Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001413 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001413
Unique NameTCONS_00001413
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4962

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001413 ID=TCONS_00001413|Name=TCONS_00001413|organism=Clytia hemisphaerica|type=transcript|length=4962bp
GCTgtatacacatttttactgGAGAGGACTTTAAATTAGTATTCGTTTAG
ATCTTGTTGGTATGCGAATAAAGATCCCTAATGGATGACCCAAAGATCAA
AGAGTTTGTTAATAAATCGGATCAAATCAAAACGCAACTGGACGCCATCT
TTAAACTGGTCTTCCATACTAAACCACATCCAGTGGATGCTGGGTCACTA
CAAAAATACAGGGATGACCTCAAGAAATGTGAAAATGATTTGACCGATAG
AAGGGATGAGATAGGACGTTTAACAGATGATGCCGATCGATTACTTGAAC
GTCCCGATTTGTCCGCCAACCAACTTGATGAGATTAAATCACGTTCGACT
TCCATGCAAGCTCAAGTACAAGATCTGACCACAGGACATAGCAAACGATT
TGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAAC
TCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGGC
CACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGATCATGAAGAA
ATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTGA
AAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGCC
GTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATACG
TCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTCG
CAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTTA
CAAACCAGTTTATCTTTCACAACGACTGAAACttcaaaatacaaatatga
aaTGTATTCTTCAACGAACGAGAACAGTATCGGTGGCGAAGGAGAGACGG
CTCAACTACACGATTGGTTGAGATTGGTCGAACAGAAAATCAAAAGTCTG
AACGTTACCCTTGGTGATGAAGATGAAATGGCGGCTGCCGTACAAAAACA
AAACTCCATCCAATTGGAGATGTCAAACCGACGTAAAGAATATGACGACG
CTATTTCCATGGCAACCACGTCACCACAAGACGACGAAAAGATTAACAAG
TTGAAAGAACATTGGGAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTC
ACTTATTAACCAAGCTCTGGTTGATTGGCGTCGTTACAACGAGTTGCGTT
TACAACTTGATAATTATGTGTACAAAGCCGATATTCAATTGAACGAAAAC
CAACAGATTGGTACTACCGTCACCGAACTAGAAGCACAACTTGAAAAACA
CAAGaAATTCCAAGGCGAATTATCAACTTGGGCCAACACTTACAATACTT
TACGACAACTAGCTGAAACCATTTTGTCGACGTACGTCAACGAGGATTTG
AACGACTTCAAAACGACTGTCAACGAGACCAATACTCGGTGGAATAGCTT
GGAAACTCGCTCGAACGCGCACCAAGATTCATTACAAGAAGCATTGGATC
GCCTCTTACAATTCCACAAGAACATGATTTCAGCATTGACATGGTTATCT
TCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGGAGTCATCGCA
AGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTGAAATGCAGGAAC
TCGAAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAA
ACTGGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGC
TCTCCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTG
TTCGAGTCGTCGATATCAGGGATAGAATGTCATATGGTACTGGTGAATGG
CGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCAAGAGC
TGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGAGAAAG
TACAACAACAGAATAAACACCATCagGAATTCAAAGGCAAGCTGAACGCG
CGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCACAACTTCCTTTT
GAAACATCAATCTGCACAAGACGAATCGTTCATTCAAAGAGGAGATAAAT
TGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTGACCCACATACAG
TCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTGGGAGAAAACTAT
CAGCCTTGTATTAGAgCTGGTGAACAATCTGTTGGAGGACATCGAAAAGA
TCAACAAAACTTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTC
ACTCAAGATATACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAG
GAGAATGCAAGAACAAACGCAATCCATGGAAACACAATTTGATTCGATGG
ATGGAACAGTCAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAA
CCGACTGAAGGAGTGATCGACCAATTACATGACAGATGGAAACATTTGTT
GAATGATTGCCAGATTCGACAGGagaatttgcaaaatttgatgTCTGGTT
CGGATGCAGGATCAGTTATGTTACAagAAAGCGTACCGACACCATGGGAA
CGTGGACAAGCATTGAACAAAGTGCCATATTTCATCAATCATACCACAAA
AACGACACAATGGGATCACCCAAAGATGACGGAGTTATATCACACGTTAT
CGGAATTAAATGACGTCAAGTTTGCCGCATATCGTACCTCCATGAAATTG
AGATGTCTGCAAAAGGCTTGTTGTCTTGACTTGTGTGAATTGAACTTAAA
CATCAAGAAAGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACT
TGGTCGATGTCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGT
ATCGATACGAATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATAT
GACGTTAAACTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAAT
TACGAGTTTTATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAA
CTAGAAGATAAATGGAAATATTTATTCCGTCAAATTTCGGATAACACCGG
CCACGCAGACAGCAAAAAACTTGGTTTGCTATTACACGATTGCGTCCAGA
TTCCTCGACAACTTGGTGAAATCGCTGCCTTCGGTGGTAGCAATATCGAA
CCTAGCGTCAGGAGCTGCTTCGAAATGGCTAAAAACAACTCAGCGATCGA
TTCCAACAACTTTGTAGCCTGGACGAACGCCGAACCACAATCATTAGTCT
GGATGCCAGTATTACACAGGCTAGCGTCCGCCGAAACTGCGAAACATGAC
GCAAAATGCGGTATTTGTAAAGAGTACCCGATTGTTGGTTTCAGATATCg
ctgtttgaaatgttttaacTTTGATCTTTGTCAGACTTGCTTCTGGTCTG
GACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATCAATATAGC
TTAGCGACGACGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAG
AAACAAATTCAAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTG
GTTATCTTCCAGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACGCCA
ACGGAACCAACGACACCTGATCTATCCAACTTCACTTTCGACTCGGCAAT
GAACGGTCACCACGATTCGACAGACTTCCACCCCAATCACCATGGTAACG
ATGAGGAGATTGGTAACGAGGAACATCATCTGATCAAGCTCATGTGTCAA
TCATTAAACGGTGAAATCACAAACAATAACACAACGCCGAAAAGTCCGTC
ACAAATTTTGGCGACGTTAGATTCATCACAACAAGAAGATATCGGAGAAA
TGATTCGAGGTCTTGAAGAGGAACACCAATCTCTAATGGAAGAATACACC
CGACTGAAGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGT
TCCGGAAAATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTAC
GCGAACACAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCAT
AATCGACAATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACA
GCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAAGTACGAATCCAC
CCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCATCGTCTTATCAC
GGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTCAGATGAGCGTGC
GATGGATATACATCATGTGACCGCAGAAATCGAACACGCCTTCCCAACAT
CAAGTTATGAGGATTAACGGAGGAATGGAAATTTTGTTCTATTAGTGTAT
TGTTCTGCTTTTTCTCTTGTGTTAGTAGTGTTTATATGAAAGATTGAATC
TTTTAGAATTAGCGCTTTATTGTTAATACACAAAGAAATAATGTCATTTT
TCTATCTACCCATTTTCAGAATCAGAAATAAAGTTCTAGGAACACCGGAC
GGTTTTTAGATCCCTGGAGGACCTAAAGAAAATATCCGAAACCTTTTCTG
CTACTGAAGGTTTGGTTTTTGTAAAATAGAATACCAGTCTGGACAATTAG
GTTGATAGATACatgaaattatttattttgaaatttaaaagaaatattta
tagcttatatatatttttatattgtaCCTTGTccatataataattttttt
tgtcttttctgTTGTCTTTCCTTGTCCTCCCTGAATTCTATGTTGTGTTT
TTGTTTGCCTCCAGAAAAAACGAGGTCGCTTTATTTTCGCGTATTATTTT
GCTTTTtgtaaataagttttttttgttttgtcttatattttttgacagaa
aatcttttttatggaTAGAAATAATTTTATACAATTGAAAATACCTTTGC
GTTCATTATCAT
Run BLAST on NCBI

transcript from alignment at sc0000010:243650..284473-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001413 ID=TCONS_00001413|Name=TCONS_00001413|organism=Clytia hemisphaerica|type=transcript|length=40824bp|location=Sequence derived from alignment at sc0000010:243650..284473- (Clytia hemisphaerica)
GCTGTATACACATTTTTACTGGAGAGGACTTTAAATTAGTATTCGTTTAG ATCTTGTTGGTATGCGAATAAAGGTTATTATGATATTTGTTCGTTTTTCA TTGTGTTTAATCACACAGATCGGCATTCTTGACTACACTTTTTTTTACAA GAACCAGGAAATTTTGACAAGGCTCGTTTGTTCTTATTTTTTGGTACTTT CAGCGTCAAATTGTTCTTATCCTGTTCTTATTTATAGTGTGAAATTGAAT TATTTCATGATGTATACCCAATGTTTACTACTTTGACCCCTAAATTGCTT GAAATTGAGTCAGTGTTCAAGCATTGTTCTTAAATTGTTCTTATTTTTGG CGATTTTGAGCCTCGTTGTTCTTATAAAATTGTTCTTAAAAAAGGAAAAA AAAGTGTATTAGTAACATATCATATATTTCATATTCATTAACTTTCATCT CTCCCTTTAGATCCCTAATGGATGACCCAAAGATCAAAGAGTTTGTTAAT AAATCGGATCAAATCAAAACGCAACTGGACGCCATCTTTAAACTGGTCTT CCATACTAAACCACATCCAGTGGATGCTGGGTCACTACAAAAATACAGGG ATGACCTCAAGGTATGTGCTTTTGTACTTTTAATCTTTTGCTGTTGTAGA TCTTTTGCGGAAAACCTTGGACAGCCATCCTATAGAACAGGATGACTAAA TCAAGGAACTTTAATAAAACAGATTAAATTGGAAAATAAGCTGAATTTTG CTCTTCTTTTGTCTAAAATGATTTATGATAATTTCAAAGTCTGTTCTCGT TAACGGTGTATTTCTTTATGGCCTTCATACGAAAACTTTGTCAATGCCAG TAGACTAACACCTTCGAAAGTGGTTAATATGTGGTATGAAGAGAAATACA CAATTTGTGAATAGACTTAGCTACTAGCTAATATTTTGCGATTCTTTTTC TCCTTGCACAGAAATGTGAAAATGATTTGACCGATAGAAGGGATGAGATA GGACGTTTAACAGATGATGCCGATCGATTACTTGAACGTCCCGATTTGTC CGCCAACCAACTTGATGAGATTAAATCACGTTCGACTTCCATGCAAGCTC AAGTACAAGATCTGACCACAGGACATAGTATGTCTCTTAGTTTTTTGGTT GTTTGTTTTTTCTGGTCATTTTGAATGCATTGCTCCCTTTTTTTATCCAG TAATTCAGTTTTCAATTCCGTTAACCTTAGAAGATCATTTCCTCTACTTT ACCATTACTGAATTCAATAATTCCAAATTATTTTAGTTTTTTTATGTTAT TTTGATTCATGCCGTCCGTATGAACTAGAATTATCAGCCAAAACTTCTAA AAATTCAGAAAATTGATTTATCAAAATATAAATGATTGTTTTCTCGAGCA TTCAAAATTTCATTCATTGTTTTTTTTCTTCAAACTTTCAGGCAAACGAT TTGATGTTGTTGAGAACAACCTAGCACGTGCAACACGCTTCCTTGATGAA CTCGATGGCCTTTCCAGTTGGATGAGCAAGACAAGAGATTTATTGGAAGG CCACAAGGAAAACAAACCGGGATATAATGTCGACCCTGAGGTATTGTTGA CATTGTTTTTTTTGACTCGTAACTCTTTTTTTTCTGATGATCTTATAAAT TTTAATTAACTCTGATAACTGGAGATATTGGTCGTGAGATCTTTCAAAGA ACCATGAATTTTCTTAGTGTTTTTAATTTAAAAAAGGAATAAGCACTGTA TTAAATGAATGAACCTGAGAAATATTATCTCGCTCAATTTACCTTGATTA CCCTGATTACCCAGATCACAGCGATCCGCCAGTCTCTCGTATCTTATCGC ATCAAGCCTTTCATAATCTCAACAATTTCTCTCATCACAGATCATGAAGA AATCATTAGAAACACGTAAATGCAACGTTCTTTCCATCAATGACCTTTTG AAAGACTTCAAAGCTGAAGGGGAGCTGGCGTCTGGGAATTTCCCACAAGC CGTTGGCGAGAAGATCGGACAACTAAATGTCGACTGGCAAATCATTATAC GTCTTGCGCTAGCGCTTAAAGAACGACCAGTGTCGGAAGAAGTCGTCGTC GCAGAGACTGTTCAAGAACGTCAAGACGCTCCCGTCACGTTTGATTCGTT ACAAACCAGTTTATCTTTCACAACGACTGAAACTTCAAAATACAAATATG AAAGTAAGAGAATTTTTCCCAAAGTGAGTGTCTAGGATAGGAAATCTTGG TCAAAATTTTAATGATACCCTCGGACACCCTATGGTTTTGATCATAATTC ATGTTATGCACTATTGCAATGTCTTCTGGTATTATATCACGGACCCAATA GCTGATTGGTTGTATACGTAAAATCAGTCAATACGTCACTTTCAACCAAT CAGCTATTGGATCCACGGAAGACATTGCAATGGTGCATAGCATGAATTCA TTCAGTTAAGCCGTCTGTAATATTTGTACATTATATTGTATCAATTAATC TGAGTTGCTCGTATTGTCTCTTCTTAGCAGATTCATTGGTAAAAATAGAA AAGCCCGGGAAACAATTAATCTTAAGTGATTTCCTAACAGTATCCACTTC CAGAAGCAATAACACCAGGCCTTCAGCGATTCGAAATAAATGGTGGTGGC TCGATCTAATACGCTTCATTGGAACTCTGCGATCCTTTCTTGGTACTTCA AATTTGGTTACCCATGAGTCTACATGGGCTACCTTATCTTTGAAAAAAAT GAAACGATAGGTCGCTTTTGTCGTAGTGCGTTTTATTACCTAGTATTATA TATGCTTATAATAAAAATCAACAAAAAGTCATCTAATTAGACCCATCATT ATCACTTAAGATTGTTTTCAACGGTAGGAGGTAGTTATAGTAATTATTTA AAAAAATTTTTTTCCCTTTTACAGTGTATTCTTCAACGAACGAGAACAGT ATCGGTGGCGAAGGAGAGACGGCTCAACTACACGATTGGTTGAGATTGGT CGAACAGAAAATCAAAAGTCTGAACGTTACCCTTGGTGATGAAGATGAAA TGGCGGCTGCCGTACAAAAACAAAACGTAAGTTGGTGCTGATTTATGGGA TTGAAGAATTTTAAAACCCTTTTTCATTAGGTCTTGTATTGGTTCAGTGG ATCCTCTCTGTGTCAAAGATTTTTATAAATTGAAGTTTGGAATTTCTCTT TGAATCTACCTTTCAAAACAGTCCTTTCTATGGGCGAAAGTTTAAATTTG AAAAGGTATTTCAGCTGACAACGTTCTTCCCTTTTTCGTTCTCTGCATTT TAAAGACTATCATGTCTAGTGTTTTTACAAGTTCTTTATAAATCGAGTCT CGTCGGTTTGTCAAGCCCTGCTGTGATGAACCTACCGAGTTAAACTATCG GTCCTTGATGAAATAGAGAGAGATCACTGTACAAATATTTGACCAATCAA ATTGGGTTTAAACTAGTCATAGCTTTCACTAAATGCCCACGCAGAAGATC ATGTCAAGCACTTAAAGCTTTTAATGCTTTAAAGATTAAAGTAGTAAAAA TAATCAGGAATAATTGATTGATTTAATTATTGAATGATTGATTAATTAAT TGATTGAGGCATTGTTTGAAAAAAACATTATATTCCATTAACACAATAGA CCTTTTTTTAAAGAGGCAGCCATGTTGAATAATTATGTACTCCAGCATAA AAACAATGATACAGCCATGCATAATTTTTGAAANNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATATATTTCAAAA ATTATAGTATCATTAGCTTACTGGTTTTCACATCTTGTTTGTTTTTTTTC TCCCAGTTTCTTTCTTACAACAATATATGTCATTATTATTATTATTCACA ATAGACCTTTTCTGATAATGCCGCAGACATCTTAGATTGTAGGCAAAATA TATAGCGGTGACTGAATAAATAAAAAAGGCAACCAATCAGAAATAGCTTG TTTTTTTTTTCATTGGCTGCTATAGTTCAACATTTCTCTGTTGCTACTTT GCCTAATAAACAATAGTCAAGAATACTGCGTATAAAATTTATCAAAAAGT TCTGCGCCATCTTAAATTGGGTGAAATAGAAACCAATCCTAGTTAAGGCC CGGGCTCCACTTGCGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACTAAATTACAGTAGTTAG TATTCAGTTTCAAAGACAAGAAACTAAATTTGACATACCAAACACTTTTT CCAGTCAATGAATCAGCTCATCATTATAACCTTCCATTATAACCAGTCTG CCATTTTGTTTGTTTTGATTCGCACAAGTAATATTGTAATTTGTGTTATA TCATACACCTGTTATAATTTGCATTTATAACACTNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNCTATGAGTGCCTCCTCGTCGCTGCGCTCCTGCGGGGGCAAAAAATTTA GTCGGAAGAAAAAACTTTAGAAATTAGTTAAAGAAATTGAAAAAATTTGT GATTGTGGTGACTTTTTATTTGGTTTTGAACATAAAGAAATGGTACGTCA GCAGCCCTCCGAAACACTTCAAACATCAGGTAAAACTAACTAAGAATCAG AATATGTCTTTTCCACGTCTCTATAGAGGACGTTACCAGTCAAAAATAAA ACCTCGAGCTTATGAATCTTTCTTAATTCTATGCTTGCGTCGATTACAGC ATCTCAAATTCTTCTGAAATTTGGTACGAAGATTTGTCAAGATTTTAGCT ACTGTATTGAAAAAATGTTTTTAAAATATTTCCGGGACACCTACTAATGG TTGCTAGTCATTTTAGGAAAATAATGATAGCATGTACCAAACTTTTCTTA ATGTCGTAAAGGAATGGTCAAAAAATCTAATTTTTTTTTAGATTCTACAC GTTTTTTTTTTTATTAGAACCCAGTTTATAAGAACATTCAGGCTGAAATT CGTCGAAAAATTAAGAACGTCGCAAGAACATGCCCAGCCTCAGTTTGGAA AATAATGACAAGAAACTACAATTTTTTTCTCTTTTCAAGCAGTTTCAACC GAACTTAGAGATGGGTTTTCTAAAATCGAGAGTCAAATATTGTCCAAATT TTACCAATTTTAAGTGCTCTTTATTTTGCATGATATTGTCGATTTAGAGT AGTCTGAGAAATTAAGAACGCATTTAAGAACATTTTAGGCTGAAAATTGC TTAAAAAAAGCACATCCAGGCTCAGCCAAATTTTAGGTGTTCTAATAAAC AAAAAACGTGTACTCGATAGCCTCCCCATAAACCAAAAGTAACTGTGAAT ATTTAAAATATTATTACCAAACGAATCTTTAAAAATTAATTCTTGAAAAA TATCATTTTTGATGACGCAAGTTTTGATACTATTTTCATTCAGTTTTCAG TCGATATAAAGATTTTTTGACAGGTTACACGCAGTGTCGGTTTTTCTTAA CTCCCCTGTCACGTAGAAGGATCATTTTCTTTTTTGGGTATCAAATATTT AAGAAAAAGATTGAAGAATTTTGGAGAAAAAAATACTTTTGGGGTTTATC CATGCAGAGAGTTTTAACAAAAATATCCATATTTTGTGGGTATATGTTAG TTTTAAGGCGGTACCAAAAGCAAAAGGTGTTTTTTTTCTTTTAAGTTTTA TTTGGATTTTTCTCACCCTTCTCCAAAAATCTTTGACGATTCTTGTATTC ATTACTTATTTGTTCAATCATTAAATATTGAAATCTTCATTTTATTTGTA AAAGAATTTTGATAAAATATCATTTTGAAAAAAGGTTTATATAGCTGTCT GTTGTATGCCGGAGAAGGTTGTTTTTTTATTTTGAAAAGCTAAGCTTTGG TTTATGAGCGACCATAAAGCTTTATAATTGATCGATCGGTAAGAAATCGG AATCTGAGACTTGGGCCATTGGAACCTTATAAGGCTCTAAAAAGGATTCA TGACTTGAAATCGATGGAAAATTACCAATTTTATATTTTCTTCCAAAAAG TACACCAAAAACTTGTTAGGGAAAAATTGTCTGAAACCTTTAGACTTTGA CACTATAAATTTCATTACTGAACTTTTTTCATACCATAGTCCATCCAATT GGAGATGTCAAACCGACGTAAAGAATATGACGACGCTATTTCCATGGCAA CCACGTCACCACAAGACGACGAAAAGATTAACAAGTTGAAAGAACATTGG GAAGGAGTATGGGGCAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGC TCTGGGTAAGGCATTCTTACACTTTTGATTCCGAATAGAACTCATTCATC CGTTCGTTCGGCTACGTCAAATGCACCCCTGTCTCACAGCCTCGGTAAAA CTTTTTTCCTCACTGGGGATAAATTCCTTTTGAAATCCCAATGGGGATAG AAATTCTATTGTAAAAATCCAGTGGATATGATTTTGGAGTACAATTTTCA AACATTGAAATTTCGAATAGGGATAAAATCAAAGTCAATTTCCCAGTAGG CTAAAATTCAAGGGTATCTTCCCACTGGGGACGAAATTTTGCAAAATTTT CCAGTGGAATTTTCTTGGGTCCCAGCGGGGACAAATCTTCCTTTGTTTCA AGCGTGACTCTTACTCTAGTAAGGCCTAAAAGTCTTAAGCTGTCNCGGAG AAGGTTGTTTTTTTATTTTGAAAAGCTAAGCTTTGGTTTATGAGCGACCA TAAAGCTTTATAATTGATCGATCGGTAAGAAATCGGAATCTGAGACTTGG GCCATTGGAACCTTATAAGGCTCTAAAAAGGATTCATGACTTGAAATCGA TGGAAAATTACCAATTTTATATTTTCTTCCAAAAAGTACACCAAAAACTT GTTAGGGAAAAATTGTCTGAAACCTTTAGACTTTGACACTATAAATTTCA TTACTGAACTTTTTTCATACCATAGTCCATCCAATTGGAGATGTCAAACC GACGTAAAGAATATGACGACGCTATTTCCATGGCAACCACGTCACCACAA GACGACGAAAAGATTAACAAGTTGAAAGAACATTGGGAAGGAGTATGGGG CAAAGTCTTGAACAAGAAGTCACTTATTAACCAAGCTCTGGGTAAGGCAT TCTTACACTTTTGATTCCGAATAGAACTCATTCATCCGTTCGTTCGGCTA CGTCAAATGCACCCCTGTCTCACAGCCTCGGTAAAACTTTTTTCCTCACT GGGGATAAATTCCTTTTGAAATCCCAATGGGGATAGAAATTCTATTGTAA AAATCCAGTGGATATGATTTTGGAGTACAATTTTCAAACATTGAAATTTC GAATAGGGATAAAATCAAAGTCAATTTCCCAGTAGGCTAAAATTCAAGGG TATCTTCCCACTGGGGACGAAATTTTGCAAAATTTTCCAGTGGAATTTTC TTGGGTCCCAGCGGGGACAAATCTTCCTTTGTTTCAAGCGTGACTCTTAC TCTAGTAAGGCCTAAAAGTCTTAAGCTGTCTATTGAGTAGACTACTGAAG GCTTTCTTATTCATTTGTTTGGCTAATCTCAAACGCATTATGCTTTAAAA AGTCAAAAGCAAACTGATTTCAACAGCGCTTAAGAGAATTTCCTCATGGA ATTTGTTAATCCGAAAATAGATTTCTGAATTTTTTGCTCCAGGATTAATC AAACGAGGCTTCTGTAGACTCCTATGTCGTCTTGTTTGCATTTCTATTTC CGCTTTGACACCACAGGCTTGTATGTTTAGGATTAAGGCTTTCAACGAAC GAATAGCTGAAGTATAAAGTTTGATATTCTGTCTATCCATTGATGAGTTG AAATTGTGATCTCAGTGATAATACACAAAGATTTTTGTTGCTGTTTTTCA TGACTTGCATCATGTACTAATTTCATGCTAAATCAAAACCAATGAGTTGT TTGTAGTTATACCTGATTGATTGCCCTTTTAATCGTTTGGGTAATTTTTG ATGAATTGATTGAAGCTAAACTAACTAATTTTTTTTTTTTTTTTTTGCTG ATTTCTCTTAATTTCTTTTTTTTCTCTCTCTCCATACCTCTAGTTGATTG GCGTCGTTACAACGAGTTGCGTTTACAACTTGATAATTATGTGTACAAAG CCGATATTCAATTGAACGAAAACCAACAGATTGGTACTACCGTCACCGAA CTAGAAGCACAACTTGAAAAACACAAGGTGAGTAATTTTGTACTGCACCC TGTTTTTGTTCGGTTTTTGTGTTTTTATAGCGAGTTTATGTATTTGCACT TTCGAGGACGGTGGCAAAGCGACTGAAGCGATTTAGAATAACCTAACCCG GTTCTGACCCATAAAATCGAGGACGGTAAAAGTGCTGATTTACCATCGTC CTCAGTTCAGTTGATCAGGATCTAAACAAATCAGAAGCTAACCGTCTCTA TTGCAGAAAAATATACAAACATAAACTCGCTTACATCATCAGGCTGTAAA TTAATTCTGGATAAAGATAAGACTTTTTTTTCTGTGGAGAATCAGTGCAC TCTTACCTTCTTGGTAAGCTTAATATAAAACATTCCAAAAATAGTTATCG AATTATGACCTAATGCACTCGTGTCATTTATACTGAAAGAAAAAAAACCA CAAAGTCTTAATATTAAAGAGATCTGGGTCTGAACTACACTTCTCTATCT TTCCAAGCACACTCTTCGGTAAAATCAAGTTTGGAAGAGAGGTTACTACC AAGCAGTGTTGAAATCTTCTCTATCTTTCCAAGCATACTCTTCGGTAAAA TCAAGTTTGGAAGAGAGGTTACTACCAAGCAGTGTTGAAATCTACTCTAT CTTTCCAAGCATACTCTTCGGTAAAATCAAGTTTCGAAGAGAGGTTACTA CCAAGCAGTGTTGAAATCTAAACTTGATATCTTTCTATCTGATTCACTCA GAATTTGTTTTCCTCAGGACGAATTAAGAATTTAAGAGTTGTTGATGTCT TTAGACAAAGTAATGCTATGATGGTAACCTTTGGTGGATTTGTTAATTAT TGCATTTCTTGCGTATTTCCTGCTTATTGAGACTTAAAATATAAAAACTT GCTTTTAGTATTTTGGCAGTCGAAGCCTTACATGTTCGTGTATACACTTT TTTTAACAGAACCATTAACATTTTGCTGCAGCTTGGCTGTTCTTATTTTT TTGTCACTTTGAGCCTCAAATTTTTCTTATCCTGCTCTTATTTTTTGGAG ATGTTGAGCCGTATTGTTCTTATGAAAAATAAAGTGTACTATATATCTCA ATGTGGGGGTCCTATTTTGGAAGTCCTTCAAATGTGTTGAGTCATTTTCT GAGCAAAGATACCAGCTATTCCTTTGATTTGGACTATGTATCACCTCTTT CGCAGATGCTTTAACTATTATCAAATGTCATACCAGCAGACAAGATTTTG TTCGGAAACTCGAACTCCCTTATCATAATCTTGAGCTCAGCTATATCAGT TTCATTGTTCCAATTTTTCGTCTCCCCTATTATTAGTATAAAGTNCTGAT TTCAACAGCGCTTAAGAGAATTTCCTCATGGAATTTGTTAATCCGAAAAT AGATTTCTGATTTTTTTGCTCCAGGATTAATCAAACGAGGCTTCTGTAGA CTCCTATGTCGTCTTGTTTGCATTTCTATTTCCGCTCTGACACCACAGGC TTGTATGTTTAGGATTAAGGCTTTCAACGAACGAATAGCTGAAGTATAAA GTTTGATATTCTATCCATTGATGAGTTGAAATTGTGATCTCAGTGATAAT ACACAAAGATTTTTGTTGCTGTTTTTCATGACTTGCACCATTTACTAATT TCATGCTAAATCAAAACCAATTGAGTTGTTTGTAGTTATACCTGATTGAT TGCCCTTTGAATCGTTGGAGTAAATTGTGATGAATCGATTGAAGCTAAAC TAACTAATTTTTTTTTGCTGATTTCTCTTAATTTATTTTTTCTTTCTCTC CATACCTCTAGTTGATTGGCGTCGTTACAACGAGTTGCGTTTACAACTTG ATAATTATGTGTACAAAGCTGATATGCAATTGAACGAAAACCAACAGATT GGCACTACCGTCACCGAACTAGAAGCACAACTTGATAAACACAAGGTGAA TAATTTTGTACTGCACCCTGTTTTTGTTCGGTTTTGTGTTTTTATAGCGA GTTTATGTATTTGCACTTTTGAGGACGGCAGCGAAGCGACTGAAGCGATT TGGATAACCTAACCCGGTTCTGACCCGTAAAATCGAAGACGGTAAAAGCT GCTTGTTTACCACCGTCCTCAGTTGATCAGGATCTAAACAAATCAGAAGC TAACCGTCTCTGTTGCAGAAAAATACACAAACATAAACTCGCTTATATCA TCAAGCTACCAAACTTATTCTTGATAAAGATAAGACTTTTTTTCTGTGGA GAATCAGTGTACTCTTACCTTCTTGGTAAGCTTAATATAAAACATTCCAA AAATAGTTATGGAATTATGACCTAATGCACTCGTGTCATTTATACTGAAA GAAAAAAACCACAAAGTCTTAATATTAAAGAGATCTGGGTCTGAACTATA CTTCTCTATCTTTCCAAGCATACTCTTCGGTAAAATCAAGTTTGGAAGAG AGGTGTTACTACCAAGCAGTGTTGAAATCTAAACTTGATATCTTTCTATC TGGTTCACTCAGAATTTGTTTTGCTCAGAGCAAATCTAGAGTTTAAGAGT TGTTTTTTGATGTCTTTAGACAAAGAAATGTTACGATGGTAACCTTTGGT GAATTTGTTAATTATTGGGTTTCTTGCGTACTTCCTGCTTGAGACTGAGC TTGAGTGGCTGAAGGAGGAAGTGTTTCTATCATTAAGAGCTGATATTTAC ACCCTTTAAAGCATGGCGTTCTAAATCTTAGAACGCTATGCTTTAAAGGC ATGCCATTTTACCGATAGGCTTGCATCAGTGTAGTGGTTTGTTGTGTCTA GTACTACTGATTTTTATGTAATCATGTTGGTTTTTCTGAGAATAGAATGA ATATTATATACTCTATTTCCTATAAGAACATCCAAAAATTTTAAAACCTT TGGATTTTCTTAACCGTTTGAGATTTAAGCATGAAAATGTATTTATATAT TTATTTTTTTATCATAATGTATAAAGTGTTATAGGTGTAATTGTGGTGTT TTAAGTGTCCATTAAGCCTGAAAACATTCTTAACTTGCTTTTAAAGTCTG TCCAGATATAATTGGCAGTGGAAACAAGAATGCCTGTAACTTTTGATAGT CAAATATAATTATGGAAGTTTTTTTTGCTTGTTTTAGAGAATCAAAAGCG CTTTATTTGAATGTATTTTTGGTTGAAAAATTCGCGATTTTTAGTGGTTA AATTTGCGATTGCAAAAATTGAGCTTTTTTTCTACTTATGCTATAATGTT CATTTTTACACCAGTGGTAGTCCAACCTTAGGTTAAGAAGTTTGACAAAT TTCAAGGCAAACAGAAAAGTCCTTCGGAAGATATGGGACCCGAAATACCC CTTGGTAGCGCTTTTCTGTGAAATATCAAATCTCCAACTTATTACTAAAA ACGGGGGTAGTGATATGATTGATAAAACAGTTTTTCGATCCTAACACATT TTACGATCTTTTTAATGACCTCATAGCCAAACTGTGTTTAGTGTTTTGGG AATTAGCAAAGTTCTTTAATGACTTAAAAATAACAAAGGCAATATAAGTT CATGCTTATCTTTTCAATAAAAACAATTATACTGTGATTTCACNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNGCTGCGTTTAGACCAGCCTGGCATTTGTA ATTACTTGCAGTATTCTTTTGAATTCTATTGTTCCGTGCAATTGTTCGGT TTGTCAAATGCCTAATGATGCCAGCTTGTTGGTATTTCGTTGGCCTTTGA AATGCCATTTTGAGCAAAGGAATCCCCTTTTCTGGCATTTCAAATCAAAC AAAGGAACCAAAACAAAGAGAAAAAATGACATTTTTGATTTTTTANNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNG GAAATTCCATGCTTTTCATTGTTTGATCTGTCAAAGTTGAACTTGAGGGA ATCACCTTTTCAGTAATGACTCTAAAAAGACGATTCCTTAAATGCCATGA CAGAAAATACAATGGAAAAGCTATTAAAATTGAATCCCTCATGAGCAAAT GCCAAATTACAAATGCCAGTTGGTCTAAACGCAGCCAATGCAACACTTAA CATTTTCCAACTTTTAATTGCATTGTTCAAAAAAGATAACATATAACCCC CGTTTTTAGTAATAAGTTGGAGATTTGATATTTCACAGAAAAGTGCTACC AAGGGGTATTTCGGGTCCCATATCTTCCGAAGGACTTTTCTGTTTGCCTT GATATTTAACAAACTTCTTAACCTAAGGTTGAACTACCACTGGTGTAAAA ATGAACATTATAGCATAAGTAGAAAAAAATCTCAATTTTTGCAATCGCAA ATTTAACCACTAAAAATCACGAATTTTTCAACCAAAAATACATTCAAATA TAGCGCTTTTGATTCTCTAAAACAAGCAAAAAAACTTCCATGATTATATT TGACTATCAAAAGTTACAGGCATTCTTGTTTCCACTGCCAATTATATCTG GACAGACTTTAGTATTTTGGTAGTCGAAACCTCACATGTTCGTGTATACT ATATCTCGATGTGGGAGTCCTATTTTGGAAGCCCTTCAAATGTGTAACTT TAACAAGTCATTTTCTGAGCAATGATACCAAATATTCCTTTGATTTGGAC TATGTATCACTTCTTTCGCAGATGATTTAACTATTATCAAATGTCATACC AGCAGACAAGATTTTGTTCGGAAACTCGAACTCTCTTATCATAATCTTGA GCTCAGTGATATCAGTTTCATTGTTCCAGTTTTTCGTCTCCCCCTATTAT TAGTATAAAGTGTAGTATCATAGTCGGTATAATTTTCTGATACCGTTTTA GAGTCACTATTACATTGTGGTTTAACAAGAAAAAAAGTTACGTTTGAGGG AGCTTATTTCATTAAAAATACCTGTGATTTAGTTATGATTTGAGTACATT TATGGCTGAAAACATTTCTTGCTATTGGGCTTAGTACTAATCTGGCTTTT TGATGCCATTTTTGCAAGTTTGTTTAGGTTTCTTTCCTGTGTTAAGTACT AATAGCTGTCTCTGCTTTGTCACATCAAGTCAAATGTTATTTTATCTGCA AGTTGCGAATATCTTTCGTTTTGTCAAAATTTGATTTTGCATTCAATTTT TGATCTCCTGTGCCAAGGTTGCTGTTATCTTATTCGACTCGCTACTATTT CTATCGTTCATAACTCAAATAGTTTCTAGGTTCATAAAGAATTCTAGTAC AGTTGACGCTCTCTAATTCGATTTTCAAAGGGAATCGAGCTTCAATCGAA TATCCCTATACGTATCGAATAGTAGAGCGTCGTTTACGAGTGTTTCTTGT TGACGTTAACTTTCAATATTATCGAATAATGGAGCGTATCAAAAAGTAGA ACTTCGAATAAAAGAACATCAACTATATCTGCAAACCTTCACTGCTTCTA AATATAACAGGAACAAAATCATCTAGCTTTTCTCTCTCGGTTTACCCAAA ACATTATAAATTGTCAAGGGGAATGATTTTGAAAATTCGCTTTTAAGAAG CAATGGCTTCAGCTCTAAACCCTGTGTTATGCCATAAAGTTAGCATTGCT TCACAGATCAAAATGCTTCTGTTTTGATGTTTAATGTTAGTCGAGACATC TTACTTATACCTAATAAAACATGAACTATGATTTTTAATACATTACTTTC CTTATGCTAATTTAAAATTGAGTGATATACAGCTTAAAGTCATCTCACAA AATAGGTTTTTAATACGCGGATCAAATAAGCCTTTATAATGTGCATTGAT TTCGAAGGGCTTATCTTAATTCGATTTTTGAGATATGTCCTTCTTTTGTG TGAATGCTCTCTGATTTCAGTTAGTACGCATTTTAAAAATCTCAATTTGC TATTTAGAAAAACCCTTGATAAAAAGGTTGTCTGGTCAAATAATTGATAA AGACACGATTAAGTCGTTCTGTTGAAAAGCTTACGAGGAGCTCAGTTTAG TTTTAGTGGATTTCAAAGATCTCCTTCTCTCATAGATCACTTGGTCAAGT ATTGATCAAGAGCTTGTCTTGTTCGCCGAAAGGTTCTTTTTTGTTGTGAA ATACTGTCCATCGCAGATAGTTGTGCAAGAGTGCAACAGAAAAAAAGTAT TAGCAGACACTCAGACAGACAGACAGACAGACAGACAGATAGACACAGAC AGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAG ACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGAC AGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAGACAG ACAGACACACAAAATGTTCTGTTATGGTCTGCGAAAAGAGTGTTGTGGAA ACTTGTATTCATATAACTTTATTTCTTTTCCTTTTCAGAAATTCCAAGGC GAATTATCAACTTGGGCCAACACTTACAATACTTTACGACAACTAGCTGA AACCATTTTGTCGACGTACGTCAACGAGGATTTGAACGACTTCAAAACGA CTGTCAACGAGACCAATACTCGGTGGAATAGCTTGGAAACTCGGTATGCA TCTTTTATCCTTGTTTATTCTATCTTTTTTGAACAAATATTTCCTTTAAT ATGGAGAAGGTATACCCCTTTTATGAGGCTAAGATAAAATGTTTGGAGTT TGAGAACCCAGTGGCTTCAATTGTTGAAAGATCATTCTGGATTGAGGTTT TCACTAAATGATTTGTGTGACACTGAATTTCGTCTCCCTTGCCCGGTACC GTTAGTTGGTCTAATGTCGACATCCCTCTTCTAATTCCGACACCCAGTTT TCGAGATAGGAATAATAGTAAGGTCTGAGTCACTGATAGATAAAAGATAT TTTCCTCTCTGGTTGCTAAGCAAAGAAATATAGCTTCTATCAGCGATTCC AACCTTCCTACTATTCTTACCTCTAAAAAAGGGTGTCAGGATTAGAAGAG AGATGTCGACATTAGACCAAGTTACATTACCCATCCTGGTCTTCCATTCG CTAAATAGAAAAGCCTCTCATTAATCTTCCGGATTTATGTACCTCTACGT GTATAAAAATTCCAGTTATCAAGTGGAGAAAAAATAAAAATGTCGGAATC TCTGACATGAATCTTTGCAATCTTGTTAGATACGAATATTTAATTGACCT TCTGTCATTTTTAATCCGTGTAGATAAACCATTGTCTAGTTGTCTGATCG GTTCTTGGACTTAATGTTTTTTATTATAATTTTGATTTTTAAAACAACAT TTTTGGTCTTTCTTACCCGTTTCAACTTTTCTCCTTGCCGATGTATGAAC TTGAATTGATACTTTTGAAAAAAGCTTGTGATAATTCTATTGCAAAATTG CGTGTGCAGCCACTTGAATTCTCAAAATAGTGAGTGAGTGTTCAAAGTTT TTTCAAATCTCTTTCTATCACACCGAAAAAGCACTAGAAACCTGCATTTT GTTGATTCAACATATTCCGTGACTTCTCAAGAGTTCTTAACAAAGAAGAT TAGCCTGTACCTAACCAGAGATGGTCACGACTTAAATAAGATTCATCAAA CAACGATACAGGCTTGAGAACTTTTTCAAAACTTGATTCGCCTTTTGCTG ACGGGTTTACTGATTGACACAAAGTCTTTTAAACATTCATAAAACGTCCA TACGAGCCGTAAGGGATTTAAAACTTCACACAGAGGCTGTTAACAGACTA CATGTTTTCTCGGCAGGCAGTTGTTTTCTTTGATGACAGGTACATCATCA CTGGTTAATTGAAACACGATTTCTCAACTTTTCGATTGATTGTTTAAGAG ACTTGGTGCGAAAAGCACGTGGTTCATTTATTCGTCCGCCTCGTCTAAAT TTAAAGTCTTTTCACGATATGTAAAAAACGTGAATTTCAGTTACGGTTTG GCTTTCAGTTACAGTTTGGCTTTTAAACTTGCTGAGTTTTTTCGGAGATA CTTGGAAAAATGAGTAAACATATTATTTATGAGTTGGCTCTCCACAAAGA TTTTGACCCTTCCAAAATATAACTATTATACTGGTTTGTGAAGGCTATAA AACTAAGTCTTAAAAGCTCTCGATATATTGTATATGTTTTGTGTAGAGAA TATATTTTGTTGGACTACTGTAATTCGACGTGGGCAGAAGATTGACTGTA TCGTGAGAACGTGAACCAGTTTACCGTGAGAACTTTGTGAATTGAATCAC CGCAAACGTTGCCAACTTCTCTGATGAAAGTTTACTTTATAATTTTGTAG AGTTTGCAGAATTCCTTTTGGAGTGAGGACAAAAATGACTTCGTGGTTTT GTTGTGTTTTTTTCCTTTTCTTACAAATGATACAGACCTCTCGAGTCTTT TGGCATCTGATGGTATCTGAAAGAGTTATTTTTGCGTAATATCGGTTGAC TTTTCCCTCCCCCTCTGCTTCCTTCTAGAGGTATTTATATATCTACTTGA TAGACATTGGAAAATTGGTTTGAATCAAGTTTGAAGTTGAAATTGAAGTC GTGTACTGTAATATTGTTTCAGATTAGTTTTTAAAACATTATGTAGTTTT TAGTTTGTTTTACTAGAGTTTGGTTTGTGCTCAGGTCTCAAAGTCTTTAA AATATTTTCTCATGGTTTTTCTAAGATCCATGAGACTTACAAAACCTGTA TGAAAACCACAAAACTAAATACCAATGGTTTTTCTCCTACTTGTGTTTCA TATACCATATAAAGGATCTTTGTCTTTTCTTTTTGAAAGCCAAACATTCT AACTTGTTAAAGTTTAGAAAAACCATTAAATACTTTAAGCTTTGGTATAT ACAGTTTCTCTCAGCCATACAAAAATGGTAGTACTTGGCTGCTTTCTGGA CTTTTAGTTAACTTAATCTCAATTGGTCACCTAATTTTTCCTTTATCCTG GAAAAATTAGGTGCCAATTGAGATTAAGTTAACTAGAATTACCAGTTAGT TGATCAATAAGAGAAACCGAAAATCAGTTTATGAATTTTTCTTGGGAGTG CGGTACTTGCTTTTACAGAACGGGACATCGGAAAATTCCACCATGCTTCC CTGTTATGATAGTTTTACTTAACTTGGTTACTTTCCGCTTGGTGCTGTAA AAATCTTGACGGGAAGAATGACGTTATGGAAATGACGTTTATTGTAGAAG TGGTACCCTCGAGAAATATTTTTTTCGTTGAATTTAGCATTGTTTACTTT TCACTCTAATAATTGATTAGATTGACATTTTGATGTTATGTTTATGTTTT GTTTGTAGTAGTAATGTATTTATGTTTCAAAAGGTTGCATTGTTATATGA AATCTCGGCAAGCACCGTTCTTAGTGACTCGATTGCTTGTTAAACTGGGT CCAGTTGTCTCTACTGATTATACTTTAACAAGAATAGTTAAGTTTGTGGA AGAAATACTTTTTTCAGGCAAATAAATTGCTTTTCTTATGATTCTCAGTA TCTTAAACTACATCTGTTCACTTTAAGAAAATTGTGGTTAATTTACTATC CAGTCAATTTTTGTCGGTCAGCCGGGCTTTGTAACGATATGAATCTTGAT GACATTATAAGCTTTAAACGTATTAACCTTTTTATGATCGTCGTCTGGAA AGTGATTTCATTTTAGTTTGTATGAATTTTTGCATTTTGTCATTTCTGAT GATGCTTTTTATCATGATGCCCTTCAAAAAGCTTTTATAATACAGCTCTC TGTGTAATTTAACTTTGCAGTTATTAGCATATTTAGAAATTTTCTTCATC GAGTTTTCTCTTCCAGTTAGAATTCAGTCAGTTGACCAAGAAACACAAAA CGTAGAAAAAGCTCGAATGTCTTTAAAGGTTCTCCCGGTGATTGTGTAAC TGAACCATTTTCAATTTCTGGTATTTGAGATGTTCAATAGCTAAAGGTAG ATAGTGATAGAGAATGTTGTAGTAAGCACTGGGAAAGTGAAAGTATAGGG AAATTGTTATGTCGTAGTTTGTTTTCAACTCAAAAAATTATTGTTGGTGG TTTTTACACTTTATACCTGGTGGTTGTTGGACATAAGTTTTTGCAAAGAG AAAGATATCAAATTTTACTGTAAAATAACCATTTCTCAACAATTATTCCA TTCTATTTCAAATGGTTTTAATATTAGTATTGCGGTCATGGGGTCTTATA GATATAAAGTGTAGTTTTAGTACAAAAAGCTTATTTTGTCTTGGTGAAGG GCTTAATATGCAAGGTGCCCCAGTTTTGCTTGGATATAAATAATGAGTGA TTCTGATAGATGCTTTAGAATATCTTTTAATGATTTTAGTTTTAGACTGG AAAGTGCGAGGTTGAGGTAACACCATTTTAAAAGAAATGTTTACTAGTCA TATGCAAAAAAATGTTTCAACCTTTGGTAAACATTTTTATATTTGAAAGT TCAGAAGATATTTTAAAATAATATTAAAAAAAGAAATATATAGAATTAAG ATAAAGTTTGCGGAGAATCTAAACAATGGGTGAGATGTTATTGGATTATT CAATGGACCAATCACAGAGCGGTGATACCTCAATGCATGACGGGAAGACT CCGTCTCCGTTAATGCCCGGTACACACTTTGTCATGTTTCTATTCGATAA GTAAGTATCTTCGCCATTTTCTTTCAAGCATTGACAGGATTTTTCTCATT ATTTTTGGACAAAAATTTCGATTTCATTTTTCAGTATTCTCGAAATCGTT CGTTCTTTCCTTCGTTCGTTTCTAAATCAAAAAGCGAATCGATTTTTTAT GGAAACCTTAGACATTCCTGTGTCTAATTATTTTGTAACATTTCAACCAG CAGCTATGGTTGATACTCTAAAAGAAAACTTTGTGGTTTGATTTGATTTA TAATTCAATTGAATAATTTGTCACTTTAAGATTCCCTCACACCACACTGT CTTATTTATTTTTTAATTTTATAATTTATTAGTACTATTTTGACTGATTG CTTTTCCCCTAGAATATTTCAACCAGCCCTCATGTCATACATCGGGAAAG TTACCCACATTCTTTAAAATCCTAATATTTTTTTAAATTAGACTACTGAC CTTTAAAAAAGGACAAAGCTATATCCGTCATTTCTGATCGGAGTTTTTTT TGTATTAAACGGTGCTAGATCATCAAAAGTATCCAAGGGGGGGGGGGTAC ATCTAGCGCACTCGATGCATTTACACCGTTAGTGAAAATTGCACCTAAAA AAACTACAATCAAAGATTTTGGTTGGCCGGTATTGAGAAAGATCAGTGAA TTAGAACCTTAATTTCTTCAATGAGGAACTAGAGTGGTAAAAGCGGTGTT GTTTTTTCGCAAACGGGTATCCTGCACAGGAACACATCTTAACCTGTTCC TTAAGGTTTACAACAAAAAGAGATTAATCATAGTAAATAACATCCTTATT ACATATCCTTCAGCGTTTAAAACCATAGATTCCCTTTTTCTGGTTGTCAG TCCTCATCCTTGATGCACTTCCCGAAAAAAATTGAGACTCTTCTCTTATT CGACTTATGTTTCTTGTAAGCATGCAGATTTCTCACTAACTGAAGTTAAG GTGAATATGTTTGATATAGATGTACGGCCAATCTTAGCTCTGATTGGTAA AAGAGTGACTTTCAGTATACGATTTTTAAGATTCAGGATATGGCTTTTCT TGTTAATATGGCATGTTTCTTATAAAAGAGATGACAAGTATTCCTGTCTT GAAGTCCATTGTTATTTTAAGTAAACTCTCTGAATAGATCATCGGAAAAG TGTCTCGGTTATTTTTTTACCGTTTCATTACAAACTTAAACATAGATGAG GTATCTTTATCGGGAAATTATTAACAATAGAACGTCAAAATTTGTTTTTC GCGTATTCTTTCTTATAAGAACATACTCACAAGAACTAAGTTTAAGACTA CCGAGTGTTGAGTGCCATACTTTTTCGAGTGGCGTTTTTTAAGAACTAAA TTTAGTAGTATTACAATTCACGCTGCATGCCTTTAACATTGCACTAACAC TAACTGTGTCCCGTGAGCCCGTTTATGGATTGAATTCTCTGTCCGCAGGA AATGTCAATGTTCTTCAAATGTTCTTATAAAGTTCTTAAATTGTCAAGAC TCGACGTTGTTGCTTTTCCATAATGAAAACAAACTTATGAATACCCCGGT CGTCGTCAACTTGTTACACCTTCATGTTGTTGTTGTGTCGTTTTAATAAA AAGAAGGGTCATTTATTTTCGTTTGTTGAGACTTGACTCTAAGAGTAGTC TCTCCTTAAAAGTGAAATCAAACCGTTATTTAAAAGGGCATTTTAAGCAA GGCATTTTTTGATAGTTCGATTTTAATGTTGGTTTTGATTTTATTGATTG TATGAGTCTTAGTTTTCACTAATTCGTTTCTCTTCGTGATATCACCATTG CTGACCTTTTTGTTATGAACTGATTGCGTAATTATTATTATAACACACAT ACAAAATGAAGGATTATGACGTTTTTCGAAGAATTTAATGTGGTAACACA GTGGCATCGATAATATGAGATGAACATACTCATCCGAAATCTAGAAAACT CTTTAAAATTTTATAAACCGTTTTCAATCAAGTTTGTTTTGAAAAGTAAC TTTTTGTTCTCCTTTTGCAAAATATGCGTGTCTGCTGCCTTGCTGAGGCT TCTTGCTGTGAAGAAAAGAAAAACTTCAACCTTTTTTGCCACAACGACAG TGAATAGAAATAATCTTAAGATTTTTACTGACATCTTTTGTCTTTTACGA GGTGTCATACTTGTTAAATTGCCTTACGATACTCTTTCTCATATTTGCAA GAATTATCGTTTAAGCCAAGTTTTTTAAAGTTTAAAATTTCAATGAAATA GTGGTAAAAATCGCCGTAAATTCAATATATTCATCTGTCGTAAATATGCA ACTACTTGTCGATACCTTCGTACAGAAAGTCGTAAATCGAGTGACCAAAA CTCGATATGGATTCAAATTCTCGTAAGTATTGAAAATCTTCGTTTGAAAT CTGTTCATCATTGATCTAAACAAATTTTGCTGACAATCACTGTTTGATTT TGTCTCTGACTTAAGGGCTCTGACCATAGTCCAAAAATTGATTTTGGTAT TTGAACATAAAAGTTATATTTCAGGTTCCTTAACACTTTTAACAAAGAAT TGCCTTTATAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNCAAAAGTCTTCATTTTCTTCTTCATCAAACTTTTTCAAT GCAAATTTTGAATTTTCAGATTCAGGAATAGTTTGTCTAACAGAAAATGT GTAACATGCCATAGTTTTGTTGGTTACATCAGTCAGAAAACACATTTTAA ACACGGCAATTATGAAAAATTCACTATGGTCAGAGCCCTTAATGTACTCG CGTATATCTTCTGTCTGCTCTTTCTATCTATATTATGTTTGTGTCCTTTT CATTGATTTTGTATTGGTATTATTGATTATGGACTTTTACCATTGACTTC CAAACCCGAAGAGCTAGACTTGAGACTCCTGGATAGGAAATGAAGCCACT TATTTCCCATCCAGAACGCCCGTGCGTGGTTTTTACTCAAACGCCGGATC GAAAGTAAAATATATCACTAGATTTCAAAAAATGCAGTCCTCAAAAACAA AGGAACCGCTAGTTACAATCCTCCGTCATGATAGCGGCGCGTTCTAGACG CGTTCTGGATGGGAAATAAGTGGCTTCACTTTTTCTTGCCACTCTAGCCC TTCGGGCTTCAAACTCAATGACTTTTACAATGCTGTTTTTTCGAAGTTTT TGTCATGCTAATGAAAATTAGTGAATCTTACTCTTTTCGACGTGAGTCAA CGCAAAAAGAATCTAAATGTAGTGTGTCTTGAATGATATGAATCTCGAAT AAGGGAAAGTCTAATTGTTATGTTATTTTGCTTGATCGCAGTTTTTTAAG ATAACATATTTTTCGTGTTCTTAAAACAGTCGACATAAATATCCTAAAAA AATCGTCAGTTTTCTTATTTCCTTGTTCTAGTTTTTGTAATGATGTGGTT GTGGTGGTTAGAAATGTCAAATTTTTTTTTTATATAGATACGCCTTTTAG GAAAACTTAGTTTTCGGGTAATTTCAAGGGGATGAAATTTGGTGATCAAT CAAATGTTAAATCTCTTTTAGGGTTTTTAGGATCCTTAGACTTTCAGTAT TGTTATTTAAATAACGCTATTAATACACTGCTAATTTTTTTAACGTATTT TTTGAAGTTATTTTTAGCGAACGGAATGGTTCAATTGCCTGCGAACTAAA TCGTTTTGAATTTTATTTTGCTGGTGCTTTTGATTGATTTGATGAAATGT TAAATGAAGTATTTTTGCTTGTTGTTCTTAGTTGGTTTGTTACGAATGAC AGTTTCAACAATACGAACGTTCACACTTCATAATTTGATTGTCATATTTT CGGCATCGGTGTTGATGAAGCGTGACAGCCCTTGATAAATCAAAATGAAA CGTCTTTTTAACCTAAATCTTGCTCAATCTTTTTATTAGTCGGTCTATAA CCAACTAATGTCTAGCTGTTATTTATAGAATCTGTCTTTTAGGCCAAGTA GCTCATGAGGAGCGACTTATATTCTATATTATTCGTACTACAATCTACCT CAGGGTAAGAATATTAGAAAGTGCGTTTTTCTCAGATTTTTTTGACGTTT CAAATACATCTTGCGCGCTTTTTGATGAAAGTAACTAATACCCTTATCTT TAAAATTCGACGAAAATAAATCATATGGTATGTTACCAAATTGGACCGAT CAAAAAGAAAATACCTAATAAATCATATTACTTTTCAATCATCCCATGAA AAGCAGAATTGGTATATAATTGGTCAATTTTATGTAGAAGGAAACTAAAA CATGCATTGCACGTTGAACTTTGAGACAGATTGATTTACATTACAGACAT TTTGTACGTTCTCTCGCTTATTGGTGGAGATTAAACGGATAGACTTTTTG ATGTTAGTTTATTGACTGCAATATTCTATACTTGTCGGGCTTTTAAATGT TGTTTTTACGTCACAGTCTATTTTTATTGTAAATCTGGCTGACTCAAAGT TTTGATCATTTATTTTTAAGATATTTTTTTTGCTTTGGATCCTCTCTCTT CGCGCACTATCCGGGTTTTGGTAGTTGAAGTCTAGAAAGCATTTTATGGT GCTTAGAAGGCGCAAAAAGTGAAACATTTTCTTCGTGGCTAAATCGTGTG AACGACAATTTTTTCCATCCCTTCAAACGGCTAACCGGGACCCATGATTT TGAGTAAGATCTTTATACAACTCTATATTTCGGAGAAACTTTAGCATATC GGTAAACGTTTAGGAATCAAAAACTTGTGTGTATTCAATAAATACCATCG TGACTGACTGACTGACTGGCTCTACACGGGTAAAAATCACTACCCGCGTC ATAAAATGTGATTCTCAATGTATGACCTTTAGCCCGCCTCTAGCTCGATC AAAATAAAGATCTGCTGAACTCATTTTATAAAGTGATAAATACAATTTTA AAAAGGAAAAAAAATATTGAGCTTTTTCGTATCTTGTTAACGTACAAGCC ACGTTTTTAATAGAAAATTTTCGTGCGCATGTGTCGAAATTTCACTCACG ACTTATGTCCATTCGTTTTTTGACTGATAGTGGCGAATTTGAAGTTACCT TGTTGAGTTAGTCAAAAACCTGGAAAAACCGTGCTCTAAATAAGGTTTAG AATTCTAATATTGTGAAATCTCTTAGTGTTTGTATGATGGAGGATTTTGG GTAAGGTTTTTCTATTGTATTCACGTCTTTTTTGTCCACATTTTTATTGG TATGTTTTCGTTCATAAAGAGCACTTGATAATATTTTTGACGGTTAAGAA GGGGTTGTCTTTCTTTGGTTTGTTTTGGTCTAAAGTTATCTGTCATGAAA CTATCTAGCTCTTGAATTTGTTCACGCCAAGGGTTTAGACTGAATTTTAA CCGAAAAAAGTCTTTCGGAAGGTGGTTACGCTGTGTACTGTTCAGATGAC TAGCTTTCGTTTTGATCAAAAAGTTGCGAATTGCTCGGGGGGAGGGGGTT CTTTTTGTGTCTGTCATCCATGTTATTTTTGTTTTGTTTAACAAAAAAGA ATGAGTCAACGTTTGCGCTTTAAGAAATGACCTATTTTTGAAGTCATTTA TCATCGATATTCTTATGTATAACAATGTCTTTTTGTGCTTTAAATGACCG AGTCGAATGTTTCGAGAATTTTGGATTTGAGTTCATTTATAGTAGTTACT TTTTGTAAAAGGGGTTAAGCGGGTTTTACTTAGGTAGATAAGTTCTGTCA CAAATCGTTGCTGATATCGGGCGATGAAGAGAAAGTGCTTATATGCTAGA CTGCACATATTGTCGCATAAGATTATGCCTTGATGGTCGGTGTTGTGTCT GTTTTTGAATTTGAAATTGTTATATTTTTCCGTTGGAAACGCCAAAAATG GTGCACCTACCATGGTGATCCCACTCTTCGCATCCGGTCGAAAACGTTGT ATGGCTTTGTGACATGTTTGAACAAAATTGTAATATTACCTACCTATAAT AAACCTTCTCTCTCCACAGCTCGAACGCGCACCAAGATTCATTACAAGAA GCATTGGATCGCCTCTTACAATTTCACAAGAACATGATTTCAGCATTGAC ATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGTGG AGTCATCGCAAGCTGAGGATACTTCAAACGTGGATGAACTACAAGGTGAA ATGCAGGTATGCCACTATCCTTTTTGTTTCCAGACTACTGGGACTGGGTT TCAGATTACAGACAGGTTAGGATCGACGTCAAATATCTGAAGTCGTTACA TTGATTTTTTCATTCTTGATATGCACAATTGCAATGTCTTCCACCGACCC AACAGCTGATTGGTTGAAAGTGACGTATTGACTGATTTACAGAACGGAAT GTTCACGATTGACGATTTGTTACAATTGCNATCAGGTAGATAAGTTCTGT CACAAATCGTTGCTGACATCGGGTGATGAAGAGAAAGTGCTTATATGCTA GACTGCACATATTGTCGCATAAAATTATGCCTTGATGGTCGGTGTTGTGC CTGTTTTCGAATTTGAAATTGTTATATTTTTCCGTTGGAAACGCCAAAAA TGGTACACCTACCATGGTGATCCCACTCTTCGCATCCGGTCCAAAACGTT ATATGGCTTTGTGACATGTTTGAACAAAATTGTAATATTACCTACCTATA ATAATCCTTCTCTCTGCACAGCTCGAACGCGCACCAAGATTCATTACAAG AAGCATTGGATCGCCTCTTACAATTCCACAAGAACATGATTTCAGCATTG ACATGGTTATCTTCAGCAGAATCGAAAGTTGCAGAACTAGATTCGTTGGT GGAGTCATCGCAAGCGGAGGATACTTCAAACGTGGATGAACTACAAGGTG AAATGCAGGTATGCCACTATCCTTTTTGTTTCTAGACGACTGGGACTGGG TTTCAGATTACAGACAGGTTAGGATCGACGTCAAATATCTGAAGTCGTTA CATTGATTTTTTCATTCATGATACACGTTTTTTTTTTTATAAGGAACACG TTTATAAGGAACTCGAGGCTGAAAATGGTTCAAAAAATAAGGAATTGTTA AGGAACTGCTCAGGCTGAGANNNNNNNNNTGTGGATTTGAAAATAATGTA CCTTATTGGGACTTATTTGACCAAATTTNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNAAAAAAAAAAACGTGTATGCATCATTGCATAATGTCTTCCACGGACC CAACAGCTGATTGGTTGAAAGTGACGTATTGACTGATTTACAGAACGGAA TGTTCACGATTGACGATTTGTTACAATTGCTTCGAAATTTACACTCACTT TTTCATTCGAAATACTTAAAAAATTGGTTGTCTTTTTTAGGGGGTTCTTC ATCACTCATTGTCAAACTAGCAGTTTTTGCTGTAACTTTACCCCTTTTTT TATTTAAAGTAAAACTTTACGTCCAAAACACAACAGTGATTCCATTGTGA ATTCTGGAGTCTCTAACCTACAACCCCTACGCGATCCTCATAAGTCACCA AAGCCAATATTTGATCATTTCATTTCCTTGTTTGTTTAAGAATCTGATTA AAATCCTAATTTCTTAAAAGAACGAAACAATTATCAAAATGTCAATTGGA AACATTCCAAATCCTTAATCTCTATAAAAAAACACGATTTTTATAAATTC ACAAAATGGTGTTTATTTACTTTGTCAACTTTTTTTGTATTTGTTTTTTA ATATTTCGACGAGCTGCTTTTAATTTTCCATGTACTTTGAGTTAAAAAAA TTGGGTAATCCCTCACCCATAAGTTTTGGTCATCTGCCCTCGACTGTTTC CAAAATACGGTTAAGTTTCTTTAACTCGGACCTTTATAAGTCGGACCTTT ATAACTCGAATGTCTCCTTAACTCGAACAAGGATTATGGCCCCTTCAGTT AACAATGACTTATAAACCTTACTCCATAAATCGGAAATTTCCTTAACTCT AACAATTTTGTGTTCCCCGCGCGTATTCGAGAGTTATTGTGACTCCACAG TAGTAAATTTGATAACCTTCTATTTTATCAATCACTTGGTATAATTCGAA CCAACTGGGTCACATAATCACCCTTGTCTGTCACAATAAGATAAACTGTT TGCGCTTAGTTACAACTTCTTTCAAACATTCGCTTCATCATCATTGTTCA ATGTCCTACGCCAACGCAAAAAGTCTTCAAATTTCACGCTGATATTATTG GATTCGTTTATTCTTAATGAGACTTAACGAACGGAATTGGCTAATTAGTT AATTAATTCCGGAAAAGGCTAAACCAAAAGTTTTTTCTGCACCCACATTT TCGTCACATTCAGCTTGTGTGCCCCATAAAATCAACTAAAAAGTCTGAGG TTACGGGCTAACAAATTGACTTTTACACGTTGTTATAAGAACAAATTATA TCGTTTGCCAAAATATCAAGAATAGGTTAAGAACAATTCAAGGCTTCGTG TCCTTCATGGACTCTAAAACACCAAATTTCTTAGGAAATCGCAAAACGGT CAAAATAAGAACATTATAAAACATATTTTTAAGGTTTAAAACTTAAAATG TTAAGAACATCCCGAGGCTTCAAAAAATTTGGATGCTCTTCTAAAAAACG TGTATTTGTGACTCTTTATTATTTCTATAAATCCCCGTTACAGGAACTCG AAGATGACATTGCATCACATCAAGCCATGTTTAACGGACTCAACGAAACT GGCAAACAAATTCTCATGGATCTTGAAGTCGGCGAAGTAAGGACAGCTCT CCAATCAAAGTTGGATGATATGAATGATCGTTGGAATAGTTTAGGTGTTC GAGTCGTCGATATCAGGGATAGGTAAGACTTCAAAAATGGCAATTTCAGT AAAAACCTGGTGGTTTTTTTTATCAATTCATCGATTCTAGGAGTTAAGTA TTGTGCTTTGGAGTATAAAAAGGCGATCTTTTTAGGCATACATGTGAAGC TTCATTTTGAACGCGTGCGAATTCAAGTCTCGTGCAGAATAATGTTCTGC TAATAGCCATCACTCCTGTGTGAAAGATGATACAGCATTTAAATCATTAT TGAACCAAGCACCTTCCTGTTGGATGTTACAATGTCTTCTTCTTATCTGA TCAAACCACATATATTAATAGTAGGTTAGAGGTTGCGGATACCTCAAACA ACATAAGTACAGTCTATGTTTCCTGTTTCATGTTCTGATATAAGATTACC CATCTTTCCCTTCTCTCCATCCAACAACAGAATGTCATATGGTACTGGTG AATGGCGCCAATTATTATTGGACATGCAAGAGATTGTTGATTGGTTATCA AGAGCTGGACAAGAACTCATGTCTCAACAACCAATCGCTTCTGATGTCGA GAAAGTACAACAACAGAATAAACACCATCAGGTACCATTTTGAATTTACC TCATCACTGAAGGTCATATCTTATTCTGTATTTTTGGATACTCTTGACTT GATTTGATTTGATGTTTCAAATTCGCATAAAATAACGAGAAAATGTTTTT TTTTTTGCTAATATAGGTATCAACGACATGTTTTTTTTCGAATTTTCTTG TAGAGTTCTATTTAGATACGATTACAATAAGGTTATCCAAATACATTTAT TAGTCGCTGAAACTTACCAAATCTTTTTGCACTTGCAGGAATTCAAAGGC AAGCTGAACGCGCGACGTGTAGTCATCGAACAAGCTTTGGAACAAGGTCA CAACTTCCTTTTGAAACATCAATCTGCACAAGACGAATCGTTCATTCAAA GAGGAGATAAATTGGTCGTTCGCGTTGCAAGTAGTCTTCGTGAGCAACTG ACCCACATACAGTCGCAATGGCTCGATTTACAGAATAATTCGGATAAGTG GGAGAAAACTATCAGCCTTGTATTAGAGGTAAAATCCATTTTTATTTTGC TATTTTGCCAAAGGTTGACTGATTATCTATATGTTAGGTGGTATTTCAAA TGCTTAATCTCTTTTGACAGCGGGTTTTGTACACCTTTAAACAATTTTAT AAGGTATTTTCTTTCTTACGTTGTAAAGACGAGATTAGAAAAACTAGAAA ACGTTCCTTAATAGTTCTCATATACTCATCAACCTTATTTTTTTGGCTTC ATTGCCAAAATATTATTGGACTCGATCCGATCAATCAGTCCATCATATTT AAAGATTATTCATGATCATTGTAATGACAATGTAATTCTGCATCCTTCCA GCAATCCCAGGCTAAATAAACGAATCGTAGTTCCTTTCCCATCAGTTGAA ACAGCATGTTAAAATTGAACCAGACACTTCTATAATAGATTTTTTCGAAA TGACCGTGTACACACATCACAATCAGATTAAGAACTAGTTTACACTGTGC AGAGAACAATTAGATGACAGCGAAAATGTTTTATCGCGATATAAATAGGA GATTAAGGAAAAATAGATGATATACTCTTTAAGCTCTCCCTTATGAATCA GTAAGCTAAACAACTAATTTATTGATGGGTTGTTGAAGAAAAACTAATGA GCTAGTATTTGTTGTCCTGAAGGGTTTGAAGTGTAAAGTTGTAGACAGAT CTAATTGTTTTGAAAAAAAGAAATGGGTACTACTGTTAATTTGAATAACG AGGTATATCACTTTGGAACTTCTTTGATAATTACCGATATTTGGGGTTAC TTTCATAAGAGAGGGGTTGCTTTTGTGACCCCCAAACAGCTGACACTTTT GGTCTACAAGCTAAAAAAATTTCTAGCTGGTTGGAATGGACTGAAACTAT TTTCGACTTGAAGGCTCTGAAAGTTACCTACCTTAAGGGAAGAAATTTTC GCGAGAAGAAATTTTCGCGGAATTTAATTTCGCGAATCAGAGTTTCAAAA TGGCAACTTTCGCAGAATTTAATTTCGCGAATGAGCCGATTTTAAAAGTT TCACGGAATTTAATTTCGCGATTGAGAAGAATTTATCAACTTAGATTAAT TTTTAAGCATCACAGAGTTGTTTATATTTGATAAAAAATACACGTTATAA TGCTTCAAAATCAATTGTTCATGATTGTGTCCATCTTTTTTGGTAATACC TGGTCAAAAACAACAAAATAAAAGAAAGAGAAAAAAAATCGAATTTCGCA GAATTTAATTTCGCGATTTAACAATTTTGGTGTGTTTCGCGGAATTTAAT TTCGCGAATTACGCCCAAATTCGCGAAATTAAATTCCGCGAAAATTTCTT CCGCGGAAATTTCTTCTCGCGAAAATTTCTTCCCTTAAGGTAGCACTTAT GAAAGTAACCCCAATCGTGACATATATTGGAGAAAGGTGTACATAGTAGC TCAAAATCTTTTCACTTCATTTTGATATATGAGGGTGATATTGTTTGAAC TTTTTTCAAAGCTTTCGTGGCCTGGTGTTACTATAACTTCAAACTACAAA ATATACAATACACCTTTTCGACCGTAGCCGCCAATTGCCGTGGGGGCATA TTTTTTCACACCTAAAGACAATAGAAAAAAGTTTGAAAAAGGATTGGCTC GAGTTTAGGGTGGTAAAACGGACAAAAAAATGCCCGCGTGGCAATTGGCG GCTACGGTCGAAAAGGTGTATTGAATTAAATTAAAAAGTGACGGCTACAT CCTCGGCTTATCATCTATCTGAAGGAACTTTTCTAATCAATTGCATACTG TGAAAAATTAATCTTAGATTCTGATCTATTATCTATTTTTGTTTAAAAAC TTTCTTCACTGGTTTAATTAACAAGCTCTAATGGTTACCTTACCTATTAA GTTCGACAAGCGTAAGTTCAACTAAATTATTGGAATGGAAGATAAAAGTG AGAGTAAAGGCCAGTCTCCACTTGCGCGTGCTGCGATCGCACTTTATGTA GCAAAGCTTCCACGCCAAATATTGCCATCGAAGCGTGCGTAAGTGGAGAC CGGCCTTAAAGTTACTTTTAGTCTCTTTAAAAATCGAAAGAATACCAAAA TATGCTTAAATTACGTGGAGAGTCCCATTAAATATAAAAAATCTTCTCCT TTTTAGCTGGTGAACAATCTGTTGGAGGACATCGAAAAGATCAACAAAAC TTTGAACGAATCTGAAGAAATAGTGAACCATTGGGTACTCACTCAAGATA TACCTGTTGATAGTGTCGCCTCTTATCTTGGTGATACAAGGGTATGTTTT CGATTTGATTCTGAATTGCTTTATACTATCTGTGAACACATCAAACCTTA ACAAATTCTACATTTTGAGACAACGATATTTCGTCCCCTCTCCGCAGAAA TAAAGTAGACGGTTTTCCATTATGTGAGAGCTAGGTTGACCAAATATGTC TTAAAATATTTTAAATTATTTTTCTTTGTAAATTATATCAGAGAATGCAA GAACAAACGCAATCCATGGAAACACAATTTGATTCGATGGATGGAACAGT CAAAGAATTACGTCATATCCACGGCGTCCTATTGGCTAAACCGACTGAAG GAGTGATCGACCAATTACATGACAGATGGAAACATTTGTTGAATGATTGC CAGATTCGACAGGAGAATTTGCAAAATTTGATGTCTGGTTCGGATGCAGG ATCAGTTATGTTACAAGGTTTGAGAAAAAAGTTTTCTTAGGATTACTTTA CACTTTTCAAAACTTCAGAATAATCTTATTTGGAATACATTGACTTCGTA GGCTTCTGCTCACCCTCCAACAAAAAAGTTTCTTATGTGAAGGAAGAGTG TACATAGAGTATAGAGTTCTGTTTTTGGGTTGGAAAGGCATGACATATCT CTAACTATTCTAACCCTACCAAAATTCTTGTTAAATGCGAGAGAGAATAG CCACAAAAGTTATATTTTAATGAATTGAAATTTCATAATTCGTTACAGAA AGCGTACCGACACCATGGGAACGTGGACAAGCATTGAACAAAGTGCCATA TTTCATCAAGTAAGTGTGTAGCTCCCAGTCCCCTTTAGTGATGGCCGTCC GTAATTTTCTTTTTTTATTCTTTTATAATTACAGTGGAGTTTCCATAGCG GAAAACTCTGTTCGAGTTATGGAGTAAGGTTTATAAGGCATTGTTAACTG AAGGGACCAGAAAACATATCCGTCTCAAGGAGACATTCTTCGAGTAATGA AAACTCTACTGTACACGTCAATAGCAATTTTCTAACTTTAAAGATTGAAC AACACTGCCAATTGTGTCTGGCTCTTTTGAGTTTGAATTTTGTAAGCTGG ACACTAGATTTTGATGTTTGAGCCGTCTCAAAATCTTTTACAATCGAAAA ATCCAAGTCTTATCGATGCGACGTCACCTTGTATCATATTTATCATCTCC TTAATTGTTTTATTTCAGTCATACCACAAAAACGACACAATGGGATCACC CAAAGATGACGGAGTTATATCACACGTTATCGGAATTAAATGACGTCAAG TTTGCCGCATATCGTACCTCCATGAAATTGAGATGTCTGCAAAAGGCTTG TTGTCGTAAGTTTTTGTTATAATTTTGAGAGAGAAAAAACCAAAAGGAAA TTGGAATGAATTTTTTTTTTTAAATCGCCAAAATTTGTTTTTGCCAAAAT TGAATAAATCCTAATTTTTATCTCAAACGCTCATTAGTGGCTGAAAATAA AAAAAAATTGCTACTCGTGAAAATAAGTTTCTTGCCAAATTTGATTTTTC CGATCTTTACTGTTCATCAAGATTCTTGTTCTTTTAAGGTCACCTGCATC TTACCTTCCCTTATAGTTGACTTGTGTGAATTGAACTTAAACATCAAGAA AGCATTCGAACAACACAACCTTCGATTGAGTAACGATAACTTGGTCGATG TCGGAGAAATCATCAACGTTTTATCGACCATATTCGAAAGTATCGATACG AATCGTAAAGAATCGATAAATGTCTCACAATGTATCGATATGACGTTAAA CTGGTTGTTAAACGTTTACGATAGTGGTCGTATCGGTAAATTACGAGTTT TATCATTCAAAGCGGCCATTACTTTGATGTCACGTGCTAAACTAGAAGAT AAATGGAAATGTAAGTAGGGTTNTATCACTTTGATGTCACGTGCTAAACT GGAAGATAAATGGAAATGTAAGTAGGGTTAAAATTCATCCACTTTAGACT TTAACTAATCTTTTAAAATTAACGTGTCAACTTTCTATAATATAGCAATT AACACATATAACAGTTTCTTCACTCTTCTTTCGCTACCAAGACGTATACA TTCCTAATTCAGAATCTTTACTTGATTTTGATGCAAGTGTACAGTTCAGC TCATTTTATGACTTTCGTTTGCTATTTTTTCCTAGATTTATTCCGTCAAA TTTCGGATAACACCGGCCACGCAGACAGCAAAAAACTTGGTTTGCTATTA CACGATTGCGTCCAGATTCCTCGACAACTTGGTGAAATCGCTGCCTTCGG TGGTAGCAATATCGAACCTAGCGTCAGGAGCTGCTTCGAAATGGTAAGTT CTTTGTTTGTTATAAATCCTGTAAGTGTATTCAGAGTTGAGGTTTTTTAT TTACTTTTTTTAAGAGGCAAAATTTACAAGTGAACGAGAACCGGACCTTG AAAACTGCAGAAAAATAAGCTTCAAAAAATTACTGTTTTTGTATATTGTT AGGGTTAGATTTTATAAATTTTCTAATTTTGTCATTCGTCTTCATTTTCT AGGCTAAAAACAACTCAGCGATCGATTCCAACAACTTTGTAGCCTGGACG AACGCCGAACCACAATCATTAGTCTGGATGCCAGTATTACACAGGCTAGC GTCCGCCGAAACTGCGAAACATGACGCAAAATGCGGTATTTGTAAAGAGT ACCCGATTGTTGGTTTCAGATATCGCTGTTTGAAATGTTTTAACTTTGAT CTTTGTCAGGTAAGGAAAAGTTTGAATGCTGTGGCGAAAACTTCATTCAA TAACATTTTCAAAATGATACAAATGATATTTTTGTTCACAAAATATCTTT TGCCCAGATATAGTAAAACCCTTTAATTTAAATCAATTTAATTTGATTAG AGAATCCCACCTAATTTCAACAAATATTTGAAAATCATTAGCTCGTTTGA AGTAGCAAAGCAAGCTTGACATTCTCAAATGCTACTTTCACCATGTCTTT ATAATAGCCGTTAGCTTACGCTTGAAGTACTAACCTTTTTTACTTTTGTT CATGTGGTTTGATTACTATCTACCAATCAATTAATTATTTAGACTTGCTT CTGGTCTGGACGTGTCTCGAAGAGTCATCGTGTCACTCATCCTATGCATC AATATAGCTTAGCGGTAAGTCTCATTTGTGTTCCACGGAAGCTCCATAAC CCCAATTCTTCTTAGCTCTCTATGTTCCTCGTGCGTGTTCGAGTTGAAGG ACTCTATTATAGGTTCTATTAAGGTTTTTCGTGAAGTGACCTTATCACGC CCTTTCCCGAAAACGAACATCGTCTCTAGCGGATATTCTTTTATGAAGGT CACTGTGTTTCACACCGTATTTTCCATCGTATTTTCGATATGATTTATAA AGCAGGAGCCTTCTTAAGGTTATTTTGCACCAATCATATCCATGGTTTCC TTGGTTTATCGTTAATAATTTGTGCTGTGCGTAAAGATTGGACTTATTTT TTCTGATGCACGTACAATATGTTTTATTCTCCTCTTTTTTCTACAGACGA CGACGGGTGAAGATCTTTCCGATTTCGTGAAGTTAATGAGAAACAAATTC AAATCTCGAAGATACAGGAGTCGCCCACCAAAGAAGCTTGGTTATCTTCC AGTGCAGACCATCATGGAAGGAAGTTCCATTGAAACGTATGTTTACTCCT TTGATTTCACTCTCCACTATCATCTACAGCATGGCTTTTAACAAAGCTTG TTTCGAAAGTGCTTCATTTTCATGGCTATTGGTAGGACTTATCCTTACCA AGATGGTAGTGGGTGGACCAAATCCATGATTCCGAAAAAAGGTTATTATC CTTCTGACGTGAAGCACATTACGCAAAATATGTTGTTTTTATGAAGTAAC GGTTTCTGATGAACGACTTGCTTTGATGGACGATGACCAAATGGTCTAAG GCTTCACCAGTGCAAACCAGGCGGCCGTAGTTCGAATTCTTGTTTCTTCC AATGTTGTGTTCAGCTCATAGATTGAGCTTGCCGACAGTGGACCCTGTGA AAACAATCAAAAGGGTGTCTAAAAGTCCTAGATTACTCGGTTATCCACGT AAAATATCTATGGGATTATCTCCGTGCAACTTTTTATTACTTTTTATTTT TCTTAACAGGCCAACGGAACCAACGACACCTGATCTATCCAACTTCACTT TCGACTCGGCGTAAGATCACAGTTGTTTTCCTATTCAATCGTGTTGTTTT TCTATTCAATAGTTTCAATCACCATGTTTTAGTATTTTACCTTTTAACAC TTCCTACATTTTCAAGATGCAATTCTATCTAGCCTCAGAATAGACTGGAG TCGTTTATAATGTGTGTAATACAGTAGCATAGGTATTATATGATAATACG ATTATTGTTACAGGATTTAGCTATATTTAGTATAAACTAAAAACATTTCC CTCCATCATTTTTTGCTTTATTTTTACCATGTCTAAATTAGTCGTCTAGC TTGCTAGACCAGCCTCAGAATAAAATAGCCTATTTTACACCAGGCTGAAT AAGTCAGAGATCTTACAAATCAGCATGCTGAGATTCTTGTTTTGAAAATC CAATTCTACATTTATATTATCCTCCAGAATGAACGGTCACCACGATTCGA CAGACTTCCACCCCAATCACCATGGTAACGATGAGGAGATTGGTAACGAG GAACATCATCTGATCAAGCTCATGTGTCAATCATTAAACGGTGAAATCAC AAACAATAACACAACGGTGTGTAATTTTTCATGCCTTTTTTGTTCATCAT TTTCACTTTCGATTTTCGCTCAGACAAGTCTCCTTCATAGGTTATCTCCC GGTGGATAGGAGTCATGGGGACAAGCTGGAGTTTTTACAAGCTCTTACGT GATTTGGTTGGTCGTTAAGTTAATTTCATTACTTTTTCTAAAGAACGCGT CATCTCTATTACTTCAAATGACCAATTAGTGAAGTATCTTATAAAAACTC CAGCTCATCCCGAATCATGGGAAACATGGGGAAAATGCTCCCTTTCTATT GGTCAAACCTTTTGAAGATGACTAAAGGGACATCATTATTAGAGGGCAGT CCTGATTACCCATGATTCATTTCGAATCATGGGTAAAGAGAGATTTGCGA AATAAAAAGTATCAACTAATCGTGGTTTGCAATCAATAATTACATTTTGC TTAAACCCTGAGCACGCCGTTTTTATCCTGTATTTCTCATTTCTTTCTTC AGCCGAAAAGTCCGTCACAAATTTTGGCGACGTTAGATTCATCACAACAA GAAGATATCGGAGAAATGATTCGAGGTCTTGAAGAGGAACACCAGTAAGT AATGTTGAATTTTTTACCTATCAGTATTGAGTTTGAGACATTTAAGGAAT CAATATTTGATGAGCTCATCCCGAATTTAAGCACTGGATTTGTATTATTT TTGAATAAAATCTGTCTAAAGGATTGCCAACGTTTTTTCCGATAGTATGT CTATAATCACTTTGGAATTTTACTTATGCGAGATTTTATATTCAAATGAG ATTTTAGAAATATATATGTTAAATCTAAGATCTGTTGAAATTAAGCCCGT CAAGTTGGTGATCTTGATCTTGATATGATTAGTATGTTTCTCTTATATAT TCTCTTTGCTTTCTTCTCTAGATCTCTAATGGAAGAATACACCCGACTGA AGGGAATCAAACCAAGTAACTCATTCGAAAACGGACAAATCGTTCCGGAA AATACACAAGACACGGTGTTGATCGCTGAAGCGAAGAGTTTACGCGAACA CAAAGGTCGTTTAGAAGCTCGTATGCAAATTCTAGAAGACCATAATCGAC AATTAGAATCTCAATTACAACGCTTACGACTTCTCTTAGAACAGGTTAGT GAAGTTCCATTCTACTTGTTACCGTAAGTTGGTCTAATACCGACATCCCT CTTCTAATTCCGATGACACCCTTCTTTACAGATAGGAATTATAGGAAGGC CGGAATTGCTGATGGAAACTATTTCCCCTTATTGCTTAGCTATCAGATTG GAAAAAGTCCTTTGTCTATCAGTGATCTAGACCTTTTGACCATTCCTATC TTTAAAGAAAGGTGTCGAAATTAGAAGAGGGATGTCTACAGAACAACTTA CGGTATGATTCTCTAGCTACTCTGTATCAGAGTGTATCAAATTTATAACG TAGCGTAGTACAGTAAAGTGCGTCAAATGGGCGAAGTTTTGTTTGCAGAC AAAACTGAACCGTCCTGAGTTGCATTATGGGCTTCACATTTAGAATCAGG AAAGCTGTATGTTTGTATATGGGAGTTTCTAATTAAAATCTATTTTCTTT CGTTAAATTATAGCCGCCCTCCGAACGTGAACGACATAATTCAAGCGGAA GTACGAATCCACCCTCACCTAAAGGTCTAACACCCGCTTTAACGCCCTCA TCGTCTTATCACGGCTCGCCCGAATTAGGGCGCCGTCAGAATGGATATTC AGATGAGCGTGCGATGGATATACATCATGTGACCGCAGAAATCGAACACG CCTTCCCAACATCAAGTTATGAGGATTAACGGAGGAATGGAAATTTTGTT CTATTAGTGTATTGTTCTGCTTTTTCTCTTGTGTTAGTAGTGTTTATATG AAAGATTGAATCTTTTAGAATTAGCGCTTTATTGTTAATACACAAAGAAA TAATGTCATTTTTCTATCTACCCATTTTCAGAATCAGAAATAAAGTTCTA GGAACACCGGACGGTTTTTAGATCCCTGGAGGACCTAAAGAAAATATCCG AAACCTTTTCTGCTACTGAAGGTTTGGTTTTTGTAAAATAGAATACCAGT CTGGACAATTAGGTTGATAGATACATGAAATTATTTATTTTGAAATTTAA AAGAAATATTTATAGCTTATATATATTTTTATATTGTACCTTGTCCATAT AATAATTTTTTTTGTCTTTTCTGTTGTCTTTCCTTGTCCTCCCTGAATTC TATGTTGTGTTTTTGTTTGCCTCCAGAAAAAACGAGGTCGCTTTATTTTC GCGTATTATTTTGCTTTTTGTAAATAAGTTTTTTTTGTTTTGTCTTATAT TTTTTGACAGAAAATCTTTTTTATGGATAGAAATAATTTTATACAATTGA AAATACCTTTGCGTTCATTATCAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000749XLOC_000749Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001413-exon-sc0000010-1575043694:284401..284473TCONS_00001413-exon-sc0000010-1575043694:284401..284473Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:283863..284013TCONS_00001413-exon-sc0000010-1575043694:283863..284013Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:283347..283512TCONS_00001413-exon-sc0000010-1575043694:283347..283512Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:282884..283032TCONS_00001413-exon-sc0000010-1575043694:282884..283032Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:282271..282583TCONS_00001413-exon-sc0000010-1575043694:282271..282583Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:281398..281549TCONS_00001413-exon-sc0000010-1575043694:281398..281549Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:276419..276584TCONS_00001413-exon-sc0000010-1575043694:276419..276584Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:274497..274630TCONS_00001413-exon-sc0000010-1575043694:274497..274630Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:267631..267785TCONS_00001413-exon-sc0000010-1575043694:267631..267785Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:256316..256502TCONS_00001413-exon-sc0000010-1575043694:256316..256502Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:254102..254280TCONS_00001413-exon-sc0000010-1575043694:254102..254280Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:253543..253693TCONS_00001413-exon-sc0000010-1575043694:253543..253693Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:253046..253285TCONS_00001413-exon-sc0000010-1575043694:253046..253285Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:250783..250917TCONS_00001413-exon-sc0000010-1575043694:250783..250917Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:250357..250582TCONS_00001413-exon-sc0000010-1575043694:250357..250582Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:250015..250075TCONS_00001413-exon-sc0000010-1575043694:250015..250075Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:249469..249605TCONS_00001413-exon-sc0000010-1575043694:249469..249605Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:248914..249207TCONS_00001413-exon-sc0000010-1575043694:248914..249207Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:248481..248638TCONS_00001413-exon-sc0000010-1575043694:248481..248638Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:248065..248271TCONS_00001413-exon-sc0000010-1575043694:248065..248271Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:247660..247731TCONS_00001413-exon-sc0000010-1575043694:247660..247731Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:247138..247277TCONS_00001413-exon-sc0000010-1575043694:247138..247277Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:246614..246664TCONS_00001413-exon-sc0000010-1575043694:246614..246664Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:246058..246196TCONS_00001413-exon-sc0000010-1575043694:246058..246196Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:245480..245571TCONS_00001413-exon-sc0000010-1575043694:245480..245571Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:244930..245152TCONS_00001413-exon-sc0000010-1575043694:244930..245152Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1575043694:243650..244460TCONS_00001413-exon-sc0000010-1575043694:243650..244460Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:284401..284473TCONS_00001413-exon-sc0000010-1510915933:284401..284473Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:283863..284013TCONS_00001413-exon-sc0000010-1510915933:283863..284013Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:283347..283512TCONS_00001413-exon-sc0000010-1510915933:283347..283512Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:282884..283032TCONS_00001413-exon-sc0000010-1510915933:282884..283032Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:282271..282583TCONS_00001413-exon-sc0000010-1510915933:282271..282583Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:281398..281549TCONS_00001413-exon-sc0000010-1510915933:281398..281549Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:276419..276584TCONS_00001413-exon-sc0000010-1510915933:276419..276584Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:274497..274630TCONS_00001413-exon-sc0000010-1510915933:274497..274630Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:267631..267785TCONS_00001413-exon-sc0000010-1510915933:267631..267785Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:256316..256502TCONS_00001413-exon-sc0000010-1510915933:256316..256502Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:254102..254280TCONS_00001413-exon-sc0000010-1510915933:254102..254280Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:253543..253693TCONS_00001413-exon-sc0000010-1510915933:253543..253693Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:253046..253285TCONS_00001413-exon-sc0000010-1510915933:253046..253285Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:250783..250917TCONS_00001413-exon-sc0000010-1510915933:250783..250917Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:250357..250582TCONS_00001413-exon-sc0000010-1510915933:250357..250582Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:250015..250075TCONS_00001413-exon-sc0000010-1510915933:250015..250075Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:249469..249605TCONS_00001413-exon-sc0000010-1510915933:249469..249605Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:248914..249207TCONS_00001413-exon-sc0000010-1510915933:248914..249207Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:248481..248638TCONS_00001413-exon-sc0000010-1510915933:248481..248638Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:248065..248271TCONS_00001413-exon-sc0000010-1510915933:248065..248271Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:247660..247731TCONS_00001413-exon-sc0000010-1510915933:247660..247731Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:247138..247277TCONS_00001413-exon-sc0000010-1510915933:247138..247277Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:246614..246664TCONS_00001413-exon-sc0000010-1510915933:246614..246664Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:246058..246196TCONS_00001413-exon-sc0000010-1510915933:246058..246196Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:245480..245571TCONS_00001413-exon-sc0000010-1510915933:245480..245571Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:244930..245152TCONS_00001413-exon-sc0000010-1510915933:244930..245152Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1510915933:243650..244460TCONS_00001413-exon-sc0000010-1510915933:243650..244460Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:284401..284473TCONS_00001413-exon-sc0000010-1491911889:284401..284473Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:283863..284013TCONS_00001413-exon-sc0000010-1491911889:283863..284013Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:283347..283512TCONS_00001413-exon-sc0000010-1491911889:283347..283512Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:282884..283032TCONS_00001413-exon-sc0000010-1491911889:282884..283032Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:282271..282583TCONS_00001413-exon-sc0000010-1491911889:282271..282583Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:281398..281549TCONS_00001413-exon-sc0000010-1491911889:281398..281549Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:276419..276584TCONS_00001413-exon-sc0000010-1491911889:276419..276584Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:274497..274630TCONS_00001413-exon-sc0000010-1491911889:274497..274630Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:267631..267785TCONS_00001413-exon-sc0000010-1491911889:267631..267785Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:256316..256502TCONS_00001413-exon-sc0000010-1491911889:256316..256502Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:254102..254280TCONS_00001413-exon-sc0000010-1491911889:254102..254280Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:253543..253693TCONS_00001413-exon-sc0000010-1491911889:253543..253693Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:253046..253285TCONS_00001413-exon-sc0000010-1491911889:253046..253285Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:250783..250917TCONS_00001413-exon-sc0000010-1491911889:250783..250917Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:250357..250582TCONS_00001413-exon-sc0000010-1491911889:250357..250582Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:250015..250075TCONS_00001413-exon-sc0000010-1491911889:250015..250075Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:249469..249605TCONS_00001413-exon-sc0000010-1491911889:249469..249605Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:248914..249207TCONS_00001413-exon-sc0000010-1491911889:248914..249207Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:248481..248638TCONS_00001413-exon-sc0000010-1491911889:248481..248638Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:248065..248271TCONS_00001413-exon-sc0000010-1491911889:248065..248271Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:247660..247731TCONS_00001413-exon-sc0000010-1491911889:247660..247731Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:247138..247277TCONS_00001413-exon-sc0000010-1491911889:247138..247277Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:246614..246664TCONS_00001413-exon-sc0000010-1491911889:246614..246664Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:246058..246196TCONS_00001413-exon-sc0000010-1491911889:246058..246196Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:245480..245571TCONS_00001413-exon-sc0000010-1491911889:245480..245571Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:244930..245152TCONS_00001413-exon-sc0000010-1491911889:244930..245152Clytia hemisphaericaexon
TCONS_00001413-exon-sc0000010-1491911889:243650..244460TCONS_00001413-exon-sc0000010-1491911889:243650..244460Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:243650..284473 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.48591 2.20322 1.601 2.17952 11.4418 8.44428 6.27256 5.91454 5.59639 7.70663 2.87987 3.55755 15.4436 19.3619 9.40064 12.7256 29.6639 15.5689 33.3191 17.7252 41.7389 44.2744 10.5142 10.4983 8.98711 9.1379 12.0323 13.4319 5.13502 4.69073
Blast
BLAST of TCONS_00001413 vs. Swiss-Prot (Human)
Match: DMD (Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 462/1304 (35.43%), Postives = 721/1304 (55.29%), Query Frame = 3
Query:  354 MQAQVQDLTTGHSKRFDVVENNLARATRFLDELDGLSSWMSKTRDLLEGHKENKPGYNVDPEIMKKSLETRKCNVLSINDLLKDFKAEGELASGNFP--QAVGEKIGQLNVDWQIIIRLALALKERPVSEEVVVAETVQERQDAPVTFDSLQTSLSFTTTETSKYKYEMYSSTN-ENSIGGEGETA--QLHDWLRLVEQKIKSLNVTLGDEDEMAAAVQKQNSIQLEMSNRRKEYDDAISMA-----TTSPQD-----DEKINKLKEHWEGVWGKVLNKKSLINQALVDWRRYNELRLQLDNYVYKADIQLNENQQIGTTVTELEAQLEKHKKFQGELSTWANTYNTLRQLAETILSTYVNEDLNDFKTTVNETNTRWNSLETRSNAHQDSLQEALDRLLQFHKNMISALTWLSSAESKVAEL-DSLVESSQAEDTSNVDELQGEMQELEDDIASHQAMFNGLNETGKQILMDLEVGEVRTALQSKLDDMNDRWNSLGVRVVDIRDRMSYGTGEWRQLLLDMQEIVDWLSRAGQELMSQQPIASDVEKVQQQNKHHQEFKGKLNARRVVIEQALEQGHNFLLKHQSAQDESFIQRGDKL-----VVRVASSLREQLTHIQSQWLDLQNNSDKWEKTISXXXXXXXXXXXDIEKINKTLNESEEIVNHWVLTQDIPVDSVASYLGDTRRMQEQTQSMETQFDSMDGTVKELRHIHGVLLAKPTEGVIDQLHDRWKHLLNDCQIRQENLQNLMSGSDAGSV---MLQESVPTPWERGQALNKVPYFINHTTKTTQWDHPKMTELYHTLSELNDVKFAAYRTSMKLRCLQKACCLDLCELNLNIKKAFEQHNLRLSNDNLVDVGEIINVLSTIFESIDTNRKESINVSQCIDMTLNWLLNVYDSGRIGKLRVLSFKAAITLMSRAKLEDKWKYLFRQISDNTGHADSKKLGLLLHDCVQIPRQLGEIAAFGGSNIEPSVRSCFEMAKNNSAIDSNNFVAWTNAEPQSLVWMPVLHRLASAETAKHDAKCGICKEYPIVGFRYRCLKCFNFDLCQTCFWSGRVSKSHRVTHPMHQYSLATTTGEDLSDFVKLMRNXXXXXXXXXXXXXXLGYLPVQTIMEGSSIXXXXXXXXXDLSNF-TFDSAMNG----HHDSTDFHPNHHG--------------NDEEIGNE----EHHLIKLMCQSLNGEITNNNTTPKSPSQILATLDSSQQEDIGEMIRGLEEEHQSLMEEYTRL------KGIKPSNS-FENGQIVPENTQDTVLIAEAKSLREHKGRLEARMQILEDHN 4103
            ++AQ++DL     K  D+ E           +L+ L  W+S  R+ LE + +       D +  + +++ ++ +V       ++  ++G+      P  Q V  K+  L+ +W+ + RL   L+    +++  +A  +     +P    +L T     T ET+  K EM SS   E     +   A  +L DWL L++Q IKS  V +GD +++   + KQ +   ++  RR + ++ I+ A      TS Q+      ++I +++  W+ V   + N++  +N+ L D  ++ E + + +  + +A  +L   ++   TV  ++ ++ + K+   +L  W    +    LA  +L  Y  +D           N  W S+  R +  + +L+E    L QF  ++   L WL+ AE+    L D+  +    ED+  V EL  + Q+L+ +I +H  +++ L+E  ++IL  LE  +    LQ +LD+MN +W+ L  + ++IR  +   + +W++L L +QE++ WL     EL  Q PI  D   VQ+QN  H+ FK +L  +  VI   LE    FL +      E   Q   +L        V   LR+Q   + ++W  L  +S  W++ I   LE +  L E  ++++  L ++E I   W    D+ +DS+  +L   + ++ +   ++     ++   ++L  + G+ L+      ++ L+ RWK L    + R   L    +  D G      L  SV  PWER  + NKVPY+INH T+TT WDHPKMTELY +L++LN+V+F+AYRT+MKLR LQKA CLDL  L+     A +QHNL+  ND  +D+ +IIN L+TI++ ++      +NV  C+DM LNWLLNVYD+GR G++RVLSFK  I  + +A LEDK++YLF+Q++ +TG  D ++LGLLLHD +QIPRQLGE+A+FGGSNIEPSVRSCF+ A N   I++  F+ W   EPQS+VW+PVLHR+A+AETAKH AKC ICKE PI+GFRYR LK FN+D+CQ+CF+SGRV+K H++ +PM +Y   TT+GED+ DF K+++N     +       ++GYLPVQT++EG ++ETP       L NF   DSA        HD T     H+               ND    NE    EH LI+  CQSLN +  +  + P+SP+QIL +L+S ++ ++  ++  LEEE+++L  EY RL      KG+ P  S  E     P++ +D  LIAEAK LR+HKGRLEARMQILEDHN
Sbjct: 2316 IEAQIKDLGQLEKKLEDLEE-----------QLNHLLLWLSPIRNQLEIYNQPNQEGPFDVKETEIAVQAKQPDV-------EEILSKGQHLYKEKPATQPVKRKLEDLSSEWKAVNRLLQELR----AKQPDLAPGLTTIGASPTQTVTLVTQ-PVVTKETAISKLEMPSSLMLEVPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDLALKLLRDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEKFLAWLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKILRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTL-GIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHE--AHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACD-ALDQHNLK-QNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKN-KFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVT-----LINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQD--SPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHN 3583          
The following BLAST results are available for this feature:
BLAST of TCONS_00001413 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DMD0.000e+035.43Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3[more]
back to top