Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001410 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001410
Unique NameTCONS_00001410
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2080

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001410 ID=TCONS_00001410|Name=TCONS_00001410|organism=Clytia hemisphaerica|type=transcript|length=2080bp
atatgctTGACCGTATGAGGCAAATTAATGTGCCTCACCCGGTTCAGCAA
ATACCGTGCGGGGAAAATCGGGCATCACTATAAACGATACAATACAAGAT
TGTAGGGattgaaaaataacaaagaCGAAGTATGGAAGATTCAGTGAAAA
TGAATTATTTGacgattgaaaaaaatatcgaatatCGTATTTCAAGTGGT
AGTGACATTTCGCCTGGCCCCAGTCCACCTGGTTCACCAAAAACACAGAC
CAAGACGAGAGGAGgcTGGGCAAAAATAAAACGTGAATTAATAACAAGTA
AAGGAGAAAGGAATAAAGACAAAGAAAAGTTTGACGAAAATTCGCCCTCG
TCTACACCCGAAATGCGCCCTGTAAACACCCTACCGAAATCACCACACCT
TCAATCAAAACGAAACCCGGACCAATATTTCGATCAAAATAATAATGGTA
GCACATTTACGGGTTATAATCAGACGGGGATTCTGTCACAAAATAATAAC
CACCTGAATACAAGTTATTTGATGGCACCAGGAGGTATGGATAAAAGAAA
GTGTGTCAAATTACTGATGCTAGGGCAAGACGGAGTTGGAAAATCCGCGT
TTGTGGTAAGATACCTAACAAGGCGATACATCGGAGAATATGATCCAAAA
ATAGAGGGCATATTCCGGAAGACAGTCAATATGAATAATCAAGACATTAA
CGTTGAAATCAAAGATACATCGAGAGGGATCAACTGGTCAGGCAGAGCAA
ACGATCTAATCTGGACCAATGGGCTAATATGTGTCTATTCAATAAACAAT
CGAAGCAGTTTTAATGAAATTCAATCTATCAGTAAAATGTTATTGCAGCA
AAAGAAATCAAGGGGTATCCCTTGTTTACTGATCGGTAATAAGAAAGACT
TAGAGAAAAACGAGCGCCGGGTTCAAGTTAGTGAAGGACAGCAATTAGCT
GATTCGATTAATGGTACATTTTGCGAGTTAAGCGTAAGTGATGGATATAT
TGAACTTGAAAATATTGTTAACAAATTTATCAAGGATAAATGTAGTGACT
TAAAAAATCATCTGTTACCTCAATCGAAGATTTTATCAAGTAAATCCACT
CCAGAGATTCGGAAACCGTTGGGCGGTGGACAGGGCGGTTCGAATGATGG
TGGTGGTGTTGATATTGAAGtgaaaactgaaaagaaaacaagAGCTTTAT
GGCAAAAGTTGTTgacaaataataataaaaaacaatagtGTTATTTAAGG
GATTTATTTTATGTTAAGTCAtctataaatcaaaacaaaacatcacaAAC
ACGTAGTCTACAGTGTGTCTGTAAAACAGTGAAATAATATCATTTCATAG
TATCTTATGATTTCATTTCTAAGATTCTAAAATCATATTTCcgattttcc
ttgagaaataaaaaatatactaaaTTATTGGGATGGCAAATGATGTTTGA
TGATGTTTCAACTTTACGGCCACACTGTAGACAAAAAACCGaaagtcaaa
atattataaTTTATTAGGAAAGGAAATTCAGTAGAAAAGCCCCTTCATGA
ACTTCACGAGCTTATAATCTCATATTCAGACATTTACTAATAGTGCATTA
TCGCTTTGCCTAATGTCCGAAATGATAGCAACgatacaatcaaagtcata
atattagATTAAGTGGAATTACTTCTGAGTTTTAACTTCTTGAGACCAtt
tgagacttaagacttagatcCTAacgctcaaaaaagttttccaaaacGAA
ATTAATTAAAGTGAATTCTGAAAaccgttaaaatacccaaaatgaTCAAT
ATATTACGAGGTTGATTGTAGCGTATTGAAGTCCTTGGTTAAGATTAGGA
CATGAGGGGGAGAAAAATATAtgctaaatttcaaatttctttgaaattga
gATCGATTATGTTGATAAAATTTTTTCGTACATTTGTAAATATAAACTAA
TGCTGATTTATATTAGCTtctttgtaaaatttttgattgaaagaatTAAT
CTAAAAATCTTAATCGTGAACGGTCAGTTTTCTAAAACAACAAATTGCag
tgctctgaattatcttgTCAACGGTATATA
Run BLAST on NCBI

protein sequence of TCONS_00001410-protein

>TCONS_00001410-protein ID=TCONS_00001410-protein|Name=TCONS_00001410-protein|organism=Clytia hemisphaerica|type=polypeptide|length=368bp
MEDSVKMNYLTIEKNIEYRISSGSDISPGPSPPGSPKTQTKTRGGWAKIK
RELITSKGERNKDKEKFDENSPSSTPEMRPVNTLPKSPHLQSKRNPDQYF
DQNNNGSTFTGYNQTGILSQNNNHLNTSYLMAPGGMDKRKCVKLLMLGQD
GVGKSAFVVRYLTRRYIGEYDPKIEGIFRKTVNMNNQDINVEIKDTSRGI
NWSGRANDLIWTNGLICVYSINNRSSFNEIQSISKMLLQQKKSRGIPCLL
IGNKKDLEKNERRVQVSEGQQLADSINGTFCELSVSDGYIELENIVNKFI
KDKCSDLKNHLLPQSKILSSKSTPEIRKPLGGGQGGSNDGGGVDIEVKTE
KKTRALWQKLLTNNNKKQ
Run BLAST on NCBI

transcript from alignment at sc0000010:82890..110285-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001410 ID=TCONS_00001410|Name=TCONS_00001410|organism=Clytia hemisphaerica|type=transcript|length=27396bp|location=Sequence derived from alignment at sc0000010:82890..110285- (Clytia hemisphaerica)
ATATGCTTGACCGTATGAGGCAAATTAATGTGCCTCACCCGGTTCAGCAA ATACCGTGCGGGGAAAATCGGGCATCACTATAAACGATACAATACAAGAT TGTAGGGGTAAGTATAACGTATTTCACCATGTTCAAAGTATTTGAGAGAG CAAAAATGTTTTTGCCTGTATAATCAGTTGATAACATTGCTGATACGTCA TAATCCTGTTGTCTAGCGAGCACAAGGTCAACGGTGTCTATGGTAAGCGC CGTAATTTTCTGATCTACAATGATGGACATAATATATTGGCAAACCTCGA TTTTTCTTGTTTCCGGTGGATAACTTGGGCCCAGACCCTCTTTTACCCCC AGTTCAATGTTGGATAACACTTGGTAAACGATAGCAAGCCTTTCCCACCT ATCAATATTGATTTTGGGGGTGGAAGGGGAGATTTTTTTAAATCCCAAAG GTTTTTGCCAAATATTTTCAACATTTCAACATCCAACATTGTAGAATAAA TGATAATCGCACTATCAGTGACCCCGTTAGAATCTCTTAGCATCTCAAGA TGAAATGAAGAGCTAAATGCCAATGCGGATGGGAGGCTAGTTTTAACCGC TTTTGTTTTTATCTCAGTGAAAACTTTTTGTAAAGAACTTCTTTCTGTGG AAAAAGCTTGGGTTTAGGGATAAGGCTTAAGGAATCTACTGCTCTGAATT TCTTAGTGGCTGATGAGAATTTTGTGAATTTAGTAATGGGGTAGAATTAG AGACGATCCTATCGTCTACACAAGATCACTAAAAAAGGGATGAGTTTGAA AACGGTGCCCAGGGGCGGAGAAAGCAGTGGCGGAGATGTTTACAGTGTTT GTTTCAAACTCTACCGCTACTTTTTTCCCGTAAACCACCCTAACGCCCTG ACTTTGACTCTGACGCATATATCTCCCCGCGTTTACTGACCTACTAGCGG ACGATAGCTTCGTTTCGGGTAGAATTCGAGGTAAATTTTCTCACCGAAGA CGATTCTTCTTTGAGAGAGAGTTCCAACAGGTCACATGGAAGCCTATAAA AAAGGTGTCTGGAAAGGTGACCCCAATTTCAAATGACACATTAAAAGCCT TTCTAAGTACGTTTTTTTTGTTTTTGTTTTCTGGAAATATTTCTTGGGAA AATCTGGAAACCACGAAGGAGAAAATGTTTTCATTAAAGGTTGAATGGTA GGAGGCTTTATTGGGAAAAGATGTTATTAAAAACTAGAAGAAAATGTTTT CCTGAAAAACGAAAAATAATCAATCTGTCTTTGTCTTTATGTCTTTCATT TTTGAAGTTTAAATGACTTAGCGATATTTACGAGTGATTGAACTTTTTCT ATGCCACCTATGCTAAATTTGATCAATTTGGAACGGTTTCTCTATTCGAA ATACTTTTAAAATCTTTAATTCCATGTTTTTCAACTTTTCAAAATATTCG AAGATTGAAAAATAACAAAGACGAAGTATGGAAGATTCAGTGAAAATGAA TTATTTGACGATTGAAAAAAATATCGAATATCGTATTTCAAGTGGTAGTG ACATTTCGCCTGGCCCCAGTCCACCTGGTTCACCAAAAACACAGACCAAG ACGAGAGGAGGTAAGGAAAATCACTTTTTTGAAAATTTAGAAAGAATTGG CAAGAAAAGTAATGTCCTTGAGTGAGTTAAGGTTGTCTGCAAATTTACCC TAACCTTTTAACATCAATAACAATCGTACTTTAAAAAACGTTATACCTTT AAGTTTGTCTATTGTACATTAAAGTTCATGAATCACACGATTTTTACGAC CCTTATTGGGACTAATTTGACCAAATTTTGATCTTTCAAGGAGCAAAAAG TTGAAACTTTCCTATTTTTCAACCCTTAGTTGGACTGAAATTTGATTTTC TGGTTTTTTCCAACCCTTACAGGGACTTTCAGGTCCCAAAAAAGTCACCC TTAGGGGCGGCACATACCCATATCCTTCATTTGCCTAAGTACCCCACCGG ACCAAATTCGAACCAGTATGCATCCCCCATGCATCTGACCAATATTTAAC TTCAAAAAAATTGTTTTGAAAGATTTGACGACGTCAGTAAAAATAAGCGT CAAAGCCGGTTGACGACACACGCTCTGACCATAGTCGAAAAGTTGATTTA AAGTATTTGAACATGAAAATTATGTTTTAGGTTCTTTAACACTTTTAACA AAGAATTGCCTTTATAAATTGATTTTTAATCAAATCCCTTACCCTATTAG CCCCAAGCTTTTTTGACTTTTGTATCCCTAGGGGGGGGGGTAGAATCTAC CACCCTCGATTATTTTCGATCTAGAAGAGCTATGGCCATGAAATTTGGTA CAGATGTTCTCCATCATGACACAATTTTCCAGGAAGAAAAAAAAAATTGA TGACGTCATTCAAAAACTGATGACGTCATCACAAAATTTCCACCTGTCGG AAAAAAGCCCAAATATATGGTTTACAAAAATGTCTATTACAGTCGAACCA ATAAAGATATTTCGATTCTGTTTAAAGATTCTGAGAGGTAAAAGACTGTT CTTTAACATAATTGCAGGTTTTGCAATTTCCATGAAATTTTTTTCTTAAA ATCTATGCTGAAGATGAGTAAAATTTTCAAAATTTGATGACGTCATAAAT GATGACGTCATCATTTTCAAAAATTTTCTTTAGATTTTTTAAATNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT AAAACCTGATCTGGACAACCTATGACCCTAAAATTTTGTACAAGTACTCT TAATAAGATTTTATTAAAAGTCAGAAAGTTTCAAGTCGTTTAAAAAAATT TTCCCCGAGATATAAACAAAAGAACTCCAGCGTGGTAGATTCTACCCCCC CTGGGGCTAATAGGGTAAAGAGTAATTAAGAATTTAATTGCAAAAACGAC GTTATGATTATGAACTTTAAAAAGACGTTAATAATATGTTGCATCACATT CTTTTATAAAAGGTGCTAAGTTTTGATGGATGATTAACATTTATGTTTCG AAGTTTTTTCAAACTGTCCGCAAAGAATTGAACTGTTTTAAATTTTTCGG AAAATTTTCTAAATTAATGCATCTAAAGTTATGGCTGTTTTTCTATGAGA GATTGGGATGAAAAATTGGTCAAAAAGCAGTATTTTCAAGATTTTGAGAC AAATAAGCTTTTAGAAAAATTTTCCGAAAACATATTTTTAGTTCGGTAAA AGATACAACATCTAACACAAAAAACTATTCAAAATGTTTTTTTCTTCGCC GAAAATAAGCTCTTCAAAGTTGAAATACTCTTCTTCGCGAAAGGCTTCAT TTTCTTCAGCATCAAATTTTTTCTTTGCTATTCTTAAATTTTCAGACTCA AGGATAATTGACCTAACAGAAAATGTATAACATGCCACAGTTTTATGTGC TACATCAGGTAGAAATTTATATTTTGTAAGTGGTAAATATTAAAAATTCA CTATGGTCAGAATCCCTTTATTAAAGGTATAGGACATTTTAACTCCACCT CAGACAAAAGTGGCTAATCCTGTAAGAGGTTATATGAAAGTTGTATTAAA ACTCATTAACTTCATTCGACAATAGTATATATATGCTTCCGATTCCGATT GGTCAAGCACTCTTCTGATGAATGAGAGTTCAACTCAACAAGAAGTGAAA GTTGTATTATAAATTTTGAGAAGAAAGAAAAATCACCAGGCAAGTACACA AAGTTCTATCGTCGCTTATAAAACGTTGCAAATGTAATTGCAAGTGGACA CCATGAGTATTGTATTGGCGTAGATTGCCGCCATGTTGGTAATAAAGAAT TTTACGCTAGCCATAAATTTCCGTTTTCTAAACGAAAGAAATTTTCCTAC GCATATTATTTACTCAAAGACCACAAGTATTTTGATGGAGTAAATATATA TTTTAATAATTCTAGCTTCAAAAATTCAGCCATCTCTTCTGCGTTGGATT ATTGTCCAGCCACCTCCTATTTTTGGACGGCTTTACAGTTTAAAGCCTAA AAGACAAACAAGTGAAAAAACAATCTAGCGTGAATCAGTCGGATGTGAAT GTCTTTCGTAATTGGAAAGAAAAATTAATGATTAAATGCTGAAAACTATT TAATTTCTCAAATTTGACTTTATACTTTAGAATTGAAAATTGAAATTGAC CAAAAACTTTTCCTCGCTCTCCTATGCAGCTCCTATTTTAGAAAACCCCC GGCCCCCTTTCCTGTCTTCTGACATGATCAATTAACAGACTAGTTTTCTA GTCTATTTTAGGCGTACAAACTTTCACGAGCAGAAACTTTCGCGAGGTCG AAAAATCGCGAAATTCACGACATAAACTTTCGCGAATCGTAGGATAATAA TGAGAATTTTCGAATAAAAATCGCCTTAAAAGTGAAAATTATTCCTTCAT CCGCTAAAGACGGTATAGCTCTTCGACTTTAAAAAGGCATTAAAAGATAA TAATATGTCGAAAATTTGAAATTTATTACGATTTCGAGGTTTTATAAATT TCTAACTTTTTTTGAGAATTTTTCGCGAGCATAAACTTTCGCGAGTTGCC CTGTTTAGAATTTTCAAAGACATTTACTTTCGCGAAAAAGGCCAAAATTC GTGAAAATTCGCGAAAGTTTCTGCTCGCGAAAGTTTGTACGCCTAAATGA TGGACCCAAACCTAAAAGTGTGCAGTTGAAATTAGAAAATTCTGAAATGG CCTGTTTTTCTCCTAGCAGAGGGTCCAGTGCCATAAAGCAGGCTTAGAAT GCAAATCAAGTTAATTGCTATAAAATTACTCGTCTTGATTCTAATTATAA AAAGATTTTATCAATGGTCAAACGAAAAAAAGGTCATTTAAGCTCAGAAG ATTGCAATAGATAAAACAAGAAATTAGGAGGCTAACACCTTTATACAACA CGATAGATACTTGATTTATTTATAAAATTCGAGTTATTTCAGTATCAAAA CTTGTATGGTTGAAAACAACTAAGATAAAATCTTGCTAAAAATCAATTCT TTAAAGAAAATAATTTAATTTTGGTCGTGCGGTGTGGTATGTTATTAGAT AATGAAAATGTTTATCTTGATGAACGTAAATATGGCGTATAGGAAATATC ATTCCATTTAGCAATTTTAGAAATTGACTCGTGTAAGAAAAAACACTTGA AAAATAGAAGGATTATTGCTCAGTTGAACCTTGTACTGACTGGTAAATTT AAAAGACTTAAACAGTTTGGAGCGAGTAGATTACATTGTGTAGATGCTGT GACTTCAAACCAATGATATGTTTCGAACACTGGTGTCTTTCAGATAATGT TTTAAATGTTGTTTGTATGTTTTCAAAGTATTCTTGTTTTTGCACACTGC ACTTGCTGGATTTGCATTGGTACTTTCATTTCCTTTTCAAGGTAATATGC ATGCCAAAATTCAAGATTATTCACCAAAATGAGTCTATACGCTCTAGTGT TATGATTCAAAATTAGATTTGATGACAAATGAATGGGTTAGGGTTTCCCA GAGTTGAATGGGTAAAATGTCCGAAGTCATTCAATTGACATTCTGGCAGC TGTAATAGCATTTGAAATTCTTTGTTAACTGATTTCAAGCTAGTTGACTG GATCGGGGTTCCCATATAAAAGGTAGGGTGTTCAGTCTTAAGAATTACCA GTCCACCGTCTTGTTTTCAATTCTGGTCATCAGCGAGGCCCCCCAAGCGG ACCTTCAATTCGAGCAATCACTCAGATTTTTCCCCCAAATTCACGCATTC ACGCAATGTTTTTAGCAATGCACGCAGTTTTTGTTCACGCAAAGTTTTCC AATTCACGCATTCACACAATTTATTTTTAATTATCACGTATTCACGCAAG TGAAAAAGCCCATTCACGCAAACCGCTGGGGCATTTACAGTGCAATTTGA ATGTTTTGAATTTTGAACGTTCGAAATTCTAAGGTTAATAAAAAAACATA GCAGACTAGTCCGACTTCATAACTGGACAAACTTCCAAAGGAAAATTATA AGCATAGTTAGCCTATATCACTAGCGTAGACAAGGAGAGCAGAATTTCAC GACACAGTAATTATCTATTCAAAGTATAATAAACCAGCTGCGCTGGAAGG TCAGCCCTAAAGGATAAGATAGTTCAAAGGATAAGCTGGATCAAGAGAGA GTAGAAAAAAGGATGTGATCACAAGATAACGATAAACTACTCTTGGAGGT GGCTTAGACAAAATGGGTGCAAAAATCGTCAACATTTTGTCAGGGTCGAT TACACATTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTCTTAACGACGAGCGGG AAAAAAATCGCGGAACAGATTTGAAGGGTCACCTGGGCTGACCAAAAATA TAATTTTAGTGCTATAAAAATCTACTCTCCTACACAAATTTTGCGCCCCT CTTGTCTACGCTAGTGTATATAGTGTGAAAAGAAATATGATATACAGTAT GTACCTCTGGGGGGAGGTACTAGGTTTGTGAGATGACGCGTATGTCGTCC GAGCTAAAGTTCGGAAATCAAGACCCTTAGAGAGACTGGATTTCAAAAGA TTTTGTCCATTTTTTGATGTTTTTGCCACCCATTTTGCCTAAGTAACCAC CCCCGGATGTTCCTTTATCCCTGGTAGACTCAAGCCCATTCTCCTTGTTG CGTAAAAGTTGAAAAGTGTCTTTAAAATAATCGAAGGTTTTGTACGTTCG TAAGTCAGTCTTTTCCTCTTTCTTAAACGTGTGACATGATTAGAAAATTT ATCAAAAATCTCATCACAAAAGTTGAAGAAAAGAGGTTGTTCGTCGATCG ACATTTTGGTTGATGGATATAAAGTATTGGCGGTTAGTTTTACTCTTTAT TTTTATTCAACGTCAATAGAAAATATCAGGCGATTTTGTTGAAATTTCTT TCAGTTTGTACGTGTTTGATTTTGGCTTCAAAACGTTTCTTTAAGTTTAG ATGGTTTGGGATTGCTAGCCAGGTTTCGTGCCCAAATCTCTTAGGAGTTA CATTTCCAGCTTTAACGAATGTTGCATCCTATAATAAGGGAATTATTTTG ATGTTTTCGAGATGATTGCTCTATAGATTGGGCTTTTAGAAAGAATTGGT TCAAAAAGACAATCTCGTACCCAGAGCAAGTTGCACCATTTTTGGAGTAT AATTGATAAGCGTAGTAAATCATAAAAAACGAACTAGGGAAAAGATTAAC AGTGGAATCCCCATAACTCGAAGACACACGGGACAACAAAATTGTTCTAG TTAAGAAAATTTCATTGTAATATAAGGATGTGGATGAGTTATAGTGAAGG AGTGGAGGTGTTAAATTAGCGATTTTACTGTATGTAAAGTAAGTAAGTCT ACGACTGTCGTCGAAAGCGCCACGAAGGTTCCTCTTTCGATAGATATCTA CCAGAGACATCGGGCATCACCCTTTCTCCCTGGTTTGTTCTACTTACCCT TCTCTTTCCGGTCAAAAATATATTTTCGAAAAATTTAAATTTAGTTTAAA TTTCGGACCATGTTGGATGTTAAAGAAGGTTAAAGTCTGAGAGGGGGCAG GCAGTGGAGAAATAGAAAGACTCAAACATTTAAGCAAATTGCTAAAACTT AACATTAATGTTCAAAGATTCACGAAAGCTTAACATCTCGAAGTCAAAAA CTTTATTTATCACCTTTTAGTTACCATCTTTCGTAAAGGCGCCATGGCAA ACCCCAAAACAGAAACCATGAGATAAAACTCTATTTTGAAAAATGTATTA GAGTCTGTTTACTGTGATTTATCATCTAGGTACAATTTGCGTCACGGGGA ACAGAAAAAAGAACTCCTCCTTTTTCCAGTGGTTTGTAGTTATCAGTTGA CATAAGTTAAAACACCCACTGTCACCCTCTAATAGACCCGGTATAACTTC AGCCAGTTGGGATACAATAACAGACTGAAGACTCGAAGGCAATCGATTTC CCCATGTTTTTTTTATGGCTGGGGATTTGAATTCCATTATTTTCAAGAGT TAAAAAAGTAAGTTGGGATTGAAAAATAGCACAATAGATTGTAGTGTTTA CTTAATTACCTTCAACGTGGAAAAATTAGATTATAATTTTCCACTGCCTA GGGATGATATTTTTCCAGTGGGAGGGGTCCTAGCGGTTCTATGAGAAAGG GACCAGTTAAATGGAGAGAAACCTCTCAGTTCATTTTCACAATTCTTTTC ACACTTGCACCATCAGTAAATTGAAAATTGTCGGGAGTTGTTCGAGATAC GAGATCGAAAGAAGACAATTCTTTTCATTCAAATTCTCCCCGCAATATCC TTTCTTTTTCTTGTCTCTAAACATACTTTGTGTTATTTGCCAGAAATAGA ATGAATAGTTGGATATCCATAAGGAGGAGTAGAGTTAAGCCTAGGCAAAA ATACTGATTCGTTTAAAAAACATGTAACTGGGAGATTAATAGTATTAAGT GTCTGATTAAAGTAGAATATCCAAAGGGTTCGAGTATCCTTTAACAAAAG GGGTATTCAGGGGATTCGGCATCTTGTAAGCTTCTCGTTATAGACCAATC AAATAAATTCAATTTAGGATATTTTATATCTACTTATGAGATTAGGCAAT ATACATCCTAATCTTCCCCACATTGTACTCTACAAACCAAAACTATTTCT CAATACGATATTGAAAATATGATTTAGGATGACAAAACTGTTCTTTGATG AGTGATGGGTCCCGCCGTGTTAGAGATTGACTTAACATTTAACATGTTTT ATAAAAACAAAAGCCTAGTTTGAAAGTTGCGAATTATCGGCTTTTCATAC TAAAAACAGTCTCGTAAAGTGATTTGTCATTTTAAAAAGAACGTTCAAAT CCTTAGTTCAACATCATAGCTCAGCGTCATATATATAGAGTAAACCCTTA AGGTGTACTTTCTCAGACATAACACAAAATTACTTGTAGACAAGAAATCA CAAACAGCCTATTGATTGGTTTGTAATTTTTTGTCTACAGTACATACTTT TTGTAAAAATCAAAACTTATTGGGTTTTTGAATTTGTGTTTGATGTAAGT AAGTTTTGGATATATTGTATTTGAAAGTATGGCGGAAAGAGTGTGTGCAG CTAGACTGATTCGTATATTTTAAACAGTGCCGTAGGAAGCATTTTCTTAT TGGGGGGGGGGGGGGCTGAAGTTTAGGGACACCGCGACGGCCCGGGGGGG GGGGGGGGGTTTTTAAAATTTTTTGCTCAATTTTATTTAAAAAAACCCAA AAAAAAAAATTTTTTTTTTGGGGGGGGGGGGGGGGGCTGAAGTTTAGTGA CACCGCGAGGGCCCGAGGGGGGGGGGGGATTTTGAAAATTTAAGCTCTAG ATTGCTTGAAAATGCACTCAAAACAAAATGCTTTCTTTGTGCGGACGGGA CCTCCGAAAATCGAACCTTAGAGTGACAAAATTTTAGAGAGTCTTTAAAA AAAAATTTTGTTAGATTTTTGAAAAATGTATTACCCTTTTTCCGACCCTG TGAGAAACTACTTTGAGATTTTCTGATTTCTCTCAGAAGTCTGTTTGACC TAGATTAGACAAGAGCCTTTTTGGTTCTAACGGGACCCTTATGTAAAGGT TATATAACATTATCGAGTTTAACATTTTAATACATTTTTCATCTAACAGC TCATAAAATCCTTTCTTACGCCTTACAGTTCTTTCAAGACTTGTCATGTC GTGAAAAGGGTCAAATTTAATTTAAAACTGCGAGCTGTTACTTTTACACT ATAATCATACCTGAGAGAAGGCATTGTCTTGACTTAAGCCGCGATGAAGG GTTACTAAAGTATCATTGAAATATTTTAGTAAATTTTTCTATCAAAACTG GATCTCACAAAATTCAACAATTCTGCAACACAGCCTGAGAAAATAACTAT TTTTCACAGGCTTGGACCAACAGAGGATCTACTGTTAAGTTAGTACTTAT CTTATCTACAGTAATTTTTCTTATTTTTTAGGCTGGGCAAAAATAAAACG TGAATTAATAACAAGTAAAGGAGAAAGGAATAAAGACAAAGAAAAGTTTG ACGAAAATTCGCCCTCGTCTACACCCGAAATGCGCCCTGTAAACACCCTA CCGAAATCACCACACCTTCAATCAAAACGAAACCCGGACCAATATTTCGA TCAAAATAATAATGGTAGCACATTTACGGGTTATAATCAGACGGGGATTC TGTCACAAAATAATAACCACCTGAATACAAGTTATTTGATGGCACCAGGA GGTATGGATAAAAGAAAGTGTGTCAAATTACTGATGCTAGGGCAAGACGG AGTTGGAAAATCCGGTAAGTTTTAAAACCAAATTCTCATGATTACCTAAT ATTTGGTGAATATGTAAAATGGTTGGAAAAAGGAAAAATAAATTACCGGG TAAATTGAATACGCATGTCCCGGGTGGAAAGATTTCGAAAAATTATTTCC CTAGCACCATTATCTTTTTTAACCTGGAAAGGAAAATAATCTGTGAAAAT TTTTACCAAATTGGCAGCTTACACTAAGCTTGGACTAAATATTTGACAAA AAAGAATAAAACCTTTTTGAAAATACGGAAGCTTAATGTGGAATTTTATG CGTGGTTGTAATATGCTTTTACAACGAACAAACAAATTAATAAAGTATGT AAATGTGCCCATGGCCGATGTTTGCTTTGTCAGAAATATTAAGAGATTTG CACCTTCTATCTTTTCACCGCTATGTTTGAATTTTATCAATTTTCCGGAT AAATTCAAAGCTTAAAACACCCACTCTTCCGAAAGCTTTTAACGGATCTT CTATTTTTGTGGTACTTTTGCTTCCTACGTATTTTGTGATTGAGATTAAA GGCAAATTGTCCCAAGTTCATTGATCGACTTTATGAAGTTTATTACAATT CGAACCTCTACTATCCGAATCTTTCTGTAATTTGAACTGAAATATTGGTC CCCTCAGCTGGAAAGTGGTTTAAATTACTCTCTGTAATTTGAATCTTTCT CTTATTCTAAGAGAAATTTTAGCCGTCCAATGAAGATCGAATTAGAGAGT GTCAATAGTATATGGCCTTGTTGGGTGAGAAACCTGAATATCTGGTATAA TTCACTATTATATTATTATTCACACCTTTGACGAGAAATCTTTTGAACCC GTATTACATGAATTTTTGATTGAGAAATTAACCATTTTTTGATTTCAAAG ACCTCTAAATTCATATTATTATTCTTTCAGCGTTTGTGGTAAGATACCTA ACAAGGCGATACATCGGAGAATATGATCCAAAAATAGGTAACTAGAAATC AACTTTAAGCCAATTCCGCCCTCACATTATTCAGTCCCCTCAGTTTTCAA ATTTGAGAAGTTACAGTCATATTTCGAGAATAGTGAAAAGATTTTATAAT CTCGTAAAACTTGAGAAATCAAGACCATTTACTAACTTATTAAAGATTTT AGAAACTCTTTTAAATTACTTTTGCTCGAATAAATTTCACTCCTTTACAT CGAAGAGAACCAAAAAACGAAATTTCTAAAAATTTGAAATTTAAACAATA AAACTGGTAGGAAATTCTATATTATTTCAGGGTGGCTACCTAATGCGCGA ATATCAAACATAGATATTCCCAGTCAGAGGCTAAATGTCCCTCTCCAAAA CTTAATTTCTCTTCTTGATTCCACATTTTCTAGAGGGCATATTCCGGAAG ACAGTCAATATGAATAATCAAGACATTAACGTTGAAATCAAAGATACATC GAGAGGGGTAAGAACTTCAACTCAGATCCGCGAAAACGTTTAATATTGGA ATTATACGGGCTTTTTAGAAATAGGGGACAAAACTTTGACCACTGTTTGA ATCTAGTCCGTCACACCCTGGCGAAAATCCTTTTTTTCAATTTTTCTGTC ATTTCATAACAATTAATTACCTATTTCGAGAATATTCACCTTGTCCACTT TTACATCGGTTTTATCATATCTTTCATACCTTTATTTTGCTAGGCGAGGA GTTGTTTCATTTTAAATCTTCTTTTCATGATCCTTTCCATGNATACCTTT ATTTTGCTAGGCGAGGAGTTGTTTCATTTTGAATCTTCTTTTCATGATCT TTTCCATAGAACCTGATTAAGGAAAAATAAGTAAGAACTTTAAATTATTT ATCCCGAAGAATAATTTCAGACTCAATATTTCAATATTTCTTAGATCAAC TGGTCAGGCAGAGCAAACGATCTAATCTGGACCAATGGGCTAATATGTGT CTATTCAATAAACAATCGAAGCAGTTTTAATGAAATTCAATCTATCAGTA AAATGTTATTGCAGCAAAAGAAATCAAGGGGTATCCCTTGTTTACTGATC GGTAATAAGAAAGACTTAGAGAAAAACGAGCGCCGGGTTCAAGTTAGTGA AGGACAGCAATTAGCTGATTCGATTAATGGTACATTTTGCGAGTTAAGCG TAAGTGATGGATATATTGAACTTGAAAATATTGTTAACAAATTTATCAAG GATAAATGTAGTGACTTAAAAAATCATCTGTTACCTCAATCGAAGATTTT ATCAAGTAAATCCACTCCAGAGATTCGGAAACCGTTGGGCGGTGGACAGG GCGGTTCGAATGATGGTGGTGGTGTTGATATTGAAGTGAAAACTGAAAAG AAAACAAGAGCTTTATGGCAAAAGTTGTTGACAAATAATAATAAAAAACA ATAGTGTTATTTAAGGGATTTATTTTATGTTAAGTCATCTATAAATCAAA ACAAAACATCACAAACACGTAGTCTACAGTGTGTCTGTAAAACAGTGAAA TAATATCATTTCATAGTATCTTATGATTTCATTTCTAAGATTCTAAAATC ATATTTCCGATTTTCCTTGAGAAATAAAAAATATACTAAATTATTGGGAT GGCAAATGATGTTTGATGATGTTTCAACTTTACGGCCACACTGTAGACAA AAAACCGAAAGTCAAAATATTATAATTTATTAGGAAAGGAAATTCAGTAG AAAAGCCCCTTCATGAACTTCACGAGCTTATAATCTCATATTCAGACATT TACTAATAGTGCATTATCGCTTTGCCTAATGTCCGAAATGATAGCAACGA TACAATCAAAGTCATAATATTAGATTAAGTGGAATTACTTCTGAGTTTTA ACTTCTTGAGACCATTTGAGACTTAAGACTTAGATCCTAACGCTCAAAAA AGTTTTCCAAAACGAAATTAATTAAAGTGAATTCTGAAAACCGTTAAAAT ACCCAAAATGATCAATATATTACGAGGTTGATTGTAGCGTATTGAAGTCC TTGGTTAAGATTAGGACATGAGGGGGAGAAAAATATATGCTAAATTTCAA ATTTCTTTGAAATTGAGATCGATTATGTTGATAAAATTTTTTCGTACATT TGTAAATATAAACTAATGCTGATTTATATTAGCTTCTTTGTAAAATTTTT GATTGAAAGAATTAATCTAAAAATCTTAATCGTGAACGGTCAGTTTTCTA AAACAACAAATTGCAGTGCTCTGAATTATCTTGTCAACGGTATATA

Coding sequence (CDS) from alignment at sc0000010:82890..110285-

>TCONS_00001410 ID=TCONS_00001410|Name=TCONS_00001410|organism=Clytia hemisphaerica|type=CDS|length=5535bp|location=Sequence derived from alignment at sc0000010:82890..110285- (Clytia hemisphaerica)
ATCAACTGGTCAGGCAGAGCAAACGATCTAATCTGGACCAATGGGCTAAT
ATGTGTCTATTCAATAAACAATCGAAGCAGTTTTAATGAAATTCAATCTA
TCAGTAAAATGTTATTGCAGCAAAAGAAATCAAGGGGTATCCCTTGTTTA
CTGATCGGTAATAAGAAAGACTTAGAGAAAAACGAGCGCCGGGTTCAAGT
TAGTGAAGGACAGCAATTAGCTGATTCGATTAATGGTACATTTTGCGAGT
TAAGCGTAAGTGATGGATATATTGAACTTGAAAATATTGTTAACAAATTT
ATCAAGGATAAATGTAGTGACTTAAAAAATCATCTGTTACCTCAATCGAA
GATTTTATCAAGTAAATCCACTCCAGAGATTCGGAAACCGTTGGGCGGTG
GACAGGGCGGTTCGAATGATGGTGGTGGTGTTGATATTGAAGTGAAAACT
GAAAAGAAAACAAGAGCTTTATGGCAAAAGTTGTTGACAAATAATAATAA
AAAACAATAGAGGGCATATTCCGGAAGACAGTCAATATGAATAATCAAGA
CATTAACGTTGAAATCAAAGATACATCGAGAGGGCGTTTGTGGTAAGATA
CCTAACAAGGCGATACATCGGAGAATATGATCCAAAAATAGGCTGGGCAA
AAATAAAACGTGAATTAATAACAAGTAAAGGAGAAAGGAATAAAGACAAA
GAAAAGTTTGACGAAAATTCGCCCTCGTCTACACCCGAAATGCGCCCTGT
AAACACCCTACCGAAATCACCACACCTTCAATCAAAACGAAACCCGGACC
AATATTTCGATCAAAATAATAATGGTAGCACATTTACGGGTTATAATCAG
ACGGGGATTCTGTCACAAAATAATAACCACCTGAATACAAGTTATTTGAT
GGCACCAGGAGGTATGGATAAAAGAAAGTGTGTCAAATTACTGATGCTAG
GGCAAGACGGAGTTGGAAAATCCGATGGAAGATTCAGTGAAAATGAATTA
TTTGACGATTGAAAAAAATATCGAATATCGTATTTCAAGTGGTAGTGACA
TTTCGCCTGGCCCCAGTCCACCTGGTTCACCAAAAACACAGACCAAGACG
AGAGGAGATCAACTGGTCAGGCAGAGCAAACGATCTAATCTGGACCAATG
GGCTAATATGTGTCTATTCAATAAACAATCGAAGCAGTTTTAATGAAATT
CAATCTATCAGTAAAATGTTATTGCAGCAAAAGAAATCAAGGGGTATCCC
TTGTTTACTGATCGGTAATAAGAAAGACTTAGAGAAAAACGAGCGCCGGG
TTCAAGTTAGTGAAGGACAGCAATTAGCTGATTCGATTAATGGTACATTT
TGCGAGTTAAGCGTAAGTGATGGATATATTGAACTTGAAAATATTGTTAA
CAAATTTATCAAGGATAAATGTAGTGACTTAAAAAATCATCTGTTACCTC
AATCGAAGATTTTATCAAGTAAATCCACTCCAGAGATTCGGAAACCGTTG
GGCGGTGGACAGGGCGGTTCGAATGATGGTGGTGGTGTTGATATTGAAGT
GAAAACTGAAAAGAAAACAAGAGCTTTATGGCAAAAGTTGTTGACAAATA
ATAATAAAAAACAATAGAGGGCATATTCCGGAAGACAGTCAATATGAATA
ATCAAGACATTAACGTTGAAATCAAAGATACATCGAGAGGGCGTTTGTGG
TAAGATACCTAACAAGGCGATACATCGGAGAATATGATCCAAAAATAGGC
TGGGCAAAAATAAAACGTGAATTAATAACAAGTAAAGGAGAAAGGAATAA
AGACAAAGAAAAGTTTGACGAAAATTCGCCCTCGTCTACACCCGAAATGC
GCCCTGTAAACACCCTACCGAAATCACCACACCTTCAATCAAAACGAAAC
CCGGACCAATATTTCGATCAAAATAATAATGGTAGCACATTTACGGGTTA
TAATCAGACGGGGATTCTGTCACAAAATAATAACCACCTGAATACAAGTT
ATTTGATGGCACCAGGAGGTATGGATAAAAGAAAGTGTGTCAAATTACTG
ATGCTAGGGCAAGACGGAGTTGGAAAATCCGATGGAAGATTCAGTGAAAA
TGAATTATTTGACGATTGAAAAAAATATCGAATATCGTATTTCAAGTGGT
AGTGACATTTCGCCTGGCCCCAGTCCACCTGGTTCACCAAAAACACAGAC
CAAGACGAGAGGAGATCAACTGGTCAGGCAGAGCAAACGATCTAATCTGG
ACCAATGGGCTAATATGTGTCTATTCAATAAACAATCGAAGCAGTTTTAA
TGAAATTCAATCTATCAGTAAAATGTTATTGCAGCAAAAGAAATCAAGGG
GTATCCCTTGTTTACTGATCGGTAATAAGAAAGACTTAGAGAAAAACGAG
CGCCGGGTTCAAGTTAGTGAAGGACAGCAATTAGCTGATTCGATTAATGG
TACATTTTGCGAGTTAAGCGTAAGTGATGGATATATTGAACTTGAAAATA
TTGTTAACAAATTTATCAAGGATAAATGTAGTGACTTAAAAAATCATCTG
TTACCTCAATCGAAGATTTTATCAAGTAAATCCACTCCAGAGATTCGGAA
ACCGTTGGGCGGTGGACAGGGCGGTTCGAATGATGGTGGTGGTGTTGATA
TTGAAGTGAAAACTGAAAAGAAAACAAGAGCTTTATGGCAAAAGTTGTTG
ACAAATAATAATAAAAAACAATAGAGGGCATATTCCGGAAGACAGTCAAT
ATGAATAATCAAGACATTAACGTTGAAATCAAAGATACATCGAGAGGGCG
TTTGTGGTAAGATACCTAACAAGGCGATACATCGGAGAATATGATCCAAA
AATAGGCTGGGCAAAAATAAAACGTGAATTAATAACAAGTAAAGGAGAAA
GGAATAAAGACAAAGAAAAGTTTGACGAAAATTCGCCCTCGTCTACACCC
GAAATGCGCCCTGTAAACACCCTACCGAAATCACCACACCTTCAATCAAA
ACGAAACCCGGACCAATATTTCGATCAAAATAATAATGGTAGCACATTTA
CGGGTTATAATCAGACGGGGATTCTGTCACAAAATAATAACCACCTGAAT
ACAAGTTATTTGATGGCACCAGGAGGTATGGATAAAAGAAAGTGTGTCAA
ATTACTGATGCTAGGGCAAGACGGAGTTGGAAAATCCGATGGAAGATTCA
GTGAAAATGAATTATTTGACGATTGAAAAAAATATCGAATATCGTATTTC
AAGTGGTAGTGACATTTCGCCTGGCCCCAGTCCACCTGGTTCACCAAAAA
CACAGACCAAGACGAGAGGAGATCAACTGGTCAGGCAGAGCAAACGATCT
AATCTGGACCAATGGGCTAATATGTGTCTATTCAATAAACAATCGAAGCA
GTTTTAATGAAATTCAATCTATCAGTAAAATGTTATTGCAGCAAAAGAAA
TCAAGGGGTATCCCTTGTTTACTGATCGGTAATAAGAAAGACTTAGAGAA
AAACGAGCGCCGGGTTCAAGTTAGTGAAGGACAGCAATTAGCTGATTCGA
TTAATGGTACATTTTGCGAGTTAAGCGTAAGTGATGGATATATTGAACTT
GAAAATATTGTTAACAAATTTATCAAGGATAAATGTAGTGACTTAAAAAA
TCATCTGTTACCTCAATCGAAGATTTTATCAAGTAAATCCACTCCAGAGA
TTCGGAAACCGTTGGGCGGTGGACAGGGCGGTTCGAATGATGGTGGTGGT
GTTGATATTGAAGTGAAAACTGAAAAGAAAACAAGAGCTTTATGGCAAAA
GTTGTTGACAAATAATAATAAAAAACAATAGAGGGCATATTCCGGAAGAC
AGTCAATATGAATAATCAAGACATTAACGTTGAAATCAAAGATACATCGA
GAGGGCGTTTGTGGTAAGATACCTAACAAGGCGATACATCGGAGAATATG
ATCCAAAAATAGGCTGGGCAAAAATAAAACGTGAATTAATAACAAGTAAA
GGAGAAAGGAATAAAGACAAAGAAAAGTTTGACGAAAATTCGCCCTCGTC
TACACCCGAAATGCGCCCTGTAAACACCCTACCGAAATCACCACACCTTC
AATCAAAACGAAACCCGGACCAATATTTCGATCAAAATAATAATGGTAGC
ACATTTACGGGTTATAATCAGACGGGGATTCTGTCACAAAATAATAACCA
CCTGAATACAAGTTATTTGATGGCACCAGGAGGTATGGATAAAAGAAAGT
GTGTCAAATTACTGATGCTAGGGCAAGACGGAGTTGGAAAATCCGATGGA
AGATTCAGTGAAAATGAATTATTTGACGATTGAAAAAAATATCGAATATC
GTATTTCAAGTGGTAGTGACATTTCGCCTGGCCCCAGTCCACCTGGTTCA
CCAAAAACACAGACCAAGACGAGAGGAGATCAACTGGTCAGGCAGAGCAA
ACGATCTAATCTGGACCAATGGGCTAATATGTGTCTATTCAATAAACAAT
CGAAGCAGTTTTAATGAAATTCAATCTATCAGTAAAATGTTATTGCAGCA
AAAGAAATCAAGGGGTATCCCTTGTTTACTGATCGGTAATAAGAAAGACT
TAGAGAAAAACGAGCGCCGGGTTCAAGTTAGTGAAGGACAGCAATTAGCT
GATTCGATTAATGGTACATTTTGCGAGTTAAGCGTAAGTGATGGATATAT
TGAACTTGAAAATATTGTTAACAAATTTATCAAGGATAAATGTAGTGACT
TAAAAAATCATCTGTTACCTCAATCGAAGATTTTATCAAGTAAATCCACT
CCAGAGATTCGGAAACCGTTGGGCGGTGGACAGGGCGGTTCGAATGATGG
TGGTGGTGTTGATATTGAAGTGAAAACTGAAAAGAAAACAAGAGCTTTAT
GGCAAAAGTTGTTGACAAATAATAATAAAAAACAATAGAGGGCATATTCC
GGAAGACAGTCAATATGAATAATCAAGACATTAACGTTGAAATCAAAGAT
ACATCGAGAGGGCGTTTGTGGTAAGATACCTAACAAGGCGATACATCGGA
GAATATGATCCAAAAATAGGCTGGGCAAAAATAAAACGTGAATTAATAAC
AAGTAAAGGAGAAAGGAATAAAGACAAAGAAAAGTTTGACGAAAATTCGC
CCTCGTCTACACCCGAAATGCGCCCTGTAAACACCCTACCGAAATCACCA
CACCTTCAATCAAAACGAAACCCGGACCAATATTTCGATCAAAATAATAA
TGGTAGCACATTTACGGGTTATAATCAGACGGGGATTCTGTCACAAAATA
ATAACCACCTGAATACAAGTTATTTGATGGCACCAGGAGGTATGGATAAA
AGAAAGTGTGTCAAATTACTGATGCTAGGGCAAGACGGAGTTGGAAAATC
CGATGGAAGATTCAGTGAAAATGAATTATTTGACGATTGAAAAAAATATC
GAATATCGTATTTCAAGTGGTAGTGACATTTCGCCTGGCCCCAGTCCACC
TGGTTCACCAAAAACACAGACCAAGACGAGAGGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000747XLOC_000747Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001410-exon-sc0000010-1575043694:110179..110285TCONS_00001410-exon-sc0000010-1575043694:110179..110285Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1575043694:108676..108832TCONS_00001410-exon-sc0000010-1575043694:108676..108832Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1575043694:86122..86454TCONS_00001410-exon-sc0000010-1575043694:86122..86454Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1575043694:85149..85205TCONS_00001410-exon-sc0000010-1575043694:85149..85205Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1575043694:84679..84752TCONS_00001410-exon-sc0000010-1575043694:84679..84752Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1575043694:82890..84241TCONS_00001410-exon-sc0000010-1575043694:82890..84241Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1510915933:110179..110285TCONS_00001410-exon-sc0000010-1510915933:110179..110285Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1510915933:108676..108832TCONS_00001410-exon-sc0000010-1510915933:108676..108832Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1510915933:86122..86454TCONS_00001410-exon-sc0000010-1510915933:86122..86454Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1510915933:85149..85205TCONS_00001410-exon-sc0000010-1510915933:85149..85205Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1510915933:84679..84752TCONS_00001410-exon-sc0000010-1510915933:84679..84752Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1510915933:82890..84241TCONS_00001410-exon-sc0000010-1510915933:82890..84241Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1491911889:110179..110285TCONS_00001410-exon-sc0000010-1491911889:110179..110285Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1491911889:108676..108832TCONS_00001410-exon-sc0000010-1491911889:108676..108832Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1491911889:86122..86454TCONS_00001410-exon-sc0000010-1491911889:86122..86454Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1491911889:85149..85205TCONS_00001410-exon-sc0000010-1491911889:85149..85205Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1491911889:84679..84752TCONS_00001410-exon-sc0000010-1491911889:84679..84752Clytia hemisphaericaexon
TCONS_00001410-exon-sc0000010-1491911889:82890..84241TCONS_00001410-exon-sc0000010-1491911889:82890..84241Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001410-proteinTCONS_00001410-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:82890..110285 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 3.16445 2.55741 14.9168 17.159 6.2133 8.28583 5.62706 3.19341 1.35259 1.56075 0.0326996 0.035032 1.01782 2.43421 0.960857 3.26777 1.96635 4.15617 1.03638 0.706668 2.18355 0.43306 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001806Small_GTPase
IPR005225Small_GTP-bd_dom
IPR020849Small_GTPase_Ras
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0007165signal transduction
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007165 signal transduction
cellular_component GO:0016020 membrane
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
Blast
BLAST of TCONS_00001410 vs. Swiss-Prot (Human)
Match: RERG (Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 9.049e-31
Identity = 64/195 (32.82%), Postives = 108/195 (55.38%), Query Frame = 3
Query:  537 MDKRKCVKLLMLGQDGVGKSAFVVRYLTRRYIGEYDPKIEGIFRKTVNMNNQDINVEIKDTSRGINWSGRANDLIWTNGLICVYSINNRSSFNEIQSISKMLLQQKKSRGIPCLLIGNKKDLEKNERRVQVSEGQQLADSINGTFCELSVSDGYIELENIVNKFIKDKCSDLKNHLLPQSKILSSKSTPEIRKPL 1121
            M K   VKL + G+ GVGKSA VVR+LT+R+I EYDP +E  +R    ++++ +++EI DT+   +   R   + W  G + VY I +R SF E+  +  +L + KK + +  +L+GNK DL+ + R+V   EG++LA  +   F E S   G    E  + +   + C +++   + Q K     ST  +++ +
Sbjct:    1 MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLD-HSRQVSTEEGEKLATELACAFYECSACTG----EGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAI 190          
The following BLAST results are available for this feature:
BLAST of TCONS_00001410 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RERG9.049e-3132.82Ras-related and estrogen-regulated growth inhibito... [more]
back to top