTCTTCGTGATATCACCATTGCTGA CCTTTTTGTTATGAACTGATTGCGTAATTATTATTATAACACACATACAA AATGAAGGATTATGACGTTTTTCGAAGAATTTAATGTGGTAACACAGTGG CATCGATAATATGAGATGAACATACTCATCCGAAATCTAGAAAACTCTTT AAAATTTTATAAACCGTTTTCAATCAAGTTTGTTTTGAAAAGTAACTTTT TGTTCTCCTTTTGCAAAATATGCGTGTCTGCTGCCTTGCTGAGGCTTCTT GCTGTGAAGAAAAGAAAAACTTCAACCTTTTTTGCCACAACGACAGTGAA TAGAAATAATCTTAAGATTTTTACTGACATCTTTTGTCTTTTACGAGGTG TCATACTTGTTAAATTGCCTTACGATACTCTTTCTCATATTTGCAAGAAT TATCGTTTAAGCCAAGTTTTTTAAAGTTTAAAATTTCAATGAAATAGTGG TAAAAATCGCCGTAAATTCAATATATTCATCTGTCGTAAATATGCAACTA CTTGTCGATACCTTCGTACAGAAAGTCGTAAATCGAGTGACCAAAACTCG ATATGGATTCAAATTCTCGTAAGTATTGAAAATCTTCGTTTGAAATCTGT TCATCATTGATCTAAACAAATTTTGCTGACAATCACTGTTTGATTTTGTC TCTGACTTAAGGGCTCTGACCATAGTCCAAAAATTGATTTTGGTATTTGA ACATAAAAGTTATATTTCAGGTTCCTTAACACTTTTAACAAAGAATTGCC TTTATAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNCAAAAGTCTTCATTTTCTTCTTCATCAAACTTTTTCAATGCAA ATTTTGAATTTTCAGATTCAGGAATAGTTTGTCTAACAGAAAATGTGTAA CATGCCATAGTTTTGTTGGTTACATCAGTCAGAAAACACATTTTAAACAC GGCAATTATGAAAAATTCACTATGGTCAGAGCCCTTAATGTACTCGCGTA TATCTTCTGTCTGCTCTTTCTATCTATATTATGTTTGTGTCCTTTTCATT GATTTTGTATTGGTATTATTGATTATGGACTTTTACCATTGACTTCCAAA CCCGAAGAGCTAGACTTGAGACTCCTGGATAGGAAATGAAGCCACTTATT TCCCATCCAGAACGCCCGTGCGTGGTTTTTACTCAAACGCCGGATCGAAA GTAAAATATATCACTAGATTTCAAAAAATGCAGTCCTCAAAAACAAAGGA ACCGCTAGTTACAATCCTCCGTCATGATAGCGGCGCGTTCTAGACGCGTT CTGGATGGGAAATAAGTGGCTTCACTTTTTCTTGCCACTCTAGCCCTTCG GGCTTCAAACTCAATGACTTTTACAATGCTGTTTTTTCGAAGTTTTTGTC ATGCTAATGAAAATTAGTGAATCTTACTCTTTTCGACGTGAGTCAACGCA AAAAGAATCTAAATGTAGTGTGTCTTGAATGATATGAATCTCGAATAAGG GAAAGTCTAATTGTTATGTTATTTTGCTTGATCGCAGTTTTTTAAGATAA CATATTTTTCGTGTTCTTAAAACAGTCGACATAAATATCCTAAAAAAATC GTCAGTTTTCTTATTTCCTTGTTCTAGTTTTTGTAATGATGTGGTTGTGG TGGTTAGAAATGTCAAATTTTTTTTTTATATAGATACGCCTTTTAGGAAA ACTTAGTTTTCGGGTAATTTCAAGGGGATGAAATTTGGTGATCAATCAAA TGTTAAATCTCTTTTAGGGTTTTTAGGATCCTTAGACTTTCAGTATTGTT ATTTAAATAACGCTATTAATACACTGCTAATTTTTTTAACGTATTTTTTG AAGTTATTTTTAGCGAACGGAATGGTTCAATTGCCTGCGAACTAAATCGT TTTGAATTTTATTTTGCTGGTGCTTTTGATTGATTTGATGAAATGTTAAA TGAAGTATTTTTGCTTGTTGTTCTTAGTTGGTTTGTTACGAATGACAGTT TCAACAATACGAACGTTCACACTTCATAATTTGATTGTCATATTTTCGGC ATCGGTGTTGATGAAGCGTGACAGCCCTTGATAAATCAAAATGAAACGTC TTTTTAACCTAAATCTTGCTCAATCTTTTTATTAGTCGGTCTATAACCAA CTAATGTCTAGCTGTTATTTATAGAATCTGTCTTTTAGGCCAAGTAGCTC ATGAGGAGCGACTTATATTCTATATTATTCGTACTACAATCTACCTCAGG GTAAGAATATTAGAAAGTGCGTTTTTCTCAGATTTTTTTGACGTTTCAAA TACATCTTGCGCGCTTTTTGATGAAAGTAACTAATACCCTTATCTTTAAA ATTCGACGAAAATAAATCATATGGTATGTTACCAAATTGGACCGATCAAA AAGAAAATACCTAATAAATCATATTACTTTTCAATCATCCCATGAAAAGC AGAATTGGTATATAATTGGTCAATTTTATGTAGAAGGAAACTAAAACATG CATTGCACGTTGAACTTTGAGACAGATTGATTTACATTACAGACATTTTG TACGTTCTCTCGCTTATTGGTGGAGATTAAACGGATAGACTTTTTGATGT TAGTTTATTGACTGCAATATTCTATACTTGTCGGGCTTTTAAATGTTGTT TTTACGTCACAGTCTATTTTTATTGTAAATCTGGCTGACTCAAAGTTTTG ATCATTTATTTTTAAGATATTTTTTTTGCTTTGGATCCTCTCTCTTCGCG CACTATCCGGGTTTTGGTAGTTGAAGTCTAGAAAGCATTTTATGGTGCTT AGAAGGCGCAAAAAGTGAAACATTTTCTTCGTGGCTAAATCGTGTGAACG ACAATTTTTTCCATCCCTTCAAACGGCTAACCGGGACCCATGATTTTGAG TAAGATCTTTATACAACTCTATATTTCGGAGAAACTTTAGCATATCGGTA AACGTTTAGGAATCAAAAACTTGTGTGTATTCAATAAATACCATCGTGAC TGACTGACTGACTGGCTCTACACGGGTAAAAATCACTACCCGCGTCATAA AATGTGATTCTCAATGTATGACCTTTAGCCCGCCTCTAGCTCGATCAAAA TAAAGATCTGCTGAACTCATTTTATAAAGTGATAAATACAATTTTAAAAA GGAAAAAAAATATTGAGCTTTTTCGTATCTTGTTAACGTACAAGCCACGT TTTTAATAGAAAATTTTCGTGCGCATGTGTCGAAATTTCACTCACGACTT ATGTCCATTCGTTTTTTGACTGATAGTGGCGAATTTGAAGTTACCTTGTT GAGTTAGTCAAAAACCTGGAAAAACCGTGCTCTAAATAAGGTTTAGAATT CTAATATTGTGAAATCTCTTAGTGTTTGTATGATGGAGGATTTTGGGTAA GGTTTTTCTATTGTATTCACGTCTTTTTTGTCCACATTTTTATTGGTATG TTTTCGTTCATAAAGAGCACTTGATAATATTTTTGACGGTTAAGAAGGGG TTGTCTTTCTTTGGTTTGTTTTGGTCTAAAGTTATCTGTCATGAAACTAT CTAGCTCTTGAATTTGTTCACGCCAAGGGTTTAGACTGAATTTTAACCGA AAAAAGTCTTTCGGAAGGTGGTTACGCTGTGTACTGTTCAGATGACTAGC TTTCGTTTTGATCAAAAAGTTGCGAATTGCTCGGGGGGAGGGGGTTCTTT TTGTGTCTGTCATCCATGTTATTTTTGTTTTGTTTAACAAAAAAGAATGA GTCAACGTTTGCGCTTTAAGAAATGACCTATTTTTGAAGTCATTTATCAT CGATATTCTTATGTATAACAATGTCTTTTTGTGCTTTAAATGACCGAGTC GAATGTTTCGAGAATTTTGGATTTGAGTTCATTTATAGTAGTTACTTTTT GTAAAAGGGGTTAAGCGGGTTTTACTTAGGTAGATAAGTTCTGTCACAAA TCGTTGCTGATATCGGGCGATGAAGAGAAAGTGCTTATATGCTAGACTGC ACATATTGTCGCATAAGATTATGCCTTGATGGTCGGTGTTGTGTCTGTTT TTGAATTTGAAATTGTTATATTTTTCCGTTGGAAACGCCAAAAATGGTGC ACCTACCATGGTGATCCCACTCTTCGCATCCGGTCGAAAACGTTGTATGG CTTTGTGACATGTTTGAACAAAATTGTAATATTACCTACCTATAATAAAC CTTCTCTCTCCACAGCTCGAACGCGCACCAAGATTCATTACAAGAAGCAT TGGATCGCCTCTTACAATTTCACAAGAACATGATTTCAGCATTGACATGG TTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTC ATCGCAAGCTGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGC AGGTATGCCACTATCCTTTTTGTTTCCAGACTACTGGGACTGGGTTTCAG ATTACAGACAGGTTAGGATCGACGTCAAATATCTGAAGTCGTTACATTGA TTTTTTCATTCTTGATATGCACAATTGCAATGTCTTCCACCGACCCAACA GCTGATTGGTTGAAAGTGACGTATTGACTGATTTACAGAACGGAATGTTC ACGATTGACGATTTGTTACAATTGCNATCAGGTAGATAAGTTCTGTCACA AATCGTTGCTGACATCGGGTGATGAAGAGAAAGTGCTTATATGCTAGACT GCACATATTGTCGCATAAAATTATGCCTTGATGGTCGGTGTTGTGCCTGT TTTCGAATTTGAAATTGTTATATTTTTCCGTTGGAAACGCCAAAAATGGT ACACCTACCATGGTGATCCCACTCTTCGCATCCGGTCCAAAACGTTATAT GGCTTTGTGACATGTTTGAACAAAATTGTAATATTACCTACCTATAATAA TCCTTCTCTCTGCACAGCTCGAACGCGCACCAAGATTCATTACAAGAAGC ATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACAT GGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAG TCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAAT GCAGGTATGCCACTATCCTTTTTGTTTCTAGACGACTGGGACTGGGTTTC AGATTACAGACAGGTTAGGATCGACGTCAAATATCTGAAGTCGTTACATT GATTTTTTCATTCATGATACACGTTTTTTTTTTTATAAGGAACACGTTTA TAAGGAACTCGAGGCTGAAAATGGTTCAAAAAATAAGGAATTGTTAAGGA ACTGCTCAGGCTGAGANNNNNNNNNTGTGGATTTGAAAATAATGTACCTT ATTGGGACTTATTTGACCAAATTTNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA AAAAAAAAAACGTGTATGCATCATTGCATAATGTCTTCCACGGACCCAAC AGCTGATTGGTTGAAAGTGACGTATTGACTGATTTACAGAACGGAATGTT CACGATTGACGATTTGTTACAATTGCTTCGAAATTTACACTCACTTTTTC ATTCGAAATACTTAAAAAATTGGTTGTCTTTTTTAGGGGGTTCTTCATCA CTCATTGTCAAACTAGCAGTTTTTGCTGTAACTTTACCCCTTTTTTTATT TAAAGTAAAACTTTACGTCCAAAACACAACAGTGATTCCATTGTGAATTC TGGAGTCTCTAACCTACAACCCCTACGCGATCCTCATAAGTCACCAAAGC CAATATTTGATCATTTCATTTCCTTGTTTGTTTAAGAATCTGATTAAAAT CCTAATTTCTTAAAAGAACGAAACAATTATCAAAATGTCAATTGGAAACA TTCCAAATCCTTAATCTCTATAAAAAAACACGATTTTTATAAATTCACAA AATGGTGTTTATTTACTTTGTCAACTTTTTTTGTATTTGTTTTTTAATAT TTCGACGAGCTGCTTTTAATTTTCCATGTACTTTGAGTTAAAAAAATTGG GTAATCCCTCACCCATAAGTTTTGGTCATCTGCCCTCGACTGTTTCCAAA ATACGGTTAAGTTTCTTTAACTCGGACCTTTATAAGTCGGACCTTTATAA CTCGAATGTCTCCTTAACTCGAACAAGGATTATGGCCCCTTCAGTTAACA ATGACTTATAAACCTTACTCCATAAATCGGAAATTTCCTTAACTCTAACA ATTTTGTGTTCCCCGCGCGTATTCGAGAGTTATTGTGACTCCACAGTAGT AAATTTGATAACCTTCTATTTTATCAATCACTTGGTATAATTCGAACCAA CTGGGTCACATAATCACCCTTGTCTGTCACAATAAGATAAACTGTTTGCG CTTAGTTACAACTTCTTTCAAACATTCGCTTCATCATCATTGTTCAATGT CCTACGCCAACGCAAAAAGTCTTCAAATTTCACGCTGATATTATTGGATT CGTTTATTCTTAATGAGACTTAACGAACGGAATTGGCTAATTAGTTAATT AATTCCGGAAAAGGCTAAACCAAAAGTTTTTTCTGCACCCACATTTTCGT CACATTCAGCTTGTGTGCCCCATAAAATCAACTAAAAAGTCTGAGGTTAC GGGCTAACAAATTGACTTTTACACGTTGTTATAAGAACAAATTATATCGT TTGCCAAAATATCAAGAATAGGTTAAGAACAATTCAAGGCTTCGTGTCCT TCATGGACTCTAAAACACCAAATTTCTTAGGAAATCGCAAAACGGTCAAA ATAAGAACATTATAAAACATATTTTTAAGGTTTAAAACTTAAAATGTTAA GAACATCCCGAGGCTTCAAAAAATTTGGATGCTCTTCTAAAAAACGTGTA TTTGTGACTCTTTATTATTTCTATAAATCCCCGTTACAGGAACTCGAAGA TGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACTGGCA AACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCTCCAA TCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTCGAGT CGTCGATATCAGGGATAGGTAAGACTTCAAAAATGGCAATTTCAGTAAAA ACCTGGTGGTTTTTTTTATCAATTCATCGATTCTAGGAGTTAAGTATTGT GCTTTGGAGTATAAAAAGGCGATCTTTTTAGGCATACATGTGAAGCTTCA TTTTGAACGCGTGCGAATTCAAGTCTCGTGCAGAATAATGTTCTGCTAAT AGCCATCACTCCTGTGTGAAAGATGATACAGCATTTAAATCATTATTGAA CCAAGCACCTTCCTGTTGGATGTTACAATGTCTTCTTCTTATCTGATCAA ACCACATATATTAATAGTAGGTTAGAGGTTGCGGATACCTCAAACAACAT AAGTACAGTCTATGTTTCCTGTTTCATGTTCTGATATAAGATTACCCATC TTTCCCTTCTCTCCATCCAACAACAGAATGTCATATGGTACTGGTGAATG GCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAG CTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAA GTACAACAACAGAATAAACACCATCAGGTACCATTTTGAATTTACCTCAT CACTGAAGGTCATATCTTATTCTGTATTTTTGGATACTCTTGACTTGATT TGATTTGATGTTTCAAATTCGCATAAAATAACGAGAAAATGTTTTTTTTT TTGCTAATATAGGTATCAACGACATGTTTTTTTTCGAATTTTCTTGTAGA GTTCTATTTAGATACGATTACAATAAGGTTATCCAAATACATTTATTAGT CGCTGAAACTTACCAAATCTTTTTGCACTTGCAGGAATTCAAAGGCAAGC TGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAAC TTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGG AGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCC ACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAG AAAACTATCAGCCTTGTATTAGAGGTAAAATCCATTTTTATTTTGCTATT TTGCCAAAGGTTGACTGATTATCTATATGTTAGGTGGTATTTCAAATGCT TAATCTCTTTTGACAGCGGGTTTTGTACACCTTTAAACAATTTTATAAGG TATTTTCTTTCTTACGTTGTAAAGACGAGATTAGAAAAACTAGAAAACGT TCCTTAATAGTTCTCATATACTCATCAACCTTATTTTTTTGGCTTCATTG CCAAAATATTATTGGACTCGATCCGATCAATCAGTCCATCATATTTAAAG ATTATTCATGATCATTGTAATGACAATGTAATTCTGCATCCTTCCAGCAA TCCCAGGCTAAATAAACGAATCGTAGTTCCTTTCCCATCAGTTGAAACAG CATGTTAAAATTGAACCAGACACTTCTATAATAGATTTTTTCGAAATGAC CGTGTACACACATCACAATCAGATTAAGAACTAGTTTACACTGTGCAGAG AACAATTAGATGACAGCGAAAATGTTTTATCGCGATATAAATAGGAGATT AAGGAAAAATAGATGATATACTCTTTAAGCTCTCCCTTATGAATCAGTAA GCTAAACAACTAATTTATTGATGGGTTGTTGAAGAAAAACTAATGAGCTA GTATTTGTTGTCCTGAAGGGTTTGAAGTGTAAAGTTGTAGACAGATCTAA TTGTTTTGAAAAAAAGAAATGGGTACTACTGTTAATTTGAATAACGAGGT ATATCACTTTGGAACTTCTTTGATAATTACCGATATTTGGGGTTACTTTC ATAAGAGAGGGGTTGCTTTTGTGACCCCCAAACAGCTGACACTTTTGGTC TACAAGCTAAAAAAATTTCTAGCTGGTTGGAATGGACTGAAACTATTTTC GACTTGAAGGCTCTGAAAGTTACCTACCTTAAGGGAAGAAATTTTCGCGA GAAGAAATTTTCGCGGAATTTAATTTCGCGAATCAGAGTTTCAAAATGGC AACTTTCGCAGAATTTAATTTCGCGAATGAGCCGATTTTAAAAGTTTCAC GGAATTTAATTTCGCGATTGAGAAGAATTTATCAACTTAGATTAATTTTT AAGCATCACAGAGTTGTTTATATTTGATAAAAAATACACGTTATAATGCT TCAAAATCAATTGTTCATGATTGTGTCCATCTTTTTTGGTAATACCTGGT CAAAAACAACAAAATAAAAGAAAGAGAAAAAAAATCGAATTTCGCAGAAT TTAATTTCGCGATTTAACAATTTTGGTGTGTTTCGCGGAATTTAATTTCG CGAATTACGCCCAAATTCGCGAAATTAAATTCCGCGAAAATTTCTTCCGC GGAAATTTCTTCTCGCGAAAATTTCTTCCCTTAAGGTAGCACTTATGAAA GTAACCCCAATCGTGACATATATTGGAGAAAGGTGTACATAGTAGCTCAA AATCTTTTCACTTCATTTTGATATATGAGGGTGATATTGTTTGAACTTTT TTCAAAGCTTTCGTGGCCTGGTGTTACTATAACTTCAAACTACAAAATAT ACAATACACCTTTTCGACCGTAGCCGCCAATTGCCGTGGGGGCATATTTT TTCACACCTAAAGACAATAGAAAAAAGTTTGAAAAAGGATTGGCTCGAGT TTAGGGTGGTAAAACGGACAAAAAAATGCCCGCGTGGCAATTGGCGGCTA CGGTCGAAAAGGTGTATTGAATTAAATTAAAAAGTGACGGCTACATCCTC GGCTTATCATCTATCTGAAGGAACTTTTCTAATCAATTGCATACTGTGAA AAATTAATCTTAGATTCTGATCTATTATCTATTTTTGTTTAAAAACTTTC TTCACTGGTTTAATTAACAAGCTCTAATGGTTACCTTACCTATTAAGTTC GACAAGCGTAAGTTCAACTAAATTATTGGAATGGAAGATAAAAGTGAGAG TAAAGGCCAGTCTCCACTTGCGCGTGCTGCGATCGCACTTTATGTAGCAA AGCTTCCACGCCAAATATTGCCATCGAAGCGTGCGTAAGTGGAGACCGGC CTTAAAGTTACTTTTAGTCTCTTTAAAAATCGAAAGAATACCAAAATATG CTTAAATTACGTGGAGAGTCCCATTAAATATAAAAAATCTTCTCCTTTTT AGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAACTTTG AACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATATACC TGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGTATGTTTTCGAT TTGATTCTGAATTGCTTTATACTATCTGTGAACACATCAAACCTTAACAA ATTCTACATTTTGAGACAACGATATTTCGTCCCCTCTCCGCAGAAATAAA GTAGACGGTTTTCCATTATGTGAGAGCTAGGTTGACCAAATATGTCTTAA AATATTTTAAATTATTTTTCTTTGTAAATTATATCAGAGAATGCAAGAAC AAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGTCAAA GAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAGGAGT GATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGCCAGA TTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGGATCA GTTATGTTACAAGGTTTGAGAAAAAAGTTTTCTTAGGATTACTTTACACT TTTCAAAACTTCAGAATAATCTTATTTGGAATACATTGACTTCGTAGGCT TCTGCTCACCCTCCAACAAAAAAGTTTCTTATGTGAAGGAAGAGTGTACA TAGAGTATAGAGTTCTGTTTTTGGGTTGGAAAGGCATGACATATCTCTAA CTATTCTAACCCTACCAAAATTCTTGTTAAATGCGAGAGAGAATAGCCAC AAAAGTTATATTTTAATGAATTGAAATTTCATAATTCGTTACAGAAAGCG TACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATATTTC ATCAAGTAAGTGTGTAGCTCCCAGTCCCCTTTAGTGATGGCCGTCCGTAA TTTTCTTTTTTTATTCTTTTATAATTACAGTGGAGTTTCCATAGCGGAAA ACTCTGTTCGAGTTATGGAGTAAGGTTTATAAGGCATTGTTAACTGAAGG GACCAGAAAACATATCCGTCTCAAGGAGACATTCTTCGAGTAATGAAAAC TCTACTGTACACGTCAATAGCAATTTTCTAACTTTAAAGATTGAACAACA CTGCCAATTGTGTCTGGCTCTTTTGAGTTTGAATTTTGTAAGCTGGACAC TAGATTTTGATGTTTGAGCCGTCTCAAAATCTTTTACAATCGAAAAATCC AAGTCTTATCGATGCGACGTCACCTTGTATCATATTTATCATCTCCTTAA TTGTTTTATTTCAGTCATACCACAAAAACGACACAATGGGATCACCCAAA GATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAGTTTG CCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTGTTGT CGTAAGTTTTTGTTATAATTTTGAGAGAGAAAAAACCAAAAGGAAATTGG AATGAATTTTTTTTTTTAAATCGCCAAAATTTGTTTTTGCCAAAATTGAA TAAATCCTAATTTTTATCTCAAACGCTCATTAGTGGCTGAAAATAAAAAA AAATTGCTACTCGTGAAAATAAGTTTCTTGCCAAATTTGATTTTTCCGAT CTTTACTGTTCATCAAGATTCTTGTTCTTTTAAGGTCACCTGCATCTTAC CTTCCCTTATAGTTGACTTGTGTGAATTGAACTTAAACATCAAGAAAGCA TTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATGTCGG AGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACGAATC GTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAACTGG TTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTTTATC ATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGATAAAT GGAAATGTAAGTAGGGTTNTATCACTTTGATGTCACGTGCTAAACTGGAA GATAAATGGAAATGTAAGTAGGGTTAAAATTCATCCACTTTAGACTTTAA CTAATCTTTTAAAATTAACGTGTCAACTTTCTATAATATAGCAATTAACA CATATAACAGTTTCTTCACTCTTCTTTCGCTACCAAGACGTATACATTCC TAATTCAGAATCTTTACTTGATTTTGATGCAAGTGTACAGTTCAGCTCAT TTTATGACTTTCGTTTGCTATTTTTTCCTAGATTTATTCCGTCAAATTTC GGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACG ATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGT AGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGGTAAGTTCTTT GTTTGTTATAAATCCTGTAAGTGTATTCAGAGTTGAGGTTTTTTATTTAC TTTTTTTAAGAGGCAAAATTTACAAGTGAACGAGAACCGGACCTTGAAAA CTGCAGAAAAATAAGCTTCAAAAAATTACTGTTTTTGTATATTGTTAGGG TTAGATTTTATAAATTTTCTAATTTTGTCATTCGTCTTCATTTTCTAGGC TAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACGAACG CCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGCGTCC GCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGTACCC GATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGATCTTT GTCAGGTAAGGAAAAGTTTGAATGCTGTGGCGAAAACTTCATTCAATAAC ATTTTCAAAATGATACAAATGATATTTTTGTTCACAAAATATCTTTTGCC CAGATATAGTAAAACCCTTTAATTTAAATCAATTTAATTTGATTAGAGAA TCCCACCTAATTTCAACAAATATTTGAAAATCATTAGCTCGTTTGAAGTA GCAAAGCAAGCTTGACATTCTCAAATGCTACTTTCACCATGTCTTTATAA TAGCCGTTAGCTTACGCTTGAAGTACTAACCTTTTTTACTTTTGTTCATG TGGTTTGATTACTATCTACCAATCAATTAATTATTTAGACTTGCTTCTGG TCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATA TAGCTTAGCGGTAAGTCTCATTTGTGTTCCACGGAAGCTCCATAACCCCA ATTCTTCTTAGCTCTCTATGTTCCTCGTGCGTGTTCGAGTTGAAGGACTC TATTATAGGTTCTATTAAGGTTTTTCGTGAAGTGACCTTATCACGCCCTT TCCCGAAAACGAACATCGTCTCTAGCGGATATTCTTTTATGAAGGTCACT GTGTTTCACACCGTATTTTCCATCGTATTTTCGATATGATTTATAAAGCA GGAGCCTTCTTAAGGTTATTTTGCACCAATCATATCCATGGTTTCCTTGG TTTATCGTTAATAATTTGTGCTGTGCGTAAAGATTGGACTTATTTTTTCT GATGCACGTACAATATGTTTTATTCTCCTCTTTTTTCTACAGACGACGAC GGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTCAAAT CTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCCAGTG CAGACCATCATGGAAGGAAGTTCCATTGAAACGTATGTTTACTCCTTTGA TTTCACTCTCCACTATCATCTACAGCATGGCTTTTAACAAAGCTTGTTTC GAAAGTGCTTCATTTTCATGGCTATTGGTAGGACTTATCCTTACCAAGAT GGTAGTGGGTGGACCAAATCCATGATTCCGAAAAAAGGTTATTATCCTTC TGACGTGAAGCACATTACGCAAAATATGTTGTTTTTATGAAGTAACGGTT TCTGATGAACGACTTGCTTTGATGGACGATGACCAAATGGTCTAAGGCTT CACCAGTGCAAACCAGGCGGCCGTAGTTCGAATTCTTGTTTCTTCCAATG TTGTGTTCAGCTCATAGATTGAGCTTGCCGACAGTGGACCCTGTGAAAAC AATCAAAAGGGTGTCTAAAAGTCCTAGATTACTCGGTTATCCACGTAAAA TATCTATGGGATTATCTCCGTGCAACTTTTTATTACTTTTTATTTTTCTT AACAGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGA CTCGGCGTAAGATCACAGTTGTTTTCCTATTCAATCGTGTTGTTTTTCTA TTCAATAGTTTCAATCACCATGTTTTAGTATTTTACCTTTTAACACTTCC TACATTTTCAAGATGCAATTCTATCTAGCCTCAGAATAGACTGGAGTCGT TTATAATGTGTGTAATACAGTAGCATAGGTATTATATGATAATACGATTA TTGTTACAGGATTTAGCTATATTTAGTATAAACTAAAAACATTTCCCTCC ATCATTTTTTGCTTTATTTTTACCATGTCTAAATTAGTCGTCTAGCTTGC TAGACCAGCCTCAGAATAAAATAGCCTATTTTACACCAGGCTGAATAAGT CAGAGATCTTACAAATCAGCATGCTGAGATTCTTGTTTTGAAAATCCAAT TCTACATTTATATTATCCTCCAGAATGAACGGTCACCACGATTCGACAGA CTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAGGAAC ATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCACAAAC AATAACACAACGGTGTGTAATTTTTCATGCCTTTTTTGTTCATCATTTTC ACTTTCGATTTTCGCTCAGACAAGTCTCCTTCATAGGTTATCTCCCGGTG GATAGGAGTCATGGGGACAAGCTGGAGTTTTTACAAGCTCTTACGTGATT TGGTTGGTCGTTAAGTTAATTTCATTACTTTTTCTAAAGAACGCGTCATC TCTATTACTTCAAATGACCAATTAGTGAAGTATCTTATAAAAACTCCAGC TCATCCCGAATCATGGGAAACATGGGGAAAATGCTCCCTTTCTATTGGTC AAACCTTTTGAAGATGACTAAAGGGACATCATTATTAGAGGGCAGTCCTG ATTACCCATGATTCATTTCGAATCATGGGTAAAGAGAGATTTGCGAAATA AAAAGTATCAACTAATCGTGGTTTGCAATCAATAATTACATTTTGCTTAA ACCCTGAGCACGCCGTTTTTATCCTGTATTTCTCATTTCTTTCTTCAGCC GAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAG ATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAGTAAGTAATG TTGAATTTTTTACCTATCAGTATTGAGTTTGAGACATTTAAGGAATCAAT ATTTGATGAGCTCATCCCGAATTTAAGCACTGGATTTGTATTATTTTTGA ATAAAATCTGTCTAAAGGATTGCCAACGTTTTTTCCGATAGTATGTCTAT AATCACTTTGGAATTTTACTTATGCGAGATTTTATATTCAAATGAGATTT TAGAAATATATATGTTAAATCTAAGATCTGTTGAAATTAAGCCCGTCAAG TTGGTGATCTTGATCTTGATATGATTAGTATGTTTCTCTTATATATTCTC TTTGCTTTCTTCTCTAGATCTCTAATGGAAGAATACACCCGACTGAAGGG AATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAAAATA CACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACACAAA GGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGACAATT AGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGGTTAGTGAAG TTCCATTCTACTTGTTACCGTAAGTTGGTCTAATACCGACATCCCTCTTC TAATTCCGATGACACCCTTCTTTACAGATAGGAATTATAGGAAGGCCGGA ATTGCTGATGGAAACTATTTCCCCTTATTGCTTAGCTATCAGATTGGAAA AAGTCCTTTGTCTATCAGTGATCTAGACCTTTTGACCATTCCTATCTTTA AAGAAAGGTGTCGAAATTAGAAGAGGGATGTCTACAGAACAACTTACGGT ATGATTCTCTAGCTACTCTGTATCAGAGTGTATCAAATTTATAACGTAGC GTAGTACAGTAAAGTGCGTCAAATGGGCGAAGTTTTGTTTGCAGACAAAA CTGAACCGTCCTGAGTTGCATTATGGGCTTCACATTTAGAATCAGGAAAG CTGTATGTTTGTATATGGGAGTTTCTAATTAAAATCTATTTTCTTTCGTT AAATTATAGCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTAC GAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGT CTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGAT GAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTT CCCAACATCAAGTTATGAGGATTAACGGAGGAATGGAAATTTTGTTCTAT TAGTGTATTGTTCTGCTTTTTCTCTTGTGTTAGTAGTGTTTATATGAAAG ATTGAATCTTTTAGAATTAGCGCTTTATTGTTAATACACAAAGAAATAAT GTCATTTTTCTATCTACCCATTTTCAGAATCAGAAATAAAGTTCTAGGAA CACCGGACGGTTTTTAGATCCCTGGAGGACCTAAAGAAAATATCCGAAAC CTTTTCTGCTACTGAAGGTTTGGTTTTTGTAAAATAGAATACCAGTCTGG ACAATTAGGTTGATAGATACATGAAATTATTTATTTTGAAATTTAAAAGA AATATTTATAGCTTATATATATTTTTATATTGTACCTTGTCCATATAATA ATTTTTTTTGTCTTTTCTGTTGTCTTTCCTTGTCCTCCCTGAATTCTATG TTGTGTTTTTGTTTGCCTCCAGAAAAAACGAGGTCGCTTTATTTTCGCGT ATTATTTTGCTTTTTGTAAATAAGTTTTTTTTGTTTTGTCTTATATTTTT TGACAGAAAATCTTTTTTATGGATAGAAATAATTTTATACAATTGAAAAT ACCTTTGCGTTCATTATCAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000749XLOC_000749Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001414-exon-sc0000010-1575043694:305133..305169TCONS_00001414-exon-sc0000010-1575043694:305133..305169Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:304642..304860TCONS_00001414-exon-sc0000010-1575043694:304642..304860Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:302804..302908TCONS_00001414-exon-sc0000010-1575043694:302804..302908Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:300771..300956TCONS_00001414-exon-sc0000010-1575043694:300771..300956Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:299999..300076TCONS_00001414-exon-sc0000010-1575043694:299999..300076Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:294516..294735TCONS_00001414-exon-sc0000010-1575043694:294516..294735Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:291980..292098TCONS_00001414-exon-sc0000010-1575043694:291980..292098Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:290122..290409TCONS_00001414-exon-sc0000010-1575043694:290122..290409Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:289428..289608TCONS_00001414-exon-sc0000010-1575043694:289428..289608Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:288420..288806TCONS_00001414-exon-sc0000010-1575043694:288420..288806Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:287724..287947TCONS_00001414-exon-sc0000010-1575043694:287724..287947Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:287246..287412TCONS_00001414-exon-sc0000010-1575043694:287246..287412Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:286702..286828TCONS_00001414-exon-sc0000010-1575043694:286702..286828Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:285501..285673TCONS_00001414-exon-sc0000010-1575043694:285501..285673Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:283863..284013TCONS_00001414-exon-sc0000010-1575043694:283863..284013Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:283347..283512TCONS_00001414-exon-sc0000010-1575043694:283347..283512Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:282884..283032TCONS_00001414-exon-sc0000010-1575043694:282884..283032Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:282271..282583TCONS_00001414-exon-sc0000010-1575043694:282271..282583Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:281398..281549TCONS_00001414-exon-sc0000010-1575043694:281398..281549Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:276419..276584TCONS_00001414-exon-sc0000010-1575043694:276419..276584Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:274497..274630TCONS_00001414-exon-sc0000010-1575043694:274497..274630Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:267631..267785TCONS_00001414-exon-sc0000010-1575043694:267631..267785Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:256316..256502TCONS_00001414-exon-sc0000010-1575043694:256316..256502Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:254102..254280TCONS_00001414-exon-sc0000010-1575043694:254102..254280Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:253543..253693TCONS_00001414-exon-sc0000010-1575043694:253543..253693Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:253046..253285TCONS_00001414-exon-sc0000010-1575043694:253046..253285Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:250783..250917TCONS_00001414-exon-sc0000010-1575043694:250783..250917Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:250357..250582TCONS_00001414-exon-sc0000010-1575043694:250357..250582Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:250015..250075TCONS_00001414-exon-sc0000010-1575043694:250015..250075Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:249469..249605TCONS_00001414-exon-sc0000010-1575043694:249469..249605Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:248914..249207TCONS_00001414-exon-sc0000010-1575043694:248914..249207Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:248481..248638TCONS_00001414-exon-sc0000010-1575043694:248481..248638Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:248065..248271TCONS_00001414-exon-sc0000010-1575043694:248065..248271Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:247660..247731TCONS_00001414-exon-sc0000010-1575043694:247660..247731Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:247138..247277TCONS_00001414-exon-sc0000010-1575043694:247138..247277Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:246614..246664TCONS_00001414-exon-sc0000010-1575043694:246614..246664Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:246058..246196TCONS_00001414-exon-sc0000010-1575043694:246058..246196Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:245480..245571TCONS_00001414-exon-sc0000010-1575043694:245480..245571Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:244930..245152TCONS_00001414-exon-sc0000010-1575043694:244930..245152Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1575043694:243650..244460TCONS_00001414-exon-sc0000010-1575043694:243650..244460Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:305133..305169TCONS_00001414-exon-sc0000010-1510915933:305133..305169Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:304642..304860TCONS_00001414-exon-sc0000010-1510915933:304642..304860Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:302804..302908TCONS_00001414-exon-sc0000010-1510915933:302804..302908Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:300771..300956TCONS_00001414-exon-sc0000010-1510915933:300771..300956Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:299999..300076TCONS_00001414-exon-sc0000010-1510915933:299999..300076Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:294516..294735TCONS_00001414-exon-sc0000010-1510915933:294516..294735Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:291980..292098TCONS_00001414-exon-sc0000010-1510915933:291980..292098Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:290122..290409TCONS_00001414-exon-sc0000010-1510915933:290122..290409Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:289428..289608TCONS_00001414-exon-sc0000010-1510915933:289428..289608Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:288420..288806TCONS_00001414-exon-sc0000010-1510915933:288420..288806Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:287724..287947TCONS_00001414-exon-sc0000010-1510915933:287724..287947Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:287246..287412TCONS_00001414-exon-sc0000010-1510915933:287246..287412Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:286702..286828TCONS_00001414-exon-sc0000010-1510915933:286702..286828Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:285501..285673TCONS_00001414-exon-sc0000010-1510915933:285501..285673Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:283863..284013TCONS_00001414-exon-sc0000010-1510915933:283863..284013Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:283347..283512TCONS_00001414-exon-sc0000010-1510915933:283347..283512Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:282884..283032TCONS_00001414-exon-sc0000010-1510915933:282884..283032Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:282271..282583TCONS_00001414-exon-sc0000010-1510915933:282271..282583Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:281398..281549TCONS_00001414-exon-sc0000010-1510915933:281398..281549Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:276419..276584TCONS_00001414-exon-sc0000010-1510915933:276419..276584Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:274497..274630TCONS_00001414-exon-sc0000010-1510915933:274497..274630Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:267631..267785TCONS_00001414-exon-sc0000010-1510915933:267631..267785Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:256316..256502TCONS_00001414-exon-sc0000010-1510915933:256316..256502Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:254102..254280TCONS_00001414-exon-sc0000010-1510915933:254102..254280Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:253543..253693TCONS_00001414-exon-sc0000010-1510915933:253543..253693Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:253046..253285TCONS_00001414-exon-sc0000010-1510915933:253046..253285Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:250783..250917TCONS_00001414-exon-sc0000010-1510915933:250783..250917Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:250357..250582TCONS_00001414-exon-sc0000010-1510915933:250357..250582Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:250015..250075TCONS_00001414-exon-sc0000010-1510915933:250015..250075Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:249469..249605TCONS_00001414-exon-sc0000010-1510915933:249469..249605Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:248914..249207TCONS_00001414-exon-sc0000010-1510915933:248914..249207Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:248481..248638TCONS_00001414-exon-sc0000010-1510915933:248481..248638Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:248065..248271TCONS_00001414-exon-sc0000010-1510915933:248065..248271Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:247660..247731TCONS_00001414-exon-sc0000010-1510915933:247660..247731Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:247138..247277TCONS_00001414-exon-sc0000010-1510915933:247138..247277Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:246614..246664TCONS_00001414-exon-sc0000010-1510915933:246614..246664Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:246058..246196TCONS_00001414-exon-sc0000010-1510915933:246058..246196Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:245480..245571TCONS_00001414-exon-sc0000010-1510915933:245480..245571Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:244930..245152TCONS_00001414-exon-sc0000010-1510915933:244930..245152Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1510915933:243650..244460TCONS_00001414-exon-sc0000010-1510915933:243650..244460Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:305133..305169TCONS_00001414-exon-sc0000010-1491911889:305133..305169Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:304642..304860TCONS_00001414-exon-sc0000010-1491911889:304642..304860Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:302804..302908TCONS_00001414-exon-sc0000010-1491911889:302804..302908Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:300771..300956TCONS_00001414-exon-sc0000010-1491911889:300771..300956Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:299999..300076TCONS_00001414-exon-sc0000010-1491911889:299999..300076Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:294516..294735TCONS_00001414-exon-sc0000010-1491911889:294516..294735Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:291980..292098TCONS_00001414-exon-sc0000010-1491911889:291980..292098Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:290122..290409TCONS_00001414-exon-sc0000010-1491911889:290122..290409Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:289428..289608TCONS_00001414-exon-sc0000010-1491911889:289428..289608Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:288420..288806TCONS_00001414-exon-sc0000010-1491911889:288420..288806Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:287724..287947TCONS_00001414-exon-sc0000010-1491911889:287724..287947Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:287246..287412TCONS_00001414-exon-sc0000010-1491911889:287246..287412Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:286702..286828TCONS_00001414-exon-sc0000010-1491911889:286702..286828Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:285501..285673TCONS_00001414-exon-sc0000010-1491911889:285501..285673Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:283863..284013TCONS_00001414-exon-sc0000010-1491911889:283863..284013Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:283347..283512TCONS_00001414-exon-sc0000010-1491911889:283347..283512Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:282884..283032TCONS_00001414-exon-sc0000010-1491911889:282884..283032Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:282271..282583TCONS_00001414-exon-sc0000010-1491911889:282271..282583Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:281398..281549TCONS_00001414-exon-sc0000010-1491911889:281398..281549Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:276419..276584TCONS_00001414-exon-sc0000010-1491911889:276419..276584Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:274497..274630TCONS_00001414-exon-sc0000010-1491911889:274497..274630Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:267631..267785TCONS_00001414-exon-sc0000010-1491911889:267631..267785Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:256316..256502TCONS_00001414-exon-sc0000010-1491911889:256316..256502Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:254102..254280TCONS_00001414-exon-sc0000010-1491911889:254102..254280Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:253543..253693TCONS_00001414-exon-sc0000010-1491911889:253543..253693Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:253046..253285TCONS_00001414-exon-sc0000010-1491911889:253046..253285Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:250783..250917TCONS_00001414-exon-sc0000010-1491911889:250783..250917Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:250357..250582TCONS_00001414-exon-sc0000010-1491911889:250357..250582Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:250015..250075TCONS_00001414-exon-sc0000010-1491911889:250015..250075Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:249469..249605TCONS_00001414-exon-sc0000010-1491911889:249469..249605Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:248914..249207TCONS_00001414-exon-sc0000010-1491911889:248914..249207Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:248481..248638TCONS_00001414-exon-sc0000010-1491911889:248481..248638Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:248065..248271TCONS_00001414-exon-sc0000010-1491911889:248065..248271Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:247660..247731TCONS_00001414-exon-sc0000010-1491911889:247660..247731Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:247138..247277TCONS_00001414-exon-sc0000010-1491911889:247138..247277Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:246614..246664TCONS_00001414-exon-sc0000010-1491911889:246614..246664Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:246058..246196TCONS_00001414-exon-sc0000010-1491911889:246058..246196Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:245480..245571TCONS_00001414-exon-sc0000010-1491911889:245480..245571Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:244930..245152TCONS_00001414-exon-sc0000010-1491911889:244930..245152Clytia hemisphaericaexon
TCONS_00001414-exon-sc0000010-1491911889:243650..244460TCONS_00001414-exon-sc0000010-1491911889:243650..244460Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:243650..305169 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.59005e-07 9.3067e-10 8.79294e-08 2.64019e-06 0 0 0 0 0 0 0 0 0 0 1.55231e-10 0 0 3.12135e-10 4.55049e-09 3.28473e-07 9.30652e-10 9.96444e-11 9.3168e-09 8.87441e-09 0 0 0.00414022 9.74555e-05 2.83961e-10 0
Blast
BLAST of TCONS_00001414 vs. Swiss-Prot (Human)
Match: DMD (Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 533/1625 (32.80%), Postives = 865/1625 (53.23%), Query Frame = 2
Query: 1934 DIQDVIREIEEIHAVFNDECFSKKPFDQLAQQQELLKEMETRMDSVSPSVTSLMMVQQAYINQTTPEEMHNIDVHLTTMCARWNALDKEFRHRYVSVEKNVGEWQQFTDDCNSLMLFLTKAENQLRENQNDD---------VEKDLYDEINRNEFKXXXXXXXXXXXIALSTDSNAE-LKDKLESVNRRWKEIMSGLNSRKLGSLMDDPKIKEFVNKSDQIKTQLDAIFKLVFHTKPH----PVDAGSLQKYRDDLKKCE---NDLTDRRDEIGRLTDDADRLLERPDLSANQLDEI--KSRSTSMQ----------------AQVQDLTTGHSKRFDVVENNLARATRFLDELDGLSSWMSKTRDLLEGHKENKPGYNVDPEIMKKSLETRKCNVLSINDLLKDFKAEGELASGNFP--QAVGEKIGQLNVDWQIIIRLALALKERPVSEEVVVAETVQERQDAPVTFDSLQTSLSFTTTETSKYKYEMYSSTN-ENSIGGEGETA--QLHDWLRLVEQKIKSLNVTLGDEDEMAAAVQKQNSIQLEMSNRRKEYDDAISMA-----TTSPQD-----DEKINKLKEHWEGVWGKVLNKKSLINQALVDWRRYNELRLQLDNYVYKADIQLNENQQIGTTVTELEAQLEKHKKFQGELSTWANTYNTLRQLAETILSTYVNEDLNDFKTTVNETNTRWNSLETRSNAHQDSLQEALDRLLQFHKNMISALTWLSSAESKVAEL-DSLVESSQAEDTSNVDELQGEMQELEDDIASHQAMFNGLNETGKQILMDLEVGEVRTALQSKLDDMNDRWNSLGVRVVDIRDRMSYGTGEWRQLLLDMQEIVDWLSRAGQELMSQQPIASDVEKVQQQNKHHQEFKGKLNARRVVIEQALEQGHNFLLKHQSAQDESFIQRGDKL-----VVRVASSLREQLTHIQSQWLDLQNNSDKWEKTISXXXXXXXXXXXDIEKINKTLNESEEIVNHWVLTQDIPVDSVASYLGDTRRMQEQTQSMETQFDSMDGTVKELRHIHGVLLAKPTEGVIDQLHDRWKHLLNDCQIRQENLQNLMSGSDAGSV---MLQESVPTPWERGQALNKVPYFINHTTKTTQWDHPKMTELYHTLSELNDVKFAAYRTSMKLRCLQKACCLDLCELNLNIKKAFEQHNLRLSNDNLVDVGEIINVLSTIFESIDTNRKESINVSQCIDMTLNWLLNVYDSGRIGKLRVLSFKAAITLMSRAKLEDKWKYLFRQISDNTGHADSKKLGLLLHDCVQIPRQLGEIAAFGGSNIEPSVRSCFEMAKNNSAIDSNNFVAWTNAEPQSLVWMPVLHRLASAETAKHDAKCGICKEYPIVGFRYRCLKCFNFDLCQTCFWSGRVSKSHRVTHPMHQYSLATTTGEDLSDFVKLMRNXXXXXXXXXXXXXXLGYLPVQTIMEGSSIXXXXXXXXXDLSNF-TFDSAMNG----HHDSTDFHPNHHG--------------NDEEIGNE----EHHLIKLMCQSLNGEITNNNTTPKSPSQILATLDSSQQEDIGEMIRGLEEEHQSLMEEYTRL------KGIKPSNS-FENGQIVPENTQDTVLIAEAKSLREHKGRLEARMQILEDHN 6541
            +I  V + + E+  + N      K F+ L +Q+E LK ++  +   S  +  +   + A +   TP E   +   L+ +  +W  ++K ++ R    +++V +W++F  D      +LT+AE  LR+ Q  +           K+L D I + +  +  LN TG  +I  S+ ++A  L++KL S+N RW+E+   L+ RK        +++E  N   + +  L+  F L      +    P++ G  Q+ ++ L++ +    +L  R+  + +L +    +L    +S  + D++  K + T++Q                AQ++DL     K  D+ E           +L+ L  W+S  R+ LE + +       D +  + +++ ++ +V       ++  ++G+      P  Q V  K+  L+ +W+ + RL   L+    +++  +A  +     +P    +L T     T ET+  K EM SS   E     +   A  +L DWL L++Q IKS  V +GD +++   + KQ +   ++  RR + ++ I+ A      TS Q+      ++I +++  W+ V   + N++  +N+ L D  ++ E + + +  + +A  +L   ++   TV  ++ ++ + K+   +L  W    +    LA  +L  Y  +D           N  W S+  R +  + +L+E    L QF  ++   L WL+ AE+    L D+  +    ED+  V EL  + Q+L+ +I +H  +++ L+E  ++IL  LE  +    LQ +LD+MN +W+ L  + ++IR  +   + +W++L L +QE++ WL     EL  Q PI  D   VQ+QN  H+ FK +L  +  VI   LE    FL +      E   Q   +L        V   LR+Q   + ++W  L  +S  W++ I   LE +  L E  ++++  L ++E I   W    D+ +DS+  +L   + ++ +   ++     ++   ++L  + G+ L+      ++ L+ RWK L    + R   L    +  D G      L  SV  PWER  + NKVPY+INH T+TT WDHPKMTELY +L++LN+V+F+AYRT+MKLR LQKA CLDL  L+     A +QHNL+  ND  +D+ +IIN L+TI++ ++      +NV  C+DM LNWLLNVYD+GR G++RVLSFK  I  + +A LEDK++YLF+Q++ +TG  D ++LGLLLHD +QIPRQLGE+A+FGGSNIEPSVRSCF+ A N   I++  F+ W   EPQS+VW+PVLHR+A+AETAKH AKC ICKE PI+GFRYR LK FN+D+CQ+CF+SGRV+K H++ +PM +Y   TT+GED+ DF K+++N     +       ++GYLPVQT++EG ++ETP       L NF   DSA        HD T     H+               ND    NE    EH LI+  CQSLN +  +  + P+SP+QIL +L+S ++ ++  ++  LEEE+++L  EY RL      KG+ P  S  E     P++ +D  LIAEAK LR+HKGRLEARMQILEDHN
Sbjct: 2003 EITHVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKNIKDSLQQSSGRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSVEKWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRTLNATGEEIIQQSSKTDASILQEKLGSLNLRWQEVCKQLSDRK-------KRLEEQKNILSEFQRDLNE-FVLWLEEADNIASIPLEPGKEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPISPEEQDKLENKLKQTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEE-----------QLNHLLLWLSPIRNQLEIYNQPNQEGPFDVKETEIAVQAKQPDV-------EEILSKGQHLYKEKPATQPVKRKLEDLSSEWKAVNRLLQELR----AKQPDLAPGLTTIGASPTQTVTLVTQ-PVVTKETAISKLEMPSSLMLEVPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDLALKLLRDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEKFLAWLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKILRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTL-GIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHE--AHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACD-ALDQHNLK-QNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKN-KFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVT-----LINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQD--SPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHN 3583          
The following BLAST results are available for this feature:
BLAST of TCONS_00001414 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DMD0.000e+032.80Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3[more]
back to top