Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001405 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001405
Unique NameTCONS_00001405
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3763

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001405 ID=TCONS_00001405|Name=TCONS_00001405|organism=Clytia hemisphaerica|type=transcript|length=3763bp
atttttgttttgatttttcgtcTTTCTTGTGAAGAAGAGACGTTTTTCCA
GATTATTTATAAAGTAGTAGGAGACGCCCAgtcaagatggctgacgaagG
AAAAGAAGAACTAACGAAAAATGAAGCAGAAACGCCTCAAGATCCTGCTG
TAGAAGCGCCAACTGTAGAAAACGATAACACAGAACAAAAGGGGGATGGA
GATGATACAAGTAATAGCAGTTATATTGTGGCAGTTAAATCCAACACAAA
CTCTAAAGCTGAAGGTGACAAAAAAGATGCCGCAATTTCTAAAAagaaca
agaaaacaaaaaagaaagatgACTTAAATGACTTAAAGAAAGAACTTGAG
CTAACTTGTCATAGTGAAAATTTGGATGATCTTATTGCTCAATATGAAAC
AAACCTTACAACCGGTCTGACTAAAGAGATTGCTGCTCGAAACCTTGAAC
GTGATGGCCCAAATGCTCTCTCCCCTCCAAAACAAACACCTGAATGGATC
AAATTTTGTAAACAATTATTTGGGGGGTTTTCAATGTTACTTTGGGTTGG
TGCAATCCTTTGTTTCTTTGCTTATGGTATTCGAACAGTCAGAGAGGATG
ATCCGAGTCAAGATGAGTTATATCTTGGAATTGTACTTGCTGTTGTTGTC
ATTATTACTGGTTGTTTCTCTTATTATCAAGAAGCCAAAAGTTCAAAGAT
CATGGAAAGTTTTAAGAAGATGATCCCACAGGAGGCTACAGTATTACGTG
ATGGGGCAAAGATTCAAATCAATGCGGAAGAATGTACCATTGGAGACATA
GTATTTGTTAAGTTTGGTGACCGTATCCCTGCGGATATTCGTGTTATCGA
GTCAATGGGTTTCAAGGTTGACAACTCTTCATTGACTGGTGAATCTGAAC
CACAATCTAGAAACAGTGAATGTACTTCAGAGAATCCTTTGGAAACCAAA
AACTTGGCTTTCTTTTCCACAAACGCTGTTGAAGgtACTGCGACTGGTAT
GGTCGTTAACATTGGTGATAACACTGTCATGGGACGTATTGCCAACTTGG
CTTCTGGTCTCGGCGCTGGTAAAACGCCTATTGCTCTTGAATTGGAACAT
TTTATTCATATCATTACTGGAGTTGCAGTGTTCCTTGGTGTGACATTCCT
CATCATTTCACTTGCTATGGATTACCATTGGTTAGAAGCGATCATCTTTT
TGATTGGTATTATTGTAGCTAACGTCCCTGAAGGTCTACTTGCCACTGTC
ACAGTATGTTTAACATTGACAGCAAAGAAAATGGCAGCCAAGAATTGTTT
AGTCAAACATTTGGAAGCTGTAGAAACCCTGGGAAGTACTTCTGTTATTT
GCTCAGATAAAACTGGAACATTGACACAAAATCGTATGACCGTTGCACAC
ATGTGGTTTGACAAGATGATTATTGAAGCTGACACGACTGAAGATCAATC
AGGACTTTCACATGACAAAGGTTCATCTACATGGAAAGCCCTTGCCAAAA
TTGGTGGTCTGTGCAATCGTGCCGAGTTCAAAGAAGGACAGGAAGATTTA
CCCATATTAAGGAAAGAGTGTAACGGTGATGCTTCAGAGActgctatttt
gaaatttgttgaacTGTCTGTCGGCAATGTTATGGATATGCGTTCTAAGA
ATGGAAAGGTTGTTGAAATCCCATTCAATTCAACCAACAAATATCAAGTA
TCTATCCACAAACAAGAAGATGAGAAAGACCCCCGATATCTTTTGGTTAT
GAAAGGTGCTCCTGAACGAATTCTAGACAGATGTTCAACAATCTTGCTCC
AAGGTGAAGAGAAACCATTGGATGATGAAATGAAGGACGCATTCAATGAT
GCATATCTTCAACTTGGTGGTCTTGGTGAACGCGTCTTGGGATTCTGCCA
TTACTATCTTCCTGCTGAAAACTTTCCTGAAGGATTCGAGTTTCAAACAG
ATGATCCATGTAATTTCCCACTTGATAACCTATGTTTCGTTGGTTTGATG
AGTATGATTGATCCTCCAAGAGCTGCTGTGCCCGATGCTGTCAGCAAGTG
CCGAAGTGCAGGAATCAAGGTCATCATGGTTACAGGTGATCATCCAATCA
CAGCAAAAGCTATCGCCAAAGGTGTCGGCATCATCTCCGAAGGAAATGAG
ACTGTTGAAGACATTGCTCAACGCTTGAATATTCCTGTTGAAGAAGTCAA
TCCTCGTGATGCACACGCTGCTGTTGTCCATGGAACTCAACTGAAAGACT
TGTCAGCGGAGGACATTGACGACATTTTGAAATACCACACTGAAATTGTG
TTTGCCAGGACTTCACCACAACAAAAATTGATCATTGTTGAAGGATGTCA
ACGTCAAGGAGCTATCGTTGCTGTCACCGGAGATGGTGTTAATGATTCGC
CTGCTTTGAAGAAAGCTGATATCGGTGTTGCTATGGGGATTGCTGGCTCA
GACGTTTCAAAACAAGCAGCTGACATGATCTTATTGGATGACAATTTCGC
TTCCATTGTCACCGGAGTTGAAGAAGGACGTCTCATTTTTGACAATCTCA
AAAAATCAATTGCTTACACCTTAACCAGTAACATTCCAGAGATCTCGCCG
TTCTTGATGTTTATTTTGCTCAGTATTCCACTCCCTCTTGGTACTGTCAC
CATTCTGTGCATCGATTTAGGCACTGACTTGATACCCGCCATTTCTCTTG
CTTACGAGAAGGCTGAGACTGACATCATGAAACGTAAACCACGTGACCCT
ATACGTGATAAATTGGTGAATGAACGTTTGATCAGTTTGGCGTACGGTCA
AATTGGTATGATCCAGGCTATTGCTGGTTTTTTCACCTACTTTGTGATCA
TGGCTGAGAATGGTTTCTTGCCATCCTTCCTAATGGGTATCCGATCCCAA
TGGGATGACAAAAACAATAATTCAGTCATCGATTCTTACGGTAGCGAATG
GACGTACTCTCAACGCAAAGATTTGGAGTTGACTTGTCACACAGCTTTCT
TTACTACCATCGTTGTTGTCCAATGGGCTGACGTCATCATCTCCAAAACA
AGACGTCTCTCCGTATTTACGCAAGGAATGACaaACTGGATGTTGAATTT
TGGTTTGGTTTTCGAAACTTTATTAGCTGCCTTCTTGCAATACACACCAG
GTTTGAGTACTGGCTTACGTTTACGCCCATTGAACGCCTCGTGGTGGTTC
TGTGGTGTCCCTTTTTCCTTGTTGATCTGGATTTATGATGAAATCAGAAG
ATATTTGTTAAGAAAGTATCCTGGagGATGGGTGGAGCAAGAGACATATT
ATTAAAGAAACACGACAAAAGCACTCACTCCCGAAGAAAATAGTGCCAAC
ACTTAAATTATATCCCTAATCTTTCTAggcattttttgagtttttaagtt
attaattttttttaggatcTAAGACTTTTAGGCATTTTATTTATTCTTAC
AGtagcttttttcacatttcttaTGCATCATATTAAATAAACATAAATTT
CGATTAAAATTATATTTGGTCCGTTTTTTTAAGATACATTGTCCTGTAAA
AGTTTGAGCATTATTAAATATCTAGAAAATTAAACGAATTAATCTGAAAA
AATACTTCTATGAAATTATTTTAAGAGAATTATATTATACGTGTCTACAG
ATTTGATGAAAGAAACATGTTCATTCAAGATGGCACTCCCTTTCAAGATA
TTCCCTCCAACTAGCTGACGATTTGTGATCTAAAATTTTATTCATTCAAT
TATTTTATCTTCA
Run BLAST on NCBI

protein sequence of TCONS_00001405-protein

>TCONS_00001405-protein ID=TCONS_00001405-protein|Name=TCONS_00001405-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1072bp
MADEGKEELTKNEAETPQDPAVEAPTVENDNTEQKGDGDDTSNSSYIVAV
KSNTNSKAEGDKKDAAISKKNKKTKKKDDLNDLKKELELTCHSENLDDLI
AQYETNLTTGLTKEIAARNLERDGPNALSPPKQTPEWIKFCKQLFGGFSM
LLWVGAILCFFAYGIRTVREDDPSQDELYLGIVLAVVVIITGCFSYYQEA
KSSKIMESFKKMIPQEATVLRDGAKIQINAEECTIGDIVFVKFGDRIPAD
IRVIESMGFKVDNSSLTGESEPQSRNSECTSENPLETKNLAFFSTNAVEG
TATGMVVNIGDNTVMGRIANLASGLGAGKTPIALELEHFIHIITGVAVFL
GVTFLIISLAMDYHWLEAIIFLIGIIVANVPEGLLATVTVCLTLTAKKMA
AKNCLVKHLEAVETLGSTSVICSDKTGTLTQNRMTVAHMWFDKMIIEADT
TEDQSGLSHDKGSSTWKALAKIGGLCNRAEFKEGQEDLPILRKECNGDAS
ETAILKFVELSVGNVMDMRSKNGKVVEIPFNSTNKYQVSIHKQEDEKDPR
YLLVMKGAPERILDRCSTILLQGEEKPLDDEMKDAFNDAYLQLGGLGERV
LGFCHYYLPAENFPEGFEFQTDDPCNFPLDNLCFVGLMSMIDPPRAAVPD
AVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAQRLNIP
VEEVNPRDAHAAVVHGTQLKDLSAEDIDDILKYHTEIVFARTSPQQKLII
VEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILL
DDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFILLSIPLP
LGTVTILCIDLGTDLIPAISLAYEKAETDIMKRKPRDPIRDKLVNERLIS
LAYGQIGMIQAIAGFFTYFVIMAENGFLPSFLMGIRSQWDDKNNNSVIDS
YGSEWTYSQRKDLELTCHTAFFTTIVVVQWADVIISKTRRLSVFTQGMTN
WMLNFGLVFETLLAAFLQYTPGLSTGLRLRPLNASWWFCGVPFSLLIWIY
DEIRRYLLRKYPGGWVEQETYY
Run BLAST on NCBI

transcript from alignment at sc0000010:1110798..1128334+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001405 ID=TCONS_00001405|Name=TCONS_00001405|organism=Clytia hemisphaerica|type=transcript|length=17537bp|location=Sequence derived from alignment at sc0000010:1110798..1128334+ (Clytia hemisphaerica)
atttttgttttgatttttcgtcTTTCTTGTGAAGAAGAGACGTTTTTCCA GATTATTTATAAAGTAGTAGGAGACGCCCAgtcaagatggctgacgaagG AAAAGAAGAACTAACGAAAAATGAAGCAGAAACGCCTCAAGATCCTGCTG TAGAAGCGCCAACTGTAGAAAACGATAACACAGAACAAAAGGGGGATGGA GATGTAAGATTTTTTCAAGCTTAACTACTTTTGCTACCGCATTTTTAACA ATAGAATCGAATCGAAAAGTTTTGGACaggattttttgaaagaaaaaata ttttgaaatgtctACTTTGCTATTATATAGGACCCGTTGCcatcacagat atctgtaaagctcgtagataggcaactttaagctttctccagcaaaaaaa agtgaagcaaaaatttgactttttaaatttcgtgcccgcggataggatct agcattttaattgtttttggagcgcgagataaaaaaaaaagtagacGGAA AACGCTacttcacatctctcaaaccggtgaaattgcatattttagtcacg tgactttggtaggaaatccttccaaaccctggcttcacttttcgataaag gccgcaaatctacttagcccttcgggctttacagatctgtggttgCCATG GGGGAGTGATACACGCAATTATGTCTTTTAGTCTtgactactttcacttt cgtttacgttcaaattttctgaaatttttctgCAATAATTTTTTAACAGG ACAGAACATTGCATTATATTCTATCAGTCTATCTTGGCTTCGAATAAATT CTTTTGATAACATGTTATTATGTTTTCAATGGACCTGGTATAAAGTATAT TTCTTTTGCATCTTTTTAGGATACAAGTAATAGCAGTTATATTGTGGCAG TTAAATCCAACACAAACTCTAAAGCTGAAGGTGACAAAAAAGATGCCGCA ATTTCTAAAAagaacaagaaaacaaaaaagaaagatgACTTAAATGACTT AAAGAAAGAACTTGAGCTAGTAAGAACTTGAtgaatagttgttttggaga atgtGACAGCttattgaatagacctttttttaaagaggcagccatgttga ataattatgtagtccagcataaaaacaatgatatagccatgcataatttt taaaatatacatgatacagtaattatgtatggctgtatcattgtttttat gctggactacataattattcaacatggctgcctctttaaaaaaaggtcta taactAATTACTCTACAACAGTTACCACTAGAGACAATAAGataccgtga agttgggtaacttgcatcagtagtcCACTgacagtggaggctaacatgca tagccctcaaagaggcccccccagcggcacccctaatcacgccatcacgc aaaaaaattttctccatcacgcttcacgaaaattgctaaaatttgtcatc acgcaaaaaatagcggaaaatagcccaaatcacgcatcacgcctcaaaat tttgccctatcacgcatcacgccaaaaccttgatcacgccatcacgccaa aaaaaatctctaatcacgccatcacgcaagaaaaaagtcccaatcacgcc atcacgcaaaccgctgggggggcctcctcaaatgactgaccaatcaaagc agcaaaatttcaaaacaaataaaccaCGCAGCtttgctcgcagctctact ctaccatttttattttgatttaactttgtattttaaggaccagacagggt cattcattttagggctatgtatgttagcctccactgatagGGGCCGTCGA Taaacaattttcctttttttaacggcttctggccgtaaggggtgggaggg ggtcactgcaatgccgttaaaaaaatttaaaaaaaagggaaagtctcact tgcaaatttcatcagtccaaaaagtagaaacatgtGAAGAAAGGCTAAAA CCAAAGCAACCACACGACATTCACCTTATTCCCGGTCACCAATTAATGCT TCGACGAGAAAAATGACTGGTCACTTGACGAAAGTCGGGCAAATTTTTCC CTCCGCCTCAGTTGACTCCTTGCACCACCCATCCCGCCCTGAATTGCTGC AAGTTTTTTGAAAGGTCACggctcaaaaccacatgtttattccgtgcgaa aagaagaactttgaggATTACGAATCGAAAGAATATGGCGGGCATGGACC AGTGaaagtatttacttttgaagaatttttttggccGCTAAGACGTAGga ggggagggggtctgaacctTAACGGCTGCGAAAGTCGTTTGTCGACGGGC CCTTACCCGACTTCATGGTAATTCAtcacgtttttattggctgagggaaa gtagctaatgtatgtggagtaatttatTCAATAGGTCGTggcgttctcca aaacaactatacTAGGGAAAATGTGTCATTATTTATCttgaaatgataaa ttttgaatataCTACTTTGGTTTGTTATGAAAGCATTTAACATTATGAAA GGACCAAATACACCTTTTCCATAATTCAAATTTATCCAATTCAGCCCAGG AATATGATATTGTAGGGGAGGTAAACGAGCATGTTTTTGCCTGTAAAGGC TAGATAGCAGGTTCATGAAAATTGTAATAACTTAACATACTTAAATTTGA GAAGattatttttacaataaaaGTTAAGAAAGCTAAAAAACATAACTTTT CCTGATGAAATGCAGGCACAAATGGATTTGCTTATCTGCTAAAACCAAAC CGTTGAGCATGTGCCATTTTTTCCCAAATTATGAGATAGGTGTATTCTTT CAATTCCCATAAGAACTTATTTTGCAATTATTAACTATAATTAACTTATT CTCTTTGaattttatgttattttttaatatttttcaacaaattttcatAC TTTTATTTTGCTGTTTGTCAAATTCATAATTTAGCACCACTATATTTAAG TTTGATTAGGTTTGATGAatcaaggttttttttttttttgaaggaatCGA AAGCTTTTTTAGAATGTATTTAATCCTGACTGAAAAATTGTAATGATTAA TGGAAAAGAATTACATGATTACACGGTTATTATGCAATAAAATTACACAA TTTGATTCTTGGTAAATAAGATGAAAGATAAGACGAAATATACCAGGAAA TCTACTAACCTATATTTATTCTTATTCTTATTAGACTTGTCATAGTGAAA ATTTGGATGATCTTATTGCTCAATATGAAACAAACCTTACAACCGGTCTG ACTAAAGAGATTGCTGCTCGAAACCTTGAACGTGATGGCCCAAATGCTCT CTCCCCTCCAAAACAAACACCTGAATGGATCAAATTTTGTAAACAATTAT TTGGGGGGTTTTCAATGTTACTTTGGGTTGGTGCAATCCTTTGTTTCTTT GCTTATGGTATTCGAACAGTCAGAGAGGATGATCCGAGTCAAGATGAGTT ATATCTTGGAATTGTACTTGCTGTTGTTGTCATTATTACTGGTTGTTTCT CTTATTATCAAGTGAGTAAAATAATTGATTCTATCATGGGCCGTTTGCAA ACATTTAGCTGGTATCTTATTTAAATAGTATTCTCTTAAATGCTAAATAT AgattttaatcattttattaTGATAGCTATCTCTAGGAACATTGTGTGCG TTCAGCAACACTTAAACCAGCGTTTGCAatgacgggaaccgtctagtata TTATTGAATGGATTATTTTTCATGTCTTTAATGTTTTCAAGATTACCGAT CTGATACAGACGTTCAATGCAAAACATCTTGCACGTACAATTGATTATTT CTGTTTATTAAAAATTCTGTTTTAGGAAGCCAAAAGTTCAAAGATCATGG AAAGTTTTAAGAAGATGATCCCACAGGAGGCTACAGTATTACGTGATGGG GCAAAGATTCAAATCAATGCGGAAGAATGTACCATTGGAGACATAGTATT TGTTAAGTTTGGTGACCGTATCCCTGCGGATATTCGTGTTATCGAGTCAA TGGGTTTCAAGGTACATTTTTCTTGATGAGATTGTCAAGATTGCTTTATA TACAGTGGGCAGCCTTTCGGTATTTTCTTTACTTTATAAGTTTTAACTTT ATCAGGAATATTTTTAATGCTTAAAGTCTATGTATTAAAGAAGGGCGTCC GTGACATACTTATTTTGTTCATCCTTTAGGTTGACAACTCTTCATTGACT GGTGAATCTGAACCACAATCTAGAAACAGTGAATGTACTTCAGAGAATCC TTTGGAAACCAAAAACTTGGCTTTCTTTTCCACAAACGCTGTTGAAGGTA CATTGTTTTACATAAGAATTGACAAAGTTTTAGCTTTACTGTGATGTTTG GCTTCTCATTATTATATCTGCTNGCAAAGTTTTAGCTTTACTGAGATGTT TGGCTTCTCATTTTATCTGCTTTCAATTAACTTAATGAAAACTGGCATGT TTTTACATATTTACTTGGGTATAATCTACCAGTGTTCACCGTCTGAGATA CCCGCTCAAAGATACTACTCAGAATGAGTTCACGGTATGGGAATAAGGTT TGCTGTTAGATTGTGCTTGTGGtaaaaatgtcttacaatataaaatatta ttttcaggtACTGCGACTGGTATGGTCGTTAACATTGGTGATAACACTGT CATGGGACGTATTGCCAACTTGGCTTCTGGTCTCGGCGCTGGTAAAACGC CTATTGCTCTTGAATTGGAACATTTTATTCATATCATTACTGGAGTTGCA GTGTTCCTTGGTGTGACATTCCTCATCATTTCACTTGCTATGGATTACCA TTGGTTAGAAGCGATCATCTTTTTGATTGGTATTATTGTAGCTAACGTCC CTGAAGGTCTACTTGCCACTGTCACAGTGAGTATATTTTAGCTTTGCAGT ATATGAGCTtatactagccatagctttcactaactgccacccgctacaaA TGCTTATAAGGACTAAATACTgattaaagctttttaatgctttatagtga aagtttggaaaattattaggaacaagaatcgcaaaattgcgactaaatat ttccttaaaaatgaaggtcattatcgacatatactagcaagtagctgtcg ctaagaatNTAGGgttcatttttcgaacctcagcggagtaCCCCCGTCGG TCAACAAGGGTAGTACCCggagcaagtagctgtcgctaagaatgccctgc agagcttcctatcgaaatatccctaagtaagcaaaattacgcatgtgtag attttaaatttgttttatcgataaaatttaagttggaggaagaaagcttg gtttcaactttacttttgagatgacatgggatagatggtcgctcacatct caaaaagagaacTTATCGCTCACATTAATCACAGTGAGAAcgcaaaaaat tctgaaattgatttgattcttataaagtagacacttataataaaaacaag acgacttaaagtcgaaaatttcgcataatacttgaacatcaacgacgaag atgcgtgaaacgtgactcctgcagcattatgcatttNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNttattgatttgattcttataaagcacatgcttataataa aaataaatatgctcatctttttcgcaatcctttgtttactttctaataac taattaccgaaagatatattgccttcaatcaagagttattaatttgattc ttataaagtatatgcttataagaaaaataaatatgctcatctttttcgca atcctttgtttactttctaataactaattaccgaaagatatattgccttc aatcaagagttattgatttgattcttataaagaaaatgcttataataaaa ataaatatgctcatctttttcaccactttcgtttactttctaagaactaa ttaccgaaagatatattgccttcaatcaagagttattgatttgattctta taaagaaaatgcttataataaaaaataaatatgctcatctttttcgccat cctttgtttactttctaataactaattaccgaaaggcatattgccttcaa tcaagagttattgatttgatNatttgattcttataaagaaaatgcttata ataaaaataaatatgctcatctttttcgccatcttttgtttactttgtaa gaactaattactgaaagggatattgccttcaatcaagagttattgatttt attcttataaagcacatgcctataataaaaataaatatgctcatcttttc gccatcctttgtttactttgtaagaactaattaccgaaaggtatattgcc tttaatcaagagttattgatttaattcttataaagtagatgtttataatg aaaataaatatgctcttctttttcgccatcctttgtttactttgtaagaa ctaattaccgaaaggcatattgccttcaatcaagagttattgattagatt cttataaagtagatgcctATAATTGTTCATCGAAAGTGTGCATAGAATTA CCTGCGTTTGAAAACTTAATCCACAAATTAACGcacaacagaaaaaaaca aaaaaacccgaagggaaaaataacgaaaaacgtCCGCCGCGCATTTAGCG AAAGCCACTTGCTAGTTTGGTAAGCTATAAACGTTGCCGGATAATTACGG AACACTAATTAACCGGAAGACCGATTACAAAACACAAACGCAAAaatcga gattcctgtccaatatccttgcgtgaagctatgtagGCCGCCCTACGCTC GCAAGCTCGCTACGGGCGGCAATAACACACCCCCGTATCACAAACCTGGT GGGCCCTCCGAGCCACTGAAAAAtctggccaaaatttcttcccggtggga aaattacctttttcagccccactgggaaattgactttgacttCATCCCAC TTTGAAAATTAATTGCaaaatgcactccaaaaccattcctattagaattt ctatccccattgggatttcgacgGAAAGTTTTATCTCGACCttgtgggaa aaagtttcactgGGACTGTGAGACAGAGGTATTATGACAATACGGAGTCA ATCTCTCGAGTTGGGGAGACTTAATTTATTTTGGTCTAACAGTCCCTTGT TTTTGCAGGTTTTGACTTCTTTTGCTGGGTcttctttatttaaaaactag gGCTCATTATTGAGGGCcaaatcactaaaataaaactcgtacacaatttt ataaatcaaaaataaatcaaaaataaatcataaatcaaaaataaatcata aatcaaaaataaataaaaaataaatcagaaataaatcataaataaatcaa aaataaatcaaaaatctttcgaaaaaaaattgacttttcaacttttttta attttttgacaatAATTTTGAGTATCAGTTCgttataattgaaaaaaaaa ttcgataaaattactcctattcataaattagaaataaataaaaaataatg aaaaattaatcaaaaataaatcataaatcaaaaataaatcaaaaataaat cataaatcaaaaataaatcagaaataaatcataaatcaaaaataaatcat ataaatcaaaaataaatcataaatctcgtacaccatttTTCGATTGATTT GCCCCTCGCTCATTATAATATTGTCATCTATCGAAATAATAAATTTTCCC TttatataatataaatatattCTACTAACAGTTAAATTTATCTCTTCATT TAGGTATGTTTAACATTGACAGCAAAGAAAATGGCAGCCAAGAATTGTTT AGTCAAACATTTGGAAGCTGTAGAAACCCTGGGAAGTACTTCTGTTATTT GCTCAGATAAAACTGGAACATTGACACAAAATCGTATGACCGTTGGTAAG TAGATGATTCTATAATCAAAGTATCCTCTCTTTTCCTGAAAACTCCCCAA AAGAAACTGCATCAAccggacgacgccgggacggcaTGTGTATATTTTAA AAGATCAAAATATTTCGAacagttaaagatttttcattatTAATTGATTG ACAATTTACAATACCAGTTTTGAAATTTCCTTTTCCTCCCTACACCCCTT AcacaaattataaaattttgtcTTACTCAGCTTTTTTCAATACTTGAATA GGCTCTCAATAAAGCTATGGACTGTCTTCTTCTAAGGACTATAACCATAT CTTTATTCTTTATAGCACACATGTGGTTTGACAAGATGATTATTGAAGCT GACACGACTGAAGATCAATCAGGACTTTCACATGACAAAGGTTCATCTAC ATGGAAAGCCCTTGCCAAAATTGGTGGTCTGTGCAATCGTGCCGAGTTCA AAGAAGGACAGGAAGATTTACCCATATTAAGGTACATCCTCCTCTTATCT TTCATTATATCGCAGCGTAGACAGGCGGGGCGCAAATTTTGTGTAGGAGA GTAAATTTTGTAGAAACTCTGATTGgggttttccagaaaaaaaccgtgca ccccctgttgaggagttccaaccttttgtgacctacccccttggaattcc aggcaattttaggatcacacccctctggaattccgaatttttacaaattt tcaatcattacccccttgaaattccgcttatttttgacggattttcgtct acccttatggaattccactgcatttcaaaccttacccccttggaacggaa atggacctcctcaacagggggtatttgatttttttctggaaaagcccatt atctttttacattatgaacagataattacagtgtcataaaaatctgctat CCTACACAAACTTTGcgccctcctgtctacgctactgtatCGTTTTAAAT AATTTACTCCTATCTTGACTATCGAGCAAACGTACTTTACTATCAGCTTG AGTATGGTATCTGTGAATGGTATTAAATAGTTCTTTCGTCTCAGACAGAT TTCCGTCTCAAAATACGACTTATTTAAGCGAATCTTCAAGCAGATGAGAT AGAGTTtctataagatactttaatttGTGGTCATTTGAATTGAAGTAATA AAAANGGAGCTtctataagatactttaatttttggtcatttgaattgaag taataaaaatgatgcgttctttagaaaaagtaacaaaattgttttattat taattaacgaccaaccaaatcaaataagagcttgtaaaaactccacctCG TCCCGTTTCAAGAAAATGTGTTAATTTGCTGCGTAAAATCTATCTTCCTT CTCAGACAAGAACTTTGCTTTGATCAATGTACAAAGGAGCTAACATTTAC ATAAGACATCTTTAAATACCCTTGGAAAATTGAAATCGTGTTCAGAGGTA AGACAAGCCAAAATTCACTACTTTAAATTTCCATTTACAGGAAAGAGTGT AACGGTGATGCTTCAGAGActgctattttgaaatttgttgaacTGTCTGT CGGCAATGTTATGGATATGCGTTCTAAGAATGGAAAGGTTGTTGAAATCC CATTCAATTCAACCAACAAATATCAAGTATCTATCCACAAACAAGAAGAT GAGAAAGACCCCCGATATCTTTTGGTTATGAAAGGTGCTCCTGAACGAAT TCTAGACAGATGTAAGTGTTTTAATCTTTGTGTTAAGTAAGTCTGTGACC GCTCCACTTAcctttgatccttctcttaatttctgagcatcaagtagaga tgcatcaagtaccatttttggaatctttggGGTGCAACCTCTtgctgggg attgaacccacaaccttgtgcaCCGTAGGATGAATGCTCTACCACTTCAC TACGGTCGCTTAAAATAAAGTTTACTGAAAATTAGGCTACACCTCGCAGA TTTCCCATATTCAGGTATCATTCAATTACATCTTCACAAAAATTAGGATG AAGATCTCTTAAAATTTCGATGATATATTCAGTCTTCTGTCATATTCAAT CTTTGATTAAGATCTTTTCTGTTCTTTCCGAAGGTTCAACAATCTTGCTC CAAGGTGAAGAGAAACCATTGGATGATGAAATGAAGGACGCATTCAATGA TGCATATCTTCAACTTGGTGGTCTTGGTGAACGCGTCTTGGGATTCTGCC ATTACTATCTTCCTGGTAAAAAACTTTCTAAAAGTAGTTTTAAAGACCGT TCGTTTTAAGTTAACTCTTTTTTGAAGCCATATTGCAACCCTTCTCAAGG AAACTGACTAATTATGCTGACATGGTAAAACGCAAAACAGAGTGTCATTT CCATTATTAGGACACATCATACGCGCTCTTTGATAACTTCTATACCTTGC CCATCTTTATATACTTGATTCATTATTTTACCATCAGCTGAAAACTTTCC TGAAGGATTCGAGTTTCAAACAGATGATCCATGTAATTTCCCACTTGATA ACCTATGTTTCGTTGGTTTGATGAGTATGATTGATCCTCCAAGAGCTGCT GTGCCCGATGCTGTCAGCAAGTGCCGAAGTGCAGGTAGCTTTTATACTGT TATTGATCTTAGAATCCACTAACTTCATGATTTAAACTGTTCAAAACCCT TTTAACTGCAAATTAGATTCGCTTATTAGAGATTGGTGAAGTTTTAACGG ATTTTTTGGTCGTTTACCAAATTGTGTTGGATCTGTAGAATCTGTATATG TTTGACATCCCACTATTAGTACTGAAAGGGCCCATGAGTCTGATATTGAT TCACTCACTTCATAAGATCTACCCCGTGGACTTCTCCCTCTAAATGGCTA CATACACTACTCAATATATTATCAGGCAATATATATATATTGGTGAGAGC CGTCAACGGAGTATctgttattaaaaatttacattacggTCATCAAACTA TATTGCCACATATTGTCCACTCATTATATTGTGTAGTAGCTCTTAAGCGT CGTAAAACAACCACGCTGTAAACTAGGCTTTTCTAtaaagtttcttttct ttttcgtcTAGGAATCAAGGTCATCATGGTTACAGGTGATCATCCAATCA CAGCAAAAGCTATCGCCAAAGGTGTCGGCATCATCTCCGAAGGAAATGAG ACTGTTGAAGACATTGCTCAACGCTTGAATATTCCTGTTGAAGAAGTCAA TCCTCGTGATGCACACGCTGCTGTTGTCCATGGAAGTATGTCCTGAATTG TATTCCTTGTCTATGAAATACGAAAGATTTTGAATCTGGACAGCCTTTCC TTTCAATTTGCATTACGTTCGATTCTGTAAAATTACGCTACAGGTTTTTT TACGGAAATGCTCttgaaaattattaaatttgaatttggaaagaatGTTT CGAAAGAATTGCGGCCTCTGTAATCAATTTACCTAAGTAGTTAGTCTATT CAGCTGTCTTTTGAGGTCATATTTCAAAGCTCATAATAATAACTTCCATC AATGCTATGAATTGTTTACTGTTTGGATTTATATGATCTAAGATATCTAC TACTATGTTCTTGGACAGTATCTCAAACAAACAAAAGTTGTCAACATTAG ATACACACTTACTTCGTATAATGTACCAAACACAATATCTTTAAGAATTA ATCTGGTTTGTTCTCTTTCCAGCTCAACTGAAAGACTTGTCAGCGGAGGA CATTGACGACATTTTGAAATACCACACTGAAATTGTGTTTGCCAGGACTT CACCACAACAAAAATTGATCATTGTTGAAGGATGTCAACGTCAAGGAGCT ATCGTTGCTGTCACCGGAGATGGTGTTAATGATTCGCCTGCTTTGAAGAA AGCTGATATCGGTAGGTGGtcgaaattatattgttttacTTGAGGTTCTT GCttgtttgaagttgttcgattgataTCAATAAAATAAGATCTTACAAAG TTTTTcacatttcaaaataatataatcTGTGAGAGAGTTTCCCTGTAGGT GGATTCCCGTGGAAAGGCTTTAAACGTTTTGGTGAAGACTGAGCCATCTT TAAGATTGGGAATGACACTTCTTTAATATTACTTCCAGTGGGGTGTCTTG TACGGATTCAATCATCAATGACCAGTATAATCTTCACTTCGACTTTCTTG GTTTACAGGTGTTGCTATGGGGATTGCTGGCTCAGACGTTTCAAAACAAG CAGCTGACATGATCTTATTGGATGACAATTTCGCTTCCATTGTCACCGGA GTTGAAGAAGGACGTCTCATTTTTGACAATCTCAAAAAATCAATTGCTTA CACCTTAACCAGTAACATTCCAGAGATCTCGCCGTTCTTGATGTTTATTT TGCTCAGTATTCCACTCCCTCTTGGTACTGTCACCATTCTGTGCATCGAT TTAGGCACTGACTTGATACCCGCCATTTCTCTTGCTTACGAGAAGGCTGA GACTGACATCATGAAACGTAAACCACGTGACCCTATACGTGATAAATTGG TGAATGAACGTTTGATCAGTTTGGCGTACGGTCAAATTGGTATGATCCAG GTAAAATGATGCATTCTTCTACAAGTTATATTGATTCTCTTCTTCATACT GTTGTTATCATTTGATCAGTATTTGTAAGgtcttattcttttatattccG CCCTAGCANCTTCATACTGTTGTTATCATTTGATCAGTATTTGTAAGgtc ttattcttttatattccACCCTAGCAACGGAAGAACAAAATACTGTTCAC CGTAAACTAATCAAAGCTTATCACTCAAAGTTGGGGTGTCTAGTTAAGAC CATACTAGAAAAATGGCCAAAGATCATCCCAGCTGAGAAAGTCAACCTCA AGTTTAATGCCCATTAAAAAAACTACACAGATGTAATCATCTATGTTGTA GACATTTTCTAAAAGcgttcattaaatttttcactgATATCTTTTATTGA CATTTTGTTTTCATCATCTCACAGGCTATTGCTGGTTTTTTCACCTACTT TGTGATCATGGCTGAGAATGGTTTCTTGCCATCCTTCCTAATGGGTATCC GATCCCAATGGGATGACAAAAACAATAATTCAGTCATCGATTCTTACGGT AGCGAATGGACGTACTCTCAACGCAAAGATTTGGAGTTGACTTGTCACAC AGCTTTCTTTACTACCATCGTTGTTGTCCAATGGGCTGACGTCATCATCT CCAAAACAAGACGTCTCTCCGTATTTACGCAAGGAATGACGTAAGCATGA ATTTTTCAAACCATTCAAGTCTCTTTGTATTACGGTTATAAAGATATGAA TATACTTTCTATAGATCTTCCAAAATTATAGATCTCTTTATACTACNAAA GATATGAATATACTTTCTATAAATCTTCCAAAATTATAGATCTCTTTATA CTACGTTTGGTTTTGTAGCTTTAGTCTCCCTCCCCCAGACCACCTAAATT ATGCATCTAAAgctaaagtttttaaattttcgttcAAAAGGCTATTCCAG AAAACAATTTGTATttcctatgttgaggaggtttTTTTCAATCCCCTTAG AtttggtttttctaattttttagaCCACCTTGGATTTTGTACCtcatttt actgattttttattttcaagaccACCCTGGACGCCACAACTCCTCAAAAT ACTGGGTACACActatttttggaatagcccaataagaCAAGCTTTACCTC AAGTTTTAGGCATTTTTTTAACTGGATGTTTTTTAACTTAGCTCTGAATT TGCATTAAAagagagatttttttctctttagaaACTGGATGTTGAATTTT GGTTTGGTTTTCGAAACTTTATTAGCTGCCTTCTTGCAATACACACCAGG TTTGAGTACTGGCTTACGTTTACGCCCATTGAACGCCTCGTGGTGGTTCT GTGGTGTCCCTTTTTCCTTGTTGATCTGGATTTATGATGAAATCAGAAGA TATTTGTTAAGAAAGTATCCTGGaggtgagaaattttttttttgcttaca cgtttttttttataagaacaaactatataaaaacataaggcttcgaggcc caaaaatttaagaacattctaagaacattttaaggctttggagacttaaa aacatgcattttcttaagaaattacatcaaaatgctcaaaaaatgctgaa aataagaacattaaaaaaaaaaaacgtgtatgtaatTACATATTTCACTT CCTAAGCGCTGGTAACCTTCAGGTGTAGTGGTGTAAAATCCCGTTCTAAA GCTAAAGGGTGGGATAGAGTTACCCAGAGAATCACTTTAAGGGAGGGGTA ATGGAAAGGGGCCTTATTAAGGGTGATATAGATTTTCATATCTAGGGGTA GGGTTAAGAATTTTAGGATATTATTTTGTGAAGATAGAttataaagcttt tttaagaattattttaaagttGTTAACCGCCATAAAGCAAGAGTTTCAAG GGAAGGGAtaattcgaaaaatgttttttcagagggaatttaattccGCGG ACGAAGGATATTTTCTGGCCAAAAAcgcttttaaataaaaatatagcAAA CATTTGGGGGGGGGGAGTGAATGCGGTAATTcaaatttgacgggaattta atttggcggataacAGAAAAGATTTCTTCCCTAAAGGTAGAGGGAGAAAC AGAATAatcatatttattttgaataacgatatatttctttcatttcaaaG GATGGGTGGAGCAAGAGACATATTATTAAAGAAACACGACAAAAGCACTC ACTCCCGAAGAAAATAGTGCCAACACTTAAATTATATCCCTAATCTTTCT AggcattttttgagtttttaagttattaattttttttaggatcTAAGACT TTTAGGCATTTTATTTATTCTTACAGtagcttttttcacatttcttaTGC ATCATATTAAATAAACATAAATTTCGATTAAAATTATATTTGGTCCGTTT TTTTAAGATACATTGTCCTGTAAAAGTTTGAGCATTATTAAATATCTAGA AAATTAAACGAATTAATCTGAAAAAATACTTCTATGAAATTATTTTAAGA GAATTATATTATACGTGTCTACAGATTTGATGAAAGAAACATGTTCATTC AAGATGGCACTCCCTTTCAAGATATTCCCTCCAACTAGCTGACGATTTGT GATCTAAAATTTTATTCATTCAATTATTTTATCTTCA

Coding sequence (CDS) from alignment at sc0000010:1110798..1128334+

>TCONS_00001405 ID=TCONS_00001405|Name=TCONS_00001405|organism=Clytia hemisphaerica|type=CDS|length=54723bp|location=Sequence derived from alignment at sc0000010:1110798..1128334+ (Clytia hemisphaerica)
atggctgacgaagGAAAAGAAGAACTAACGAAAAATGAAGCAGAAACGCC
TCAAGATCCTGCTGTAGAAGCGCCAACTGTAGAAAACGATAACACAGAAC
AAAAGGGGGATGGAGATGATACAAGTAATAGCAGTTATATTGTGGCAGTT
AAATCCAACACAAACTCTAAAGCTGAAGGTGACAAAAAAGATGCCGCAAT
TTCTAAAAagaacaagaaaacaaaaaagaaagatgACTTAAATGACTTAA
AGAAAGAACTTGAGCTAACTTGTCATAGTGAAAATTTGGATGATCTTATT
GCTCAATATGAAACAAACCTTACAACCGGTCTGACTAAAGAGATTGCTGC
TCGAAACCTTGAACGTGATGGCCCAAATGCTCTCTCCCCTCCAAAACAAA
CACCTGAATGGATCAAATTTTGTAAACAATTATTTGGGGGGTTTTCAATG
TTACTTTGGGTTGGTGCAATCCTTTGTTTCTTTGCTTATGGTATTCGAAC
AGTCAGAGAGGATGATCCGAGTCAAGATGAGTTATATCTTGGAATTGTAC
TTGCTGTTGTTGTCATTATTACTGGTTGTTTCTCTTATTATCAAGAAGCC
AAAAGTTCAAAGATCATGGAAAGTTTTAAGAAGATGATCCCACAGGAGGC
TACAGTATTACGTGATGGGGCAAAGATTCAAATCAATGCGGAAGAATGTA
CCATTGGAGACATAGTATTTGTTAAGTTTGGTGACCGTATCCCTGCGGAT
ATTCGTGTTATCGAGTCAATGGGTTTCAAGGTTGACAACTCTTCATTGAC
TGGTGAATCTGAACCACAATCTAGAAACAGTGAATGTACTTCAGAGAATC
CTTTGGAAACCAAAAACTTGGCTTTCTTTTCCACAAACGCTGTTGAAGgt
ACTGCGACTGGTATGGTCGTTAACATTGGTGATAACACTGTCATGGGACG
TATTGCCAACTTGGCTTCTGGTCTCGGCGCTGGTAAAACGCCTATTGCTC
TTGAATTGGAACATTTTATTCATATCATTACTGGAGTTGCAGTGTTCCTT
GGTGTGACATTCCTCATCATTTCACTTGCTATGGATTACCATTGGTTAGA
AGCGATCATCTTTTTGATTGGTATTATTGTAGCTAACGTCCCTGAAGGTC
TACTTGCCACTGTCACAGTATGTTTAACATTGACAGCAAAGAAAATGGCA
GCCAAGAATTGTTTAGTCAAACATTTGGAAGCTGTAGAAACCCTGGGAAG
TACTTCTGTTATTTGCTCAGATAAAACTGGAACATTGACACAAAATCGTA
TGACCGTTGCACACATGTGGTTTGACAAGATGATTATTGAAGCTGACACG
ACTGAAGATCAATCAGGACTTTCACATGACAAAGGTTCATCTACATGGAA
AGCCCTTGCCAAAATTGGTGGTCTGTGCAATCGTGCCGAGTTCAAAGAAG
GACAGGAAGATTTACCCATATTAAGGAAAGAGTGTAACGGTGATGCTTCA
GAGActgctattttgaaatttgttgaacTGTCTGTCGGCAATGTTATGGA
TATGCGTTCTAAGAATGGAAAGGTTGTTGAAATCCCATTCAATTCAACCA
ACAAATATCAAGTATCTATCCACAAACAAGAAGATGAGAAAGACCCCCGA
TATCTTTTGGTTATGAAAGGTGCTCCTGAACGAATTCTAGACAGATGTTC
AACAATCTTGCTCCAAGGTGAAGAGAAACCATTGGATGATGAAATGAAGG
ACGCATTCAATGATGCATATCTTCAACTTGGTGGTCTTGGTGAACGCGTC
TTGGGATTCTGCCATTACTATCTTCCTGCTGAAAACTTTCCTGAAGGATT
CGAGTTTCAAACAGATGATCCATGTAATTTCCCACTTGATAACCTATGTT
TCGTTGGTTTGATGAGTATGATTGATCCTCCAAGAGCTGCTGTGCCCGAT
GCTGTCAGCAAGTGCCGAAGTGCAGGAATCAAGGTCATCATGGTTACAGG
TGATCATCCAATCACAGCAAAAGCTATCGCCAAAGGTGTCGGCATCATCT
CCGAAGGAAATGAGACTGTTGAAGACATTGCTCAACGCTTGAATATTCCT
GTTGAAGAAGTCAATCCTCGTGATGCACACGCTGCTGTTGTCCATGGAAC
TCAACTGAAAGACTTGTCAGCGGAGGACATTGACGACATTTTGAAATACC
ACACTGAAATTGTGTTTGCCAGGACTTCACCACAACAAAAATTGATCATT
GTTGAAGGATGTCAACGTCAAGGAGCTATCGTTGCTGTCACCGGAGATGG
TGTTAATGATTCGCCTGCTTTGAAGAAAGCTGATATCGGTGTTGCTATGG
GGATTGCTGGCTCAGACGTTTCAAAACAAGCAGCTGACATGATCTTATTG
GATGACAATTTCGCTTCCATTGTCACCGGAGTTGAAGAAGGACGTCTCAT
TTTTGACAATCTCAAAAAATCAATTGCTTACACCTTAACCAGTAACATTC
CAGAGATCTCGCCGTTCTTGATGTTTATTTTGCTCAGTATTCCACTCCCT
CTTGGTACTGTCACCATTCTGTGCATCGATTTAGGCACTGACTTGATACC
CGCCATTTCTCTTGCTTACGAGAAGGCTGAGACTGACATCATGAAACGTA
AACCACGTGACCCTATACGTGATAAATTGGTGAATGAACGTTTGATCAGT
TTGGCGTACGGTCAAATTGGTATGATCCAGGCTATTGCTGGTTTTTTCAC
CTACTTTGTGATCATGGCTGAGAATGGTTTCTTGCCATCCTTCCTAATGG
GTATCCGATCCCAATGGGATGACAAAAACAATAATTCAGTCATCGATTCT
TACGGTAGCGAATGGACGTACTCTCAACGCAAAGATTTGGAGTTGACTTG
TCACACAGCTTTCTTTACTACCATCGTTGTTGTCCAATGGGCTGACGTCA
TCATCTCCAAAACAAGACGTCTCTCCGTATTTACGCAAGGAATGACaaAC
TGGATGTTGAATTTTGGTTTGGTTTTCGAAACTTTATTAGCTGCCTTCTT
GCAATACACACCAGGTTTGAGTACTGGCTTACGTTTACGCCCATTGAACG
CCTCGTGGTGGTTCTGTGGTGTCCCTTTTTCCTTGTTGATCTGGATTTAT
GATGAAATCAGAAGATATTTGTTAAGAAAGTATCCTGGagGATGGGTGGA
GCAAGAGACATATTATTAAatggctgacgaagGAAAAGAAGAACTAACGA
AAAATGAAGCAGAAACGCCTCAAGATCCTGCTGTAGAAGCGCCAACTGTA
GAAAACGATAACACAGAACAAAAGGGGGATGGAGATGATACAAGTAATAG
CAGTTATATTGTGGCAGTTAAATCCAACACAAACTCTAAAGCTGAAGGTG
ACAAAAAAGATGCCGCAATTTCTAAAAagaacaagaaaacaaaaaagaaa
gatgACTTAAATGACTTAAAGAAAGAACTTGAGCTAACTTGTCATAGTGA
AAATTTGGATGATCTTATTGCTCAATATGAAACAAACCTTACAACCGGTC
TGACTAAAGAGATTGCTGCTCGAAACCTTGAACGTGATGGCCCAAATGCT
CTCTCCCCTCCAAAACAAACACCTGAATGGATCAAATTTTGTAAACAATT
ATTTGGGGGGTTTTCAATGTTACTTTGGGTTGGTGCAATCCTTTGTTTCT
TTGCTTATGGTATTCGAACAGTCAGAGAGGATGATCCGAGTCAAGATGAG
TTATATCTTGGAATTGTACTTGCTGTTGTTGTCATTATTACTGGTTGTTT
CTCTTATTATCAAGAAGCCAAAAGTTCAAAGATCATGGAAAGTTTTAAGA
AGATGATCCCACAGGAGGCTACAGTATTACGTGATGGGGCAAAGATTCAA
ATCAATGCGGAAGAATGTACCATTGGAGACATAGTATTTGTTAAGTTTGG
TGACCGTATCCCTGCGGATATTCGTGTTATCGAGTCAATGGGTTTCAAGG
TTGACAACTCTTCATTGACTGGTGAATCTGAACCACAATCTAGAAACAGT
GAATGTACTTCAGAGAATCCTTTGGAAACCAAAAACTTGGCTTTCTTTTC
CACAAACGCTGTTGAAGgtACTGCGACTGGTATGGTCGTTAACATTGGTG
ATAACACTGTCATGGGACGTATTGCCAACTTGGCTTCTGGTCTCGGCGCT
GGTAAAACGCCTATTGCTCTTGAATTGGAACATTTTATTCATATCATTAC
TGGAGTTGCAGTGTTCCTTGGTGTGACATTCCTCATCATTTCACTTGCTA
TGGATTACCATTGGTTAGAAGCGATCATCTTTTTGATTGGTATTATTGTA
GCTAACGTCCCTGAAGGTCTACTTGCCACTGTCACAGTATGTTTAACATT
GACAGCAAAGAAAATGGCAGCCAAGAATTGTTTAGTCAAACATTTGGAAG
CTGTAGAAACCCTGGGAAGTACTTCTGTTATTTGCTCAGATAAAACTGGA
ACATTGACACAAAATCGTATGACCGTTGCACACATGTGGTTTGACAAGAT
GATTATTGAAGCTGACACGACTGAAGATCAATCAGGACTTTCACATGACA
AAGGTTCATCTACATGGAAAGCCCTTGCCAAAATTGGTGGTCTGTGCAAT
CGTGCCGAGTTCAAAGAAGGACAGGAAGATTTACCCATATTAAGGAAAGA
GTGTAACGGTGATGCTTCAGAGActgctattttgaaatttgttgaacTGT
CTGTCGGCAATGTTATGGATATGCGTTCTAAGAATGGAAAGGTTGTTGAA
ATCCCATTCAATTCAACCAACAAATATCAAGTATCTATCCACAAACAAGA
AGATGAGAAAGACCCCCGATATCTTTTGGTTATGAAAGGTGCTCCTGAAC
GAATTCTAGACAGATGTTCAACAATCTTGCTCCAAGGTGAAGAGAAACCA
TTGGATGATGAAATGAAGGACGCATTCAATGATGCATATCTTCAACTTGG
TGGTCTTGGTGAACGCGTCTTGGGATTCTGCCATTACTATCTTCCTGCTG
AAAACTTTCCTGAAGGATTCGAGTTTCAAACAGATGATCCATGTAATTTC
CCACTTGATAACCTATGTTTCGTTGGTTTGATGAGTATGATTGATCCTCC
AAGAGCTGCTGTGCCCGATGCTGTCAGCAAGTGCCGAAGTGCAGGAATCA
AGGTCATCATGGTTACAGGTGATCATCCAATCACAGCAAAAGCTATCGCC
AAAGGTGTCGGCATCATCTCCGAAGGAAATGAGACTGTTGAAGACATTGC
TCAACGCTTGAATATTCCTGTTGAAGAAGTCAATCCTCGTGATGCACACG
CTGCTGTTGTCCATGGAACTCAACTGAAAGACTTGTCAGCGGAGGACATT
GACGACATTTTGAAATACCACACTGAAATTGTGTTTGCCAGGACTTCACC
ACAACAAAAATTGATCATTGTTGAAGGATGTCAACGTCAAGGAGCTATCG
TTGCTGTCACCGGAGATGGTGTTAATGATTCGCCTGCTTTGAAGAAAGCT
GATATCGGTGTTGCTATGGGGATTGCTGGCTCAGACGTTTCAAAACAAGC
AGCTGACATGATCTTATTGGATGACAATTTCGCTTCCATTGTCACCGGAG
TTGAAGAAGGACGTCTCATTTTTGACAATCTCAAAAAATCAATTGCTTAC
ACCTTAACCAGTAACATTCCAGAGATCTCGCCGTTCTTGATGTTTATTTT
GCTCAGTATTCCACTCCCTCTTGGTACTGTCACCATTCTGTGCATCGATT
TAGGCACTGACTTGATACCCGCCATTTCTCTTGCTTACGAGAAGGCTGAG
ACTGACATCATGAAACGTAAACCACGTGACCCTATACGTGATAAATTGGT
GAATGAACGTTTGATCAGTTTGGCGTACGGTCAAATTGGTATGATCCAGG
CTATTGCTGGTTTTTTCACCTACTTTGTGATCATGGCTGAGAATGGTTTC
TTGCCATCCTTCCTAATGGGTATCCGATCCCAATGGGATGACAAAAACAA
TAATTCAGTCATCGATTCTTACGGTAGCGAATGGACGTACTCTCAACGCA
AAGATTTGGAGTTGACTTGTCACACAGCTTTCTTTACTACCATCGTTGTT
GTCCAATGGGCTGACGTCATCATCTCCAAAACAAGACGTCTCTCCGTATT
TACGCAAGGAATGACaaACTGGATGTTGAATTTTGGTTTGGTTTTCGAAA
CTTTATTAGCTGCCTTCTTGCAATACACACCAGGTTTGAGTACTGGCTTA
CGTTTACGCCCATTGAACGCCTCGTGGTGGTTCTGTGGTGTCCCTTTTTC
CTTGTTGATCTGGATTTATGATGAAATCAGAAGATATTTGTTAAGAAAGT
ATCCTGGagGATGGGTGGAGCAAGAGACATATTATTAAatggctgacgaa
gGAAAAGAAGAACTAACGAAAAATGAAGCAGAAACGCCTCAAGATCCTGC
TGTAGAAGCGCCAACTGTAGAAAACGATAACACAGAACAAAAGGGGGATG
GAGATGATACAAGTAATAGCAGTTATATTGTGGCAGTTAAATCCAACACA
AACTCTAAAGCTGAAGGTGACAAAAAAGATGCCGCAATTTCTAAAAagaa
caagaaaacaaaaaagaaagatgACTTAAATGACTTAAAGAAAGAACTTG
AGCTAACTTGTCATAGTGAAAATTTGGATGATCTTATTGCTCAATATGAA
ACAAACCTTACAACCGGTCTGACTAAAGAGATTGCTGCTCGAAACCTTGA
ACGTGATGGCCCAAATGCTCTCTCCCCTCCAAAACAAACACCTGAATGGA
TCAAATTTTGTAAACAATTATTTGGGGGGTTTTCAATGTTACTTTGGGTT
GGTGCAATCCTTTGTTTCTTTGCTTATGGTATTCGAACAGTCAGAGAGGA
TGATCCGAGTCAAGATGAGTTATATCTTGGAATTGTACTTGCTGTTGTTG
TCATTATTACTGGTTGTTTCTCTTATTATCAAGAAGCCAAAAGTTCAAAG
ATCATGGAAAGTTTTAAGAAGATGATCCCACAGGAGGCTACAGTATTACG
TGATGGGGCAAAGATTCAAATCAATGCGGAAGAATGTACCATTGGAGACA
TAGTATTTGTTAAGTTTGGTGACCGTATCCCTGCGGATATTCGTGTTATC
GAGTCAATGGGTTTCAAGGTTGACAACTCTTCATTGACTGGTGAATCTGA
ACCACAATCTAGAAACAGTGAATGTACTTCAGAGAATCCTTTGGAAACCA
AAAACTTGGCTTTCTTTTCCACAAACGCTGTTGAAGgtACTGCGACTGGT
ATGGTCGTTAACATTGGTGATAACACTGTCATGGGACGTATTGCCAACTT
GGCTTCTGGTCTCGGCGCTGGTAAAACGCCTATTGCTCTTGAATTGGAAC
ATTTTATTCATATCATTACTGGAGTTGCAGTGTTCCTTGGTGTGACATTC
CTCATCATTTCACTTGCTATGGATTACCATTGGTTAGAAGCGATCATCTT
TTTGATTGGTATTATTGTAGCTAACGTCCCTGAAGGTCTACTTGCCACTG
TCACAGTATGTTTAACATTGACAGCAAAGAAAATGGCAGCCAAGAATTGT
TTAGTCAAACATTTGGAAGCTGTAGAAACCCTGGGAAGTACTTCTGTTAT
TTGCTCAGATAAAACTGGAACATTGACACAAAATCGTATGACCGTTGCAC
ACATGTGGTTTGACAAGATGATTATTGAAGCTGACACGACTGAAGATCAA
TCAGGACTTTCACATGACAAAGGTTCATCTACATGGAAAGCCCTTGCCAA
AATTGGTGGTCTGTGCAATCGTGCCGAGTTCAAAGAAGGACAGGAAGATT
TACCCATATTAAGGAAAGAGTGTAACGGTGATGCTTCAGAGActgctatt
ttgaaatttgttgaacTGTCTGTCGGCAATGTTATGGATATGCGTTCTAA
GAATGGAAAGGTTGTTGAAATCCCATTCAATTCAACCAACAAATATCAAG
TATCTATCCACAAACAAGAAGATGAGAAAGACCCCCGATATCTTTTGGTT
ATGAAAGGTGCTCCTGAACGAATTCTAGACAGATGTTCAACAATCTTGCT
CCAAGGTGAAGAGAAACCATTGGATGATGAAATGAAGGACGCATTCAATG
ATGCATATCTTCAACTTGGTGGTCTTGGTGAACGCGTCTTGGGATTCTGC
CATTACTATCTTCCTGCTGAAAACTTTCCTGAAGGATTCGAGTTTCAAAC
AGATGATCCATGTAATTTCCCACTTGATAACCTATGTTTCGTTGGTTTGA
TGAGTATGATTGATCCTCCAAGAGCTGCTGTGCCCGATGCTGTCAGCAAG
TGCCGAAGTGCAGGAATCAAGGTCATCATGGTTACAGGTGATCATCCAAT
CACAGCAAAAGCTATCGCCAAAGGTGTCGGCATCATCTCCGAAGGAAATG
AGACTGTTGAAGACATTGCTCAACGCTTGAATATTCCTGTTGAAGAAGTC
AATCCTCGTGATGCACACGCTGCTGTTGTCCATGGAACTCAACTGAAAGA
CTTGTCAGCGGAGGACATTGACGACATTTTGAAATACCACACTGAAATTG
TGTTTGCCAGGACTTCACCACAACAAAAATTGATCATTGTTGAAGGATGT
CAACGTCAAGGAGCTATCGTTGCTGTCACCGGAGATGGTGTTAATGATTC
GCCTGCTTTGAAGAAAGCTGATATCGGTGTTGCTATGGGGATTGCTGGCT
CAGACGTTTCAAAACAAGCAGCTGACATGATCTTATTGGATGACAATTTC
GCTTCCATTGTCACCGGAGTTGAAGAAGGACGTCTCATTTTTGACAATCT
CAAAAAATCAATTGCTTACACCTTAACCAGTAACATTCCAGAGATCTCGC
CGTTCTTGATGTTTATTTTGCTCAGTATTCCACTCCCTCTTGGTACTGTC
ACCATTCTGTGCATCGATTTAGGCACTGACTTGATACCCGCCATTTCTCT
TGCTTACGAGAAGGCTGAGACTGACATCATGAAACGTAAACCACGTGACC
CTATACGTGATAAATTGGTGAATGAACGTTTGATCAGTTTGGCGTACGGT
CAAATTGGTATGATCCAGGCTATTGCTGGTTTTTTCACCTACTTTGTGAT
CATGGCTGAGAATGGTTTCTTGCCATCCTTCCTAATGGGTATCCGATCCC
AATGGGATGACAAAAACAATAATTCAGTCATCGATTCTTACGGTAGCGAA
TGGACGTACTCTCAACGCAAAGATTTGGAGTTGACTTGTCACACAGCTTT
CTTTACTACCATCGTTGTTGTCCAATGGGCTGACGTCATCATCTCCAAAA
CAAGACGTCTCTCCGTATTTACGCAAGGAATGACaaACTGGATGTTGAAT
TTTGGTTTGGTTTTCGAAACTTTATTAGCTGCCTTCTTGCAATACACACC
AGGTTTGAGTACTGGCTTACGTTTACGCCCATTGAACGCCTCGTGGTGGT
TCTGTGGTGTCCCTTTTTCCTTGTTGATCTGGATTTATGATGAAATCAGA
AGATATTTGTTAAGAAAGTATCCTGGagGATGGGTGGAGCAAGAGACATA
TTATTAAatggctgacgaagGAAAAGAAGAACTAACGAAAAATGAAGCAG
AAACGCCTCAAGATCCTGCTGTAGAAGCGCCAACTGTAGAAAACGATAAC
ACAGAACAAAAGGGGGATGGAGATGATACAAGTAATAGCAGTTATATTGT
GGCAGTTAAATCCAACACAAACTCTAAAGCTGAAGGTGACAAAAAAGATG
CCGCAATTTCTAAAAagaacaagaaaacaaaaaagaaagatgACTTAAAT
GACTTAAAGAAAGAACTTGAGCTAACTTGTCATAGTGAAAATTTGGATGA
TCTTATTGCTCAATATGAAACAAACCTTACAACCGGTCTGACTAAAGAGA
TTGCTGCTCGAAACCTTGAACGTGATGGCCCAAATGCTCTCTCCCCTCCA
AAACAAACACCTGAATGGATCAAATTTTGTAAACAATTATTTGGGGGGTT
TTCAATGTTACTTTGGGTTGGTGCAATCCTTTGTTTCTTTGCTTATGGTA
TTCGAACAGTCAGAGAGGATGATCCGAGTCAAGATGAGTTATATCTTGGA
ATTGTACTTGCTGTTGTTGTCATTATTACTGGTTGTTTCTCTTATTATCA
AGAAGCCAAAAGTTCAAAGATCATGGAAAGTTTTAAGAAGATGATCCCAC
AGGAGGCTACAGTATTACGTGATGGGGCAAAGATTCAAATCAATGCGGAA
GAATGTACCATTGGAGACATAGTATTTGTTAAGTTTGGTGACCGTATCCC
TGCGGATATTCGTGTTATCGAGTCAATGGGTTTCAAGGTTGACAACTCTT
CATTGACTGGTGAATCTGAACCACAATCTAGAAACAGTGAATGTACTTCA
GAGAATCCTTTGGAAACCAAAAACTTGGCTTTCTTTTCCACAAACGCTGT
TGAAGgtACTGCGACTGGTATGGTCGTTAACATTGGTGATAACACTGTCA
TGGGACGTATTGCCAACTTGGCTTCTGGTCTCGGCGCTGGTAAAACGCCT
ATTGCTCTTGAATTGGAACATTTTATTCATATCATTACTGGAGTTGCAGT
GTTCCTTGGTGTGACATTCCTCATCATTTCACTTGCTATGGATTACCATT
GGTTAGAAGCGATCATCTTTTTGATTGGTATTATTGTAGCTAACGTCCCT
GAAGGTCTACTTGCCACTGTCACAGTATGTTTAACATTGACAGCAAAGAA
AATGGCAGCCAAGAATTGTTTAGTCAAACATTTGGAAGCTGTAGAAACCC
TGGGAAGTACTTCTGTTATTTGCTCAGATAAAACTGGAACATTGACACAA
AATCGTATGACCGTTGCACACATGTGGTTTGACAAGATGATTATTGAAGC
TGACACGACTGAAGATCAATCAGGACTTTCACATGACAAAGGTTCATCTA
CATGGAAAGCCCTTGCCAAAATTGGTGGTCTGTGCAATCGTGCCGAGTTC
AAAGAAGGACAGGAAGATTTACCCATATTAAGGAAAGAGTGTAACGGTGA
TGCTTCAGAGActgctattttgaaatttgttgaacTGTCTGTCGGCAATG
TTATGGATATGCGTTCTAAGAATGGAAAGGTTGTTGAAATCCCATTCAAT
TCAACCAACAAATATCAAGTATCTATCCACAAACAAGAAGATGAGAAAGA
CCCCCGATATCTTTTGGTTATGAAAGGTGCTCCTGAACGAATTCTAGACA
GATGTTCAACAATCTTGCTCCAAGGTGAAGAGAAACCATTGGATGATGAA
ATGAAGGACGCATTCAATGATGCATATCTTCAACTTGGTGGTCTTGGTGA
ACGCGTCTTGGGATTCTGCCATTACTATCTTCCTGCTGAAAACTTTCCTG
AAGGATTCGAGTTTCAAACAGATGATCCATGTAATTTCCCACTTGATAAC
CTATGTTTCGTTGGTTTGATGAGTATGATTGATCCTCCAAGAGCTGCTGT
GCCCGATGCTGTCAGCAAGTGCCGAAGTGCAGGAATCAAGGTCATCATGG
TTACAGGTGATCATCCAATCACAGCAAAAGCTATCGCCAAAGGTGTCGGC
ATCATCTCCGAAGGAAATGAGACTGTTGAAGACATTGCTCAACGCTTGAA
TATTCCTGTTGAAGAAGTCAATCCTCGTGATGCACACGCTGCTGTTGTCC
ATGGAACTCAACTGAAAGACTTGTCAGCGGAGGACATTGACGACATTTTG
AAATACCACACTGAAATTGTGTTTGCCAGGACTTCACCACAACAAAAATT
GATCATTGTTGAAGGATGTCAACGTCAAGGAGCTATCGTTGCTGTCACCG
GAGATGGTGTTAATGATTCGCCTGCTTTGAAGAAAGCTGATATCGGTGTT
GCTATGGGGATTGCTGGCTCAGACGTTTCAAAACAAGCAGCTGACATGAT
CTTATTGGATGACAATTTCGCTTCCATTGTCACCGGAGTTGAAGAAGGAC
GTCTCATTTTTGACAATCTCAAAAAATCAATTGCTTACACCTTAACCAGT
AACATTCCAGAGATCTCGCCGTTCTTGATGTTTATTTTGCTCAGTATTCC
ACTCCCTCTTGGTACTGTCACCATTCTGTGCATCGATTTAGGCACTGACT
TGATACCCGCCATTTCTCTTGCTTACGAGAAGGCTGAGACTGACATCATG
AAACGTAAACCACGTGACCCTATACGTGATAAATTGGTGAATGAACGTTT
GATCAGTTTGGCGTACGGTCAAATTGGTATGATCCAGGCTATTGCTGGTT
TTTTCACCTACTTTGTGATCATGGCTGAGAATGGTTTCTTGCCATCCTTC
CTAATGGGTATCCGATCCCAATGGGATGACAAAAACAATAATTCAGTCAT
CGATTCTTACGGTAGCGAATGGACGTACTCTCAACGCAAAGATTTGGAGT
TGACTTGTCACACAGCTTTCTTTACTACCATCGTTGTTGTCCAATGGGCT
GACGTCATCATCTCCAAAACAAGACGTCTCTCCGTATTTACGCAAGGAAT
GACaaACTGGATGTTGAATTTTGGTTTGGTTTTCGAAACTTTATTAGCTG
CCTTCTTGCAATACACACCAGGTTTGAGTACTGGCTTACGTTTACGCCCA
TTGAACGCCTCGTGGTGGTTCTGTGGTGTCCCTTTTTCCTTGTTGATCTG
GATTTATGATGAAATCAGAAGATATTTGTTAAGAAAGTATCCTGGagGAT
GGGTGGAGCAAGAGACATATTATTAAatggctgacgaagGAAAAGAAGAA
CTAACGAAAAATGAAGCAGAAACGCCTCAAGATCCTGCTGTAGAAGCGCC
AACTGTAGAAAACGATAACACAGAACAAAAGGGGGATGGAGATGATACAA
GTAATAGCAGTTATATTGTGGCAGTTAAATCCAACACAAACTCTAAAGCT
GAAGGTGACAAAAAAGATGCCGCAATTTCTAAAAagaacaagaaaacaaa
aaagaaagatgACTTAAATGACTTAAAGAAAGAACTTGAGCTAACTTGTC
ATAGTGAAAATTTGGATGATCTTATTGCTCAATATGAAACAAACCTTACA
ACCGGTCTGACTAAAGAGATTGCTGCTCGAAACCTTGAACGTGATGGCCC
AAATGCTCTCTCCCCTCCAAAACAAACACCTGAATGGATCAAATTTTGTA
AACAATTATTTGGGGGGTTTTCAATGTTACTTTGGGTTGGTGCAATCCTT
TGTTTCTTTGCTTATGGTATTCGAACAGTCAGAGAGGATGATCCGAGTCA
AGATGAGTTATATCTTGGAATTGTACTTGCTGTTGTTGTCATTATTACTG
GTTGTTTCTCTTATTATCAAGAAGCCAAAAGTTCAAAGATCATGGAAAGT
TTTAAGAAGATGATCCCACAGGAGGCTACAGTATTACGTGATGGGGCAAA
GATTCAAATCAATGCGGAAGAATGTACCATTGGAGACATAGTATTTGTTA
AGTTTGGTGACCGTATCCCTGCGGATATTCGTGTTATCGAGTCAATGGGT
TTCAAGGTTGACAACTCTTCATTGACTGGTGAATCTGAACCACAATCTAG
AAACAGTGAATGTACTTCAGAGAATCCTTTGGAAACCAAAAACTTGGCTT
TCTTTTCCACAAACGCTGTTGAAGgtACTGCGACTGGTATGGTCGTTAAC
ATTGGTGATAACACTGTCATGGGACGTATTGCCAACTTGGCTTCTGGTCT
CGGCGCTGGTAAAACGCCTATTGCTCTTGAATTGGAACATTTTATTCATA
TCATTACTGGAGTTGCAGTGTTCCTTGGTGTGACATTCCTCATCATTTCA
CTTGCTATGGATTACCATTGGTTAGAAGCGATCATCTTTTTGATTGGTAT
TATTGTAGCTAACGTCCCTGAAGGTCTACTTGCCACTGTCACAGTATGTT
TAACATTGACAGCAAAGAAAATGGCAGCCAAGAATTGTTTAGTCAAACAT
TTGGAAGCTGTAGAAACCCTGGGAAGTACTTCTGTTATTTGCTCAGATAA
AACTGGAACATTGACACAAAATCGTATGACCGTTGCACACATGTGGTTTG
ACAAGATGATTATTGAAGCTGACACGACTGAAGATCAATCAGGACTTTCA
CATGACAAAGGTTCATCTACATGGAAAGCCCTTGCCAAAATTGGTGGTCT
GTGCAATCGTGCCGAGTTCAAAGAAGGACAGGAAGATTTACCCATATTAA
GGAAAGAGTGTAACGGTGATGCTTCAGAGActgctattttgaaatttgtt
gaacTGTCTGTCGGCAATGTTATGGATATGCGTTCTAAGAATGGAAAGGT
TGTTGAAATCCCATTCAATTCAACCAACAAATATCAAGTATCTATCCACA
AACAAGAAGATGAGAAAGACCCCCGATATCTTTTGGTTATGAAAGGTGCT
CCTGAACGAATTCTAGACAGATGTTCAACAATCTTGCTCCAAGGTGAAGA
GAAACCATTGGATGATGAAATGAAGGACGCATTCAATGATGCATATCTTC
AACTTGGTGGTCTTGGTGAACGCGTCTTGGGATTCTGCCATTACTATCTT
CCTGCTGAAAACTTTCCTGAAGGATTCGAGTTTCAAACAGATGATCCATG
TAATTTCCCACTTGATAACCTATGTTTCGTTGGTTTGATGAGTATGATTG
ATCCTCCAAGAGCTGCTGTGCCCGATGCTGTCAGCAAGTGCCGAAGTGCA
GGAATCAAGGTCATCATGGTTACAGGTGATCATCCAATCACAGCAAAAGC
TATCGCCAAAGGTGTCGGCATCATCTCCGAAGGAAATGAGACTGTTGAAG
ACATTGCTCAACGCTTGAATATTCCTGTTGAAGAAGTCAATCCTCGTGAT
GCACACGCTGCTGTTGTCCATGGAACTCAACTGAAAGACTTGTCAGCGGA
GGACATTGACGACATTTTGAAATACCACACTGAAATTGTGTTTGCCAGGA
CTTCACCACAACAAAAATTGATCATTGTTGAAGGATGTCAACGTCAAGGA
GCTATCGTTGCTGTCACCGGAGATGGTGTTAATGATTCGCCTGCTTTGAA
GAAAGCTGATATCGGTGTTGCTATGGGGATTGCTGGCTCAGACGTTTCAA
AACAAGCAGCTGACATGATCTTATTGGATGACAATTTCGCTTCCATTGTC
ACCGGAGTTGAAGAAGGACGTCTCATTTTTGACAATCTCAAAAAATCAAT
TGCTTACACCTTAACCAGTAACATTCCAGAGATCTCGCCGTTCTTGATGT
TTATTTTGCTCAGTATTCCACTCCCTCTTGGTACTGTCACCATTCTGTGC
ATCGATTTAGGCACTGACTTGATACCCGCCATTTCTCTTGCTTACGAGAA
GGCTGAGACTGACATCATGAAACGTAAACCACGTGACCCTATACGTGATA
AATTGGTGAATGAACGTTTGATCAGTTTGGCGTACGGTCAAATTGGTATG
ATCCAGGCTATTGCTGGTTTTTTCACCTACTTTGTGATCATGGCTGAGAA
TGGTTTCTTGCCATCCTTCCTAATGGGTATCCGATCCCAATGGGATGACA
AAAACAATAATTCAGTCATCGATTCTTACGGTAGCGAATGGACGTACTCT
CAACGCAAAGATTTGGAGTTGACTTGTCACACAGCTTTCTTTACTACCAT
CGTTGTTGTCCAATGGGCTGACGTCATCATCTCCAAAACAAGACGTCTCT
CCGTATTTACGCAAGGAATGACaaACTGGATGTTGAATTTTGGTTTGGTT
TTCGAAACTTTATTAGCTGCCTTCTTGCAATACACACCAGGTTTGAGTAC
TGGCTTACGTTTACGCCCATTGAACGCCTCGTGGTGGTTCTGTGGTGTCC
CTTTTTCCTTGTTGATCTGGATTTATGATGAAATCAGAAGATATTTGTTA
AGAAAGTATCCTGGagGATGGGTGGAGCAAGAGACATATTATTAAatggc
tgacgaagGAAAAGAAGAACTAACGAAAAATGAAGCAGAAACGCCTCAAG
ATCCTGCTGTAGAAGCGCCAACTGTAGAAAACGATAACACAGAACAAAAG
GGGGATGGAGATGATACAAGTAATAGCAGTTATATTGTGGCAGTTAAATC
CAACACAAACTCTAAAGCTGAAGGTGACAAAAAAGATGCCGCAATTTCTA
AAAagaacaagaaaacaaaaaagaaagatgACTTAAATGACTTAAAGAAA
GAACTTGAGCTAACTTGTCATAGTGAAAATTTGGATGATCTTATTGCTCA
ATATGAAACAAACCTTACAACCGGTCTGACTAAAGAGATTGCTGCTCGAA
ACCTTGAACGTGATGGCCCAAATGCTCTCTCCCCTCCAAAACAAACACCT
GAATGGATCAAATTTTGTAAACAATTATTTGGGGGGTTTTCAATGTTACT
TTGGGTTGGTGCAATCCTTTGTTTCTTTGCTTATGGTATTCGAACAGTCA
GAGAGGATGATCCGAGTCAAGATGAGTTATATCTTGGAATTGTACTTGCT
GTTGTTGTCATTATTACTGGTTGTTTCTCTTATTATCAAGAAGCCAAAAG
TTCAAAGATCATGGAAAGTTTTAAGAAGATGATCCCACAGGAGGCTACAG
TATTACGTGATGGGGCAAAGATTCAAATCAATGCGGAAGAATGTACCATT
GGAGACATAGTATTTGTTAAGTTTGGTGACCGTATCCCTGCGGATATTCG
TGTTATCGAGTCAATGGGTTTCAAGGTTGACAACTCTTCATTGACTGGTG
AATCTGAACCACAATCTAGAAACAGTGAATGTACTTCAGAGAATCCTTTG
GAAACCAAAAACTTGGCTTTCTTTTCCACAAACGCTGTTGAAGgtACTGC
GACTGGTATGGTCGTTAACATTGGTGATAACACTGTCATGGGACGTATTG
CCAACTTGGCTTCTGGTCTCGGCGCTGGTAAAACGCCTATTGCTCTTGAA
TTGGAACATTTTATTCATATCATTACTGGAGTTGCAGTGTTCCTTGGTGT
GACATTCCTCATCATTTCACTTGCTATGGATTACCATTGGTTAGAAGCGA
TCATCTTTTTGATTGGTATTATTGTAGCTAACGTCCCTGAAGGTCTACTT
GCCACTGTCACAGTATGTTTAACATTGACAGCAAAGAAAATGGCAGCCAA
GAATTGTTTAGTCAAACATTTGGAAGCTGTAGAAACCCTGGGAAGTACTT
CTGTTATTTGCTCAGATAAAACTGGAACATTGACACAAAATCGTATGACC
GTTGCACACATGTGGTTTGACAAGATGATTATTGAAGCTGACACGACTGA
AGATCAATCAGGACTTTCACATGACAAAGGTTCATCTACATGGAAAGCCC
TTGCCAAAATTGGTGGTCTGTGCAATCGTGCCGAGTTCAAAGAAGGACAG
GAAGATTTACCCATATTAAGGAAAGAGTGTAACGGTGATGCTTCAGAGAc
tgctattttgaaatttgttgaacTGTCTGTCGGCAATGTTATGGATATGC
GTTCTAAGAATGGAAAGGTTGTTGAAATCCCATTCAATTCAACCAACAAA
TATCAAGTATCTATCCACAAACAAGAAGATGAGAAAGACCCCCGATATCT
TTTGGTTATGAAAGGTGCTCCTGAACGAATTCTAGACAGATGTTCAACAA
TCTTGCTCCAAGGTGAAGAGAAACCATTGGATGATGAAATGAAGGACGCA
TTCAATGATGCATATCTTCAACTTGGTGGTCTTGGTGAACGCGTCTTGGG
ATTCTGCCATTACTATCTTCCTGCTGAAAACTTTCCTGAAGGATTCGAGT
TTCAAACAGATGATCCATGTAATTTCCCACTTGATAACCTATGTTTCGTT
GGTTTGATGAGTATGATTGATCCTCCAAGAGCTGCTGTGCCCGATGCTGT
CAGCAAGTGCCGAAGTGCAGGAATCAAGGTCATCATGGTTACAGGTGATC
ATCCAATCACAGCAAAAGCTATCGCCAAAGGTGTCGGCATCATCTCCGAA
GGAAATGAGACTGTTGAAGACATTGCTCAACGCTTGAATATTCCTGTTGA
AGAAGTCAATCCTCGTGATGCACACGCTGCTGTTGTCCATGGAACTCAAC
TGAAAGACTTGTCAGCGGAGGACATTGACGACATTTTGAAATACCACACT
GAAATTGTGTTTGCCAGGACTTCACCACAACAAAAATTGATCATTGTTGA
AGGATGTCAACGTCAAGGAGCTATCGTTGCTGTCACCGGAGATGGTGTTA
ATGATTCGCCTGCTTTGAAGAAAGCTGATATCGGTGTTGCTATGGGGATT
GCTGGCTCAGACGTTTCAAAACAAGCAGCTGACATGATCTTATTGGATGA
CAATTTCGCTTCCATTGTCACCGGAGTTGAAGAAGGACGTCTCATTTTTG
ACAATCTCAAAAAATCAATTGCTTACACCTTAACCAGTAACATTCCAGAG
ATCTCGCCGTTCTTGATGTTTATTTTGCTCAGTATTCCACTCCCTCTTGG
TACTGTCACCATTCTGTGCATCGATTTAGGCACTGACTTGATACCCGCCA
TTTCTCTTGCTTACGAGAAGGCTGAGACTGACATCATGAAACGTAAACCA
CGTGACCCTATACGTGATAAATTGGTGAATGAACGTTTGATCAGTTTGGC
GTACGGTCAAATTGGTATGATCCAGGCTATTGCTGGTTTTTTCACCTACT
TTGTGATCATGGCTGAGAATGGTTTCTTGCCATCCTTCCTAATGGGTATC
CGATCCCAATGGGATGACAAAAACAATAATTCAGTCATCGATTCTTACGG
TAGCGAATGGACGTACTCTCAACGCAAAGATTTGGAGTTGACTTGTCACA
CAGCTTTCTTTACTACCATCGTTGTTGTCCAATGGGCTGACGTCATCATC
TCCAAAACAAGACGTCTCTCCGTATTTACGCAAGGAATGACaaACTGGAT
GTTGAATTTTGGTTTGGTTTTCGAAACTTTATTAGCTGCCTTCTTGCAAT
ACACACCAGGTTTGAGTACTGGCTTACGTTTACGCCCATTGAACGCCTCG
TGGTGGTTCTGTGGTGTCCCTTTTTCCTTGTTGATCTGGATTTATGATGA
AATCAGAAGATATTTGTTAAGAAAGTATCCTGGagGATGGGTGGAGCAAG
AGACATATTATTAAatggctgacgaagGAAAAGAAGAACTAACGAAAAAT
GAAGCAGAAACGCCTCAAGATCCTGCTGTAGAAGCGCCAACTGTAGAAAA
CGATAACACAGAACAAAAGGGGGATGGAGATGATACAAGTAATAGCAGTT
ATATTGTGGCAGTTAAATCCAACACAAACTCTAAAGCTGAAGGTGACAAA
AAAGATGCCGCAATTTCTAAAAagaacaagaaaacaaaaaagaaagatgA
CTTAAATGACTTAAAGAAAGAACTTGAGCTAACTTGTCATAGTGAAAATT
TGGATGATCTTATTGCTCAATATGAAACAAACCTTACAACCGGTCTGACT
AAAGAGATTGCTGCTCGAAACCTTGAACGTGATGGCCCAAATGCTCTCTC
CCCTCCAAAACAAACACCTGAATGGATCAAATTTTGTAAACAATTATTTG
GGGGGTTTTCAATGTTACTTTGGGTTGGTGCAATCCTTTGTTTCTTTGCT
TATGGTATTCGAACAGTCAGAGAGGATGATCCGAGTCAAGATGAGTTATA
TCTTGGAATTGTACTTGCTGTTGTTGTCATTATTACTGGTTGTTTCTCTT
ATTATCAAGAAGCCAAAAGTTCAAAGATCATGGAAAGTTTTAAGAAGATG
ATCCCACAGGAGGCTACAGTATTACGTGATGGGGCAAAGATTCAAATCAA
TGCGGAAGAATGTACCATTGGAGACATAGTATTTGTTAAGTTTGGTGACC
GTATCCCTGCGGATATTCGTGTTATCGAGTCAATGGGTTTCAAGGTTGAC
AACTCTTCATTGACTGGTGAATCTGAACCACAATCTAGAAACAGTGAATG
TACTTCAGAGAATCCTTTGGAAACCAAAAACTTGGCTTTCTTTTCCACAA
ACGCTGTTGAAGgtACTGCGACTGGTATGGTCGTTAACATTGGTGATAAC
ACTGTCATGGGACGTATTGCCAACTTGGCTTCTGGTCTCGGCGCTGGTAA
AACGCCTATTGCTCTTGAATTGGAACATTTTATTCATATCATTACTGGAG
TTGCAGTGTTCCTTGGTGTGACATTCCTCATCATTTCACTTGCTATGGAT
TACCATTGGTTAGAAGCGATCATCTTTTTGATTGGTATTATTGTAGCTAA
CGTCCCTGAAGGTCTACTTGCCACTGTCACAGTATGTTTAACATTGACAG
CAAAGAAAATGGCAGCCAAGAATTGTTTAGTCAAACATTTGGAAGCTGTA
GAAACCCTGGGAAGTACTTCTGTTATTTGCTCAGATAAAACTGGAACATT
GACACAAAATCGTATGACCGTTGCACACATGTGGTTTGACAAGATGATTA
TTGAAGCTGACACGACTGAAGATCAATCAGGACTTTCACATGACAAAGGT
TCATCTACATGGAAAGCCCTTGCCAAAATTGGTGGTCTGTGCAATCGTGC
CGAGTTCAAAGAAGGACAGGAAGATTTACCCATATTAAGGAAAGAGTGTA
ACGGTGATGCTTCAGAGActgctattttgaaatttgttgaacTGTCTGTC
GGCAATGTTATGGATATGCGTTCTAAGAATGGAAAGGTTGTTGAAATCCC
ATTCAATTCAACCAACAAATATCAAGTATCTATCCACAAACAAGAAGATG
AGAAAGACCCCCGATATCTTTTGGTTATGAAAGGTGCTCCTGAACGAATT
CTAGACAGATGTTCAACAATCTTGCTCCAAGGTGAAGAGAAACCATTGGA
TGATGAAATGAAGGACGCATTCAATGATGCATATCTTCAACTTGGTGGTC
TTGGTGAACGCGTCTTGGGATTCTGCCATTACTATCTTCCTGCTGAAAAC
TTTCCTGAAGGATTCGAGTTTCAAACAGATGATCCATGTAATTTCCCACT
TGATAACCTATGTTTCGTTGGTTTGATGAGTATGATTGATCCTCCAAGAG
CTGCTGTGCCCGATGCTGTCAGCAAGTGCCGAAGTGCAGGAATCAAGGTC
ATCATGGTTACAGGTGATCATCCAATCACAGCAAAAGCTATCGCCAAAGG
TGTCGGCATCATCTCCGAAGGAAATGAGACTGTTGAAGACATTGCTCAAC
GCTTGAATATTCCTGTTGAAGAAGTCAATCCTCGTGATGCACACGCTGCT
GTTGTCCATGGAACTCAACTGAAAGACTTGTCAGCGGAGGACATTGACGA
CATTTTGAAATACCACACTGAAATTGTGTTTGCCAGGACTTCACCACAAC
AAAAATTGATCATTGTTGAAGGATGTCAACGTCAAGGAGCTATCGTTGCT
GTCACCGGAGATGGTGTTAATGATTCGCCTGCTTTGAAGAAAGCTGATAT
CGGTGTTGCTATGGGGATTGCTGGCTCAGACGTTTCAAAACAAGCAGCTG
ACATGATCTTATTGGATGACAATTTCGCTTCCATTGTCACCGGAGTTGAA
GAAGGACGTCTCATTTTTGACAATCTCAAAAAATCAATTGCTTACACCTT
AACCAGTAACATTCCAGAGATCTCGCCGTTCTTGATGTTTATTTTGCTCA
GTATTCCACTCCCTCTTGGTACTGTCACCATTCTGTGCATCGATTTAGGC
ACTGACTTGATACCCGCCATTTCTCTTGCTTACGAGAAGGCTGAGACTGA
CATCATGAAACGTAAACCACGTGACCCTATACGTGATAAATTGGTGAATG
AACGTTTGATCAGTTTGGCGTACGGTCAAATTGGTATGATCCAGGCTATT
GCTGGTTTTTTCACCTACTTTGTGATCATGGCTGAGAATGGTTTCTTGCC
ATCCTTCCTAATGGGTATCCGATCCCAATGGGATGACAAAAACAATAATT
CAGTCATCGATTCTTACGGTAGCGAATGGACGTACTCTCAACGCAAAGAT
TTGGAGTTGACTTGTCACACAGCTTTCTTTACTACCATCGTTGTTGTCCA
ATGGGCTGACGTCATCATCTCCAAAACAAGACGTCTCTCCGTATTTACGC
AAGGAATGACaaACTGGATGTTGAATTTTGGTTTGGTTTTCGAAACTTTA
TTAGCTGCCTTCTTGCAATACACACCAGGTTTGAGTACTGGCTTACGTTT
ACGCCCATTGAACGCCTCGTGGTGGTTCTGTGGTGTCCCTTTTTCCTTGT
TGATCTGGATTTATGATGAAATCAGAAGATATTTGTTAAGAAAGTATCCT
GGagGATGGGTGGAGCAAGAGACATATTATTAAatggctgacgaagGAAA
AGAAGAACTAACGAAAAATGAAGCAGAAACGCCTCAAGATCCTGCTGTAG
AAGCGCCAACTGTAGAAAACGATAACACAGAACAAAAGGGGGATGGAGAT
GATACAAGTAATAGCAGTTATATTGTGGCAGTTAAATCCAACACAAACTC
TAAAGCTGAAGGTGACAAAAAAGATGCCGCAATTTCTAAAAagaacaaga
aaacaaaaaagaaagatgACTTAAATGACTTAAAGAAAGAACTTGAGCTA
ACTTGTCATAGTGAAAATTTGGATGATCTTATTGCTCAATATGAAACAAA
CCTTACAACCGGTCTGACTAAAGAGATTGCTGCTCGAAACCTTGAACGTG
ATGGCCCAAATGCTCTCTCCCCTCCAAAACAAACACCTGAATGGATCAAA
TTTTGTAAACAATTATTTGGGGGGTTTTCAATGTTACTTTGGGTTGGTGC
AATCCTTTGTTTCTTTGCTTATGGTATTCGAACAGTCAGAGAGGATGATC
CGAGTCAAGATGAGTTATATCTTGGAATTGTACTTGCTGTTGTTGTCATT
ATTACTGGTTGTTTCTCTTATTATCAAGAAGCCAAAAGTTCAAAGATCAT
GGAAAGTTTTAAGAAGATGATCCCACAGGAGGCTACAGTATTACGTGATG
GGGCAAAGATTCAAATCAATGCGGAAGAATGTACCATTGGAGACATAGTA
TTTGTTAAGTTTGGTGACCGTATCCCTGCGGATATTCGTGTTATCGAGTC
AATGGGTTTCAAGGTTGACAACTCTTCATTGACTGGTGAATCTGAACCAC
AATCTAGAAACAGTGAATGTACTTCAGAGAATCCTTTGGAAACCAAAAAC
TTGGCTTTCTTTTCCACAAACGCTGTTGAAGgtACTGCGACTGGTATGGT
CGTTAACATTGGTGATAACACTGTCATGGGACGTATTGCCAACTTGGCTT
CTGGTCTCGGCGCTGGTAAAACGCCTATTGCTCTTGAATTGGAACATTTT
ATTCATATCATTACTGGAGTTGCAGTGTTCCTTGGTGTGACATTCCTCAT
CATTTCACTTGCTATGGATTACCATTGGTTAGAAGCGATCATCTTTTTGA
TTGGTATTATTGTAGCTAACGTCCCTGAAGGTCTACTTGCCACTGTCACA
GTATGTTTAACATTGACAGCAAAGAAAATGGCAGCCAAGAATTGTTTAGT
CAAACATTTGGAAGCTGTAGAAACCCTGGGAAGTACTTCTGTTATTTGCT
CAGATAAAACTGGAACATTGACACAAAATCGTATGACCGTTGCACACATG
TGGTTTGACAAGATGATTATTGAAGCTGACACGACTGAAGATCAATCAGG
ACTTTCACATGACAAAGGTTCATCTACATGGAAAGCCCTTGCCAAAATTG
GTGGTCTGTGCAATCGTGCCGAGTTCAAAGAAGGACAGGAAGATTTACCC
ATATTAAGGAAAGAGTGTAACGGTGATGCTTCAGAGActgctattttgaa
atttgttgaacTGTCTGTCGGCAATGTTATGGATATGCGTTCTAAGAATG
GAAAGGTTGTTGAAATCCCATTCAATTCAACCAACAAATATCAAGTATCT
ATCCACAAACAAGAAGATGAGAAAGACCCCCGATATCTTTTGGTTATGAA
AGGTGCTCCTGAACGAATTCTAGACAGATGTTCAACAATCTTGCTCCAAG
GTGAAGAGAAACCATTGGATGATGAAATGAAGGACGCATTCAATGATGCA
TATCTTCAACTTGGTGGTCTTGGTGAACGCGTCTTGGGATTCTGCCATTA
CTATCTTCCTGCTGAAAACTTTCCTGAAGGATTCGAGTTTCAAACAGATG
ATCCATGTAATTTCCCACTTGATAACCTATGTTTCGTTGGTTTGATGAGT
ATGATTGATCCTCCAAGAGCTGCTGTGCCCGATGCTGTCAGCAAGTGCCG
AAGTGCAGGAATCAAGGTCATCATGGTTACAGGTGATCATCCAATCACAG
CAAAAGCTATCGCCAAAGGTGTCGGCATCATCTCCGAAGGAAATGAGACT
GTTGAAGACATTGCTCAACGCTTGAATATTCCTGTTGAAGAAGTCAATCC
TCGTGATGCACACGCTGCTGTTGTCCATGGAACTCAACTGAAAGACTTGT
CAGCGGAGGACATTGACGACATTTTGAAATACCACACTGAAATTGTGTTT
GCCAGGACTTCACCACAACAAAAATTGATCATTGTTGAAGGATGTCAACG
TCAAGGAGCTATCGTTGCTGTCACCGGAGATGGTGTTAATGATTCGCCTG
CTTTGAAGAAAGCTGATATCGGTGTTGCTATGGGGATTGCTGGCTCAGAC
GTTTCAAAACAAGCAGCTGACATGATCTTATTGGATGACAATTTCGCTTC
CATTGTCACCGGAGTTGAAGAAGGACGTCTCATTTTTGACAATCTCAAAA
AATCAATTGCTTACACCTTAACCAGTAACATTCCAGAGATCTCGCCGTTC
TTGATGTTTATTTTGCTCAGTATTCCACTCCCTCTTGGTACTGTCACCAT
TCTGTGCATCGATTTAGGCACTGACTTGATACCCGCCATTTCTCTTGCTT
ACGAGAAGGCTGAGACTGACATCATGAAACGTAAACCACGTGACCCTATA
CGTGATAAATTGGTGAATGAACGTTTGATCAGTTTGGCGTACGGTCAAAT
TGGTATGATCCAGGCTATTGCTGGTTTTTTCACCTACTTTGTGATCATGG
CTGAGAATGGTTTCTTGCCATCCTTCCTAATGGGTATCCGATCCCAATGG
GATGACAAAAACAATAATTCAGTCATCGATTCTTACGGTAGCGAATGGAC
GTACTCTCAACGCAAAGATTTGGAGTTGACTTGTCACACAGCTTTCTTTA
CTACCATCGTTGTTGTCCAATGGGCTGACGTCATCATCTCCAAAACAAGA
CGTCTCTCCGTATTTACGCAAGGAATGACaaACTGGATGTTGAATTTTGG
TTTGGTTTTCGAAACTTTATTAGCTGCCTTCTTGCAATACACACCAGGTT
TGAGTACTGGCTTACGTTTACGCCCATTGAACGCCTCGTGGTGGTTCTGT
GGTGTCCCTTTTTCCTTGTTGATCTGGATTTATGATGAAATCAGAAGATA
TTTGTTAAGAAAGTATCCTGGagGATGGGTGGAGCAAGAGACATATTATT
AAatggctgacgaagGAAAAGAAGAACTAACGAAAAATGAAGCAGAAACG
CCTCAAGATCCTGCTGTAGAAGCGCCAACTGTAGAAAACGATAACACAGA
ACAAAAGGGGGATGGAGATGATACAAGTAATAGCAGTTATATTGTGGCAG
TTAAATCCAACACAAACTCTAAAGCTGAAGGTGACAAAAAAGATGCCGCA
ATTTCTAAAAagaacaagaaaacaaaaaagaaagatgACTTAAATGACTT
AAAGAAAGAACTTGAGCTAACTTGTCATAGTGAAAATTTGGATGATCTTA
TTGCTCAATATGAAACAAACCTTACAACCGGTCTGACTAAAGAGATTGCT
GCTCGAAACCTTGAACGTGATGGCCCAAATGCTCTCTCCCCTCCAAAACA
AACACCTGAATGGATCAAATTTTGTAAACAATTATTTGGGGGGTTTTCAA
TGTTACTTTGGGTTGGTGCAATCCTTTGTTTCTTTGCTTATGGTATTCGA
ACAGTCAGAGAGGATGATCCGAGTCAAGATGAGTTATATCTTGGAATTGT
ACTTGCTGTTGTTGTCATTATTACTGGTTGTTTCTCTTATTATCAAGAAG
CCAAAAGTTCAAAGATCATGGAAAGTTTTAAGAAGATGATCCCACAGGAG
GCTACAGTATTACGTGATGGGGCAAAGATTCAAATCAATGCGGAAGAATG
TACCATTGGAGACATAGTATTTGTTAAGTTTGGTGACCGTATCCCTGCGG
ATATTCGTGTTATCGAGTCAATGGGTTTCAAGGTTGACAACTCTTCATTG
ACTGGTGAATCTGAACCACAATCTAGAAACAGTGAATGTACTTCAGAGAA
TCCTTTGGAAACCAAAAACTTGGCTTTCTTTTCCACAAACGCTGTTGAAG
gtACTGCGACTGGTATGGTCGTTAACATTGGTGATAACACTGTCATGGGA
CGTATTGCCAACTTGGCTTCTGGTCTCGGCGCTGGTAAAACGCCTATTGC
TCTTGAATTGGAACATTTTATTCATATCATTACTGGAGTTGCAGTGTTCC
TTGGTGTGACATTCCTCATCATTTCACTTGCTATGGATTACCATTGGTTA
GAAGCGATCATCTTTTTGATTGGTATTATTGTAGCTAACGTCCCTGAAGG
TCTACTTGCCACTGTCACAGTATGTTTAACATTGACAGCAAAGAAAATGG
CAGCCAAGAATTGTTTAGTCAAACATTTGGAAGCTGTAGAAACCCTGGGA
AGTACTTCTGTTATTTGCTCAGATAAAACTGGAACATTGACACAAAATCG
TATGACCGTTGCACACATGTGGTTTGACAAGATGATTATTGAAGCTGACA
CGACTGAAGATCAATCAGGACTTTCACATGACAAAGGTTCATCTACATGG
AAAGCCCTTGCCAAAATTGGTGGTCTGTGCAATCGTGCCGAGTTCAAAGA
AGGACAGGAAGATTTACCCATATTAAGGAAAGAGTGTAACGGTGATGCTT
CAGAGActgctattttgaaatttgttgaacTGTCTGTCGGCAATGTTATG
GATATGCGTTCTAAGAATGGAAAGGTTGTTGAAATCCCATTCAATTCAAC
CAACAAATATCAAGTATCTATCCACAAACAAGAAGATGAGAAAGACCCCC
GATATCTTTTGGTTATGAAAGGTGCTCCTGAACGAATTCTAGACAGATGT
TCAACAATCTTGCTCCAAGGTGAAGAGAAACCATTGGATGATGAAATGAA
GGACGCATTCAATGATGCATATCTTCAACTTGGTGGTCTTGGTGAACGCG
TCTTGGGATTCTGCCATTACTATCTTCCTGCTGAAAACTTTCCTGAAGGA
TTCGAGTTTCAAACAGATGATCCATGTAATTTCCCACTTGATAACCTATG
TTTCGTTGGTTTGATGAGTATGATTGATCCTCCAAGAGCTGCTGTGCCCG
ATGCTGTCAGCAAGTGCCGAAGTGCAGGAATCAAGGTCATCATGGTTACA
GGTGATCATCCAATCACAGCAAAAGCTATCGCCAAAGGTGTCGGCATCAT
CTCCGAAGGAAATGAGACTGTTGAAGACATTGCTCAACGCTTGAATATTC
CTGTTGAAGAAGTCAATCCTCGTGATGCACACGCTGCTGTTGTCCATGGA
ACTCAACTGAAAGACTTGTCAGCGGAGGACATTGACGACATTTTGAAATA
CCACACTGAAATTGTGTTTGCCAGGACTTCACCACAACAAAAATTGATCA
TTGTTGAAGGATGTCAACGTCAAGGAGCTATCGTTGCTGTCACCGGAGAT
GGTGTTAATGATTCGCCTGCTTTGAAGAAAGCTGATATCGGTGTTGCTAT
GGGGATTGCTGGCTCAGACGTTTCAAAACAAGCAGCTGACATGATCTTAT
TGGATGACAATTTCGCTTCCATTGTCACCGGAGTTGAAGAAGGACGTCTC
ATTTTTGACAATCTCAAAAAATCAATTGCTTACACCTTAACCAGTAACAT
TCCAGAGATCTCGCCGTTCTTGATGTTTATTTTGCTCAGTATTCCACTCC
CTCTTGGTACTGTCACCATTCTGTGCATCGATTTAGGCACTGACTTGATA
CCCGCCATTTCTCTTGCTTACGAGAAGGCTGAGACTGACATCATGAAACG
TAAACCACGTGACCCTATACGTGATAAATTGGTGAATGAACGTTTGATCA
GTTTGGCGTACGGTCAAATTGGTATGATCCAGGCTATTGCTGGTTTTTTC
ACCTACTTTGTGATCATGGCTGAGAATGGTTTCTTGCCATCCTTCCTAAT
GGGTATCCGATCCCAATGGGATGACAAAAACAATAATTCAGTCATCGATT
CTTACGGTAGCGAATGGACGTACTCTCAACGCAAAGATTTGGAGTTGACT
TGTCACACAGCTTTCTTTACTACCATCGTTGTTGTCCAATGGGCTGACGT
CATCATCTCCAAAACAAGACGTCTCTCCGTATTTACGCAAGGAATGACaa
ACTGGATGTTGAATTTTGGTTTGGTTTTCGAAACTTTATTAGCTGCCTTC
TTGCAATACACACCAGGTTTGAGTACTGGCTTACGTTTACGCCCATTGAA
CGCCTCGTGGTGGTTCTGTGGTGTCCCTTTTTCCTTGTTGATCTGGATTT
ATGATGAAATCAGAAGATATTTGTTAAGAAAGTATCCTGGagGATGGGTG
GAGCAAGAGACATATTATTAAatggctgacgaagGAAAAGAAGAACTAAC
GAAAAATGAAGCAGAAACGCCTCAAGATCCTGCTGTAGAAGCGCCAACTG
TAGAAAACGATAACACAGAACAAAAGGGGGATGGAGATGATACAAGTAAT
AGCAGTTATATTGTGGCAGTTAAATCCAACACAAACTCTAAAGCTGAAGG
TGACAAAAAAGATGCCGCAATTTCTAAAAagaacaagaaaacaaaaaaga
aagatgACTTAAATGACTTAAAGAAAGAACTTGAGCTAACTTGTCATAGT
GAAAATTTGGATGATCTTATTGCTCAATATGAAACAAACCTTACAACCGG
TCTGACTAAAGAGATTGCTGCTCGAAACCTTGAACGTGATGGCCCAAATG
CTCTCTCCCCTCCAAAACAAACACCTGAATGGATCAAATTTTGTAAACAA
TTATTTGGGGGGTTTTCAATGTTACTTTGGGTTGGTGCAATCCTTTGTTT
CTTTGCTTATGGTATTCGAACAGTCAGAGAGGATGATCCGAGTCAAGATG
AGTTATATCTTGGAATTGTACTTGCTGTTGTTGTCATTATTACTGGTTGT
TTCTCTTATTATCAAGAAGCCAAAAGTTCAAAGATCATGGAAAGTTTTAA
GAAGATGATCCCACAGGAGGCTACAGTATTACGTGATGGGGCAAAGATTC
AAATCAATGCGGAAGAATGTACCATTGGAGACATAGTATTTGTTAAGTTT
GGTGACCGTATCCCTGCGGATATTCGTGTTATCGAGTCAATGGGTTTCAA
GGTTGACAACTCTTCATTGACTGGTGAATCTGAACCACAATCTAGAAACA
GTGAATGTACTTCAGAGAATCCTTTGGAAACCAAAAACTTGGCTTTCTTT
TCCACAAACGCTGTTGAAGgtACTGCGACTGGTATGGTCGTTAACATTGG
TGATAACACTGTCATGGGACGTATTGCCAACTTGGCTTCTGGTCTCGGCG
CTGGTAAAACGCCTATTGCTCTTGAATTGGAACATTTTATTCATATCATT
ACTGGAGTTGCAGTGTTCCTTGGTGTGACATTCCTCATCATTTCACTTGC
TATGGATTACCATTGGTTAGAAGCGATCATCTTTTTGATTGGTATTATTG
TAGCTAACGTCCCTGAAGGTCTACTTGCCACTGTCACAGTATGTTTAACA
TTGACAGCAAAGAAAATGGCAGCCAAGAATTGTTTAGTCAAACATTTGGA
AGCTGTAGAAACCCTGGGAAGTACTTCTGTTATTTGCTCAGATAAAACTG
GAACATTGACACAAAATCGTATGACCGTTGCACACATGTGGTTTGACAAG
ATGATTATTGAAGCTGACACGACTGAAGATCAATCAGGACTTTCACATGA
CAAAGGTTCATCTACATGGAAAGCCCTTGCCAAAATTGGTGGTCTGTGCA
ATCGTGCCGAGTTCAAAGAAGGACAGGAAGATTTACCCATATTAAGGAAA
GAGTGTAACGGTGATGCTTCAGAGActgctattttgaaatttgttgaacT
GTCTGTCGGCAATGTTATGGATATGCGTTCTAAGAATGGAAAGGTTGTTG
AAATCCCATTCAATTCAACCAACAAATATCAAGTATCTATCCACAAACAA
GAAGATGAGAAAGACCCCCGATATCTTTTGGTTATGAAAGGTGCTCCTGA
ACGAATTCTAGACAGATGTTCAACAATCTTGCTCCAAGGTGAAGAGAAAC
CATTGGATGATGAAATGAAGGACGCATTCAATGATGCATATCTTCAACTT
GGTGGTCTTGGTGAACGCGTCTTGGGATTCTGCCATTACTATCTTCCTGC
TGAAAACTTTCCTGAAGGATTCGAGTTTCAAACAGATGATCCATGTAATT
TCCCACTTGATAACCTATGTTTCGTTGGTTTGATGAGTATGATTGATCCT
CCAAGAGCTGCTGTGCCCGATGCTGTCAGCAAGTGCCGAAGTGCAGGAAT
CAAGGTCATCATGGTTACAGGTGATCATCCAATCACAGCAAAAGCTATCG
CCAAAGGTGTCGGCATCATCTCCGAAGGAAATGAGACTGTTGAAGACATT
GCTCAACGCTTGAATATTCCTGTTGAAGAAGTCAATCCTCGTGATGCACA
CGCTGCTGTTGTCCATGGAACTCAACTGAAAGACTTGTCAGCGGAGGACA
TTGACGACATTTTGAAATACCACACTGAAATTGTGTTTGCCAGGACTTCA
CCACAACAAAAATTGATCATTGTTGAAGGATGTCAACGTCAAGGAGCTAT
CGTTGCTGTCACCGGAGATGGTGTTAATGATTCGCCTGCTTTGAAGAAAG
CTGATATCGGTGTTGCTATGGGGATTGCTGGCTCAGACGTTTCAAAACAA
GCAGCTGACATGATCTTATTGGATGACAATTTCGCTTCCATTGTCACCGG
AGTTGAAGAAGGACGTCTCATTTTTGACAATCTCAAAAAATCAATTGCTT
ACACCTTAACCAGTAACATTCCAGAGATCTCGCCGTTCTTGATGTTTATT
TTGCTCAGTATTCCACTCCCTCTTGGTACTGTCACCATTCTGTGCATCGA
TTTAGGCACTGACTTGATACCCGCCATTTCTCTTGCTTACGAGAAGGCTG
AGACTGACATCATGAAACGTAAACCACGTGACCCTATACGTGATAAATTG
GTGAATGAACGTTTGATCAGTTTGGCGTACGGTCAAATTGGTATGATCCA
GGCTATTGCTGGTTTTTTCACCTACTTTGTGATCATGGCTGAGAATGGTT
TCTTGCCATCCTTCCTAATGGGTATCCGATCCCAATGGGATGACAAAAAC
AATAATTCAGTCATCGATTCTTACGGTAGCGAATGGACGTACTCTCAACG
CAAAGATTTGGAGTTGACTTGTCACACAGCTTTCTTTACTACCATCGTTG
TTGTCCAATGGGCTGACGTCATCATCTCCAAAACAAGACGTCTCTCCGTA
TTTACGCAAGGAATGACaaACTGGATGTTGAATTTTGGTTTGGTTTTCGA
AACTTTATTAGCTGCCTTCTTGCAATACACACCAGGTTTGAGTACTGGCT
TACGTTTACGCCCATTGAACGCCTCGTGGTGGTTCTGTGGTGTCCCTTTT
TCCTTGTTGATCTGGATTTATGATGAAATCAGAAGATATTTGTTAAGAAA
GTATCCTGGagGATGGGTGGAGCAAGAGACATATTATTAAatggctgacg
aagGAAAAGAAGAACTAACGAAAAATGAAGCAGAAACGCCTCAAGATCCT
GCTGTAGAAGCGCCAACTGTAGAAAACGATAACACAGAACAAAAGGGGGA
TGGAGATGATACAAGTAATAGCAGTTATATTGTGGCAGTTAAATCCAACA
CAAACTCTAAAGCTGAAGGTGACAAAAAAGATGCCGCAATTTCTAAAAag
aacaagaaaacaaaaaagaaagatgACTTAAATGACTTAAAGAAAGAACT
TGAGCTAACTTGTCATAGTGAAAATTTGGATGATCTTATTGCTCAATATG
AAACAAACCTTACAACCGGTCTGACTAAAGAGATTGCTGCTCGAAACCTT
GAACGTGATGGCCCAAATGCTCTCTCCCCTCCAAAACAAACACCTGAATG
GATCAAATTTTGTAAACAATTATTTGGGGGGTTTTCAATGTTACTTTGGG
TTGGTGCAATCCTTTGTTTCTTTGCTTATGGTATTCGAACAGTCAGAGAG
GATGATCCGAGTCAAGATGAGTTATATCTTGGAATTGTACTTGCTGTTGT
TGTCATTATTACTGGTTGTTTCTCTTATTATCAAGAAGCCAAAAGTTCAA
AGATCATGGAAAGTTTTAAGAAGATGATCCCACAGGAGGCTACAGTATTA
CGTGATGGGGCAAAGATTCAAATCAATGCGGAAGAATGTACCATTGGAGA
CATAGTATTTGTTAAGTTTGGTGACCGTATCCCTGCGGATATTCGTGTTA
TCGAGTCAATGGGTTTCAAGGTTGACAACTCTTCATTGACTGGTGAATCT
GAACCACAATCTAGAAACAGTGAATGTACTTCAGAGAATCCTTTGGAAAC
CAAAAACTTGGCTTTCTTTTCCACAAACGCTGTTGAAGgtACTGCGACTG
GTATGGTCGTTAACATTGGTGATAACACTGTCATGGGACGTATTGCCAAC
TTGGCTTCTGGTCTCGGCGCTGGTAAAACGCCTATTGCTCTTGAATTGGA
ACATTTTATTCATATCATTACTGGAGTTGCAGTGTTCCTTGGTGTGACAT
TCCTCATCATTTCACTTGCTATGGATTACCATTGGTTAGAAGCGATCATC
TTTTTGATTGGTATTATTGTAGCTAACGTCCCTGAAGGTCTACTTGCCAC
TGTCACAGTATGTTTAACATTGACAGCAAAGAAAATGGCAGCCAAGAATT
GTTTAGTCAAACATTTGGAAGCTGTAGAAACCCTGGGAAGTACTTCTGTT
ATTTGCTCAGATAAAACTGGAACATTGACACAAAATCGTATGACCGTTGC
ACACATGTGGTTTGACAAGATGATTATTGAAGCTGACACGACTGAAGATC
AATCAGGACTTTCACATGACAAAGGTTCATCTACATGGAAAGCCCTTGCC
AAAATTGGTGGTCTGTGCAATCGTGCCGAGTTCAAAGAAGGACAGGAAGA
TTTACCCATATTAAGGAAAGAGTGTAACGGTGATGCTTCAGAGActgcta
ttttgaaatttgttgaacTGTCTGTCGGCAATGTTATGGATATGCGTTCT
AAGAATGGAAAGGTTGTTGAAATCCCATTCAATTCAACCAACAAATATCA
AGTATCTATCCACAAACAAGAAGATGAGAAAGACCCCCGATATCTTTTGG
TTATGAAAGGTGCTCCTGAACGAATTCTAGACAGATGTTCAACAATCTTG
CTCCAAGGTGAAGAGAAACCATTGGATGATGAAATGAAGGACGCATTCAA
TGATGCATATCTTCAACTTGGTGGTCTTGGTGAACGCGTCTTGGGATTCT
GCCATTACTATCTTCCTGCTGAAAACTTTCCTGAAGGATTCGAGTTTCAA
ACAGATGATCCATGTAATTTCCCACTTGATAACCTATGTTTCGTTGGTTT
GATGAGTATGATTGATCCTCCAAGAGCTGCTGTGCCCGATGCTGTCAGCA
AGTGCCGAAGTGCAGGAATCAAGGTCATCATGGTTACAGGTGATCATCCA
ATCACAGCAAAAGCTATCGCCAAAGGTGTCGGCATCATCTCCGAAGGAAA
TGAGACTGTTGAAGACATTGCTCAACGCTTGAATATTCCTGTTGAAGAAG
TCAATCCTCGTGATGCACACGCTGCTGTTGTCCATGGAACTCAACTGAAA
GACTTGTCAGCGGAGGACATTGACGACATTTTGAAATACCACACTGAAAT
TGTGTTTGCCAGGACTTCACCACAACAAAAATTGATCATTGTTGAAGGAT
GTCAACGTCAAGGAGCTATCGTTGCTGTCACCGGAGATGGTGTTAATGAT
TCGCCTGCTTTGAAGAAAGCTGATATCGGTGTTGCTATGGGGATTGCTGG
CTCAGACGTTTCAAAACAAGCAGCTGACATGATCTTATTGGATGACAATT
TCGCTTCCATTGTCACCGGAGTTGAAGAAGGACGTCTCATTTTTGACAAT
CTCAAAAAATCAATTGCTTACACCTTAACCAGTAACATTCCAGAGATCTC
GCCGTTCTTGATGTTTATTTTGCTCAGTATTCCACTCCCTCTTGGTACTG
TCACCATTCTGTGCATCGATTTAGGCACTGACTTGATACCCGCCATTTCT
CTTGCTTACGAGAAGGCTGAGACTGACATCATGAAACGTAAACCACGTGA
CCCTATACGTGATAAATTGGTGAATGAACGTTTGATCAGTTTGGCGTACG
GTCAAATTGGTATGATCCAGGCTATTGCTGGTTTTTTCACCTACTTTGTG
ATCATGGCTGAGAATGGTTTCTTGCCATCCTTCCTAATGGGTATCCGATC
CCAATGGGATGACAAAAACAATAATTCAGTCATCGATTCTTACGGTAGCG
AATGGACGTACTCTCAACGCAAAGATTTGGAGTTGACTTGTCACACAGCT
TTCTTTACTACCATCGTTGTTGTCCAATGGGCTGACGTCATCATCTCCAA
AACAAGACGTCTCTCCGTATTTACGCAAGGAATGACaaACTGGATGTTGA
ATTTTGGTTTGGTTTTCGAAACTTTATTAGCTGCCTTCTTGCAATACACA
CCAGGTTTGAGTACTGGCTTACGTTTACGCCCATTGAACGCCTCGTGGTG
GTTCTGTGGTGTCCCTTTTTCCTTGTTGATCTGGATTTATGATGAAATCA
GAAGATATTTGTTAAGAAAGTATCCTGGagGATGGGTGGAGCAAGAGACA
TATTATTAAatggctgacgaagGAAAAGAAGAACTAACGAAAAATGAAGC
AGAAACGCCTCAAGATCCTGCTGTAGAAGCGCCAACTGTAGAAAACGATA
ACACAGAACAAAAGGGGGATGGAGATGATACAAGTAATAGCAGTTATATT
GTGGCAGTTAAATCCAACACAAACTCTAAAGCTGAAGGTGACAAAAAAGA
TGCCGCAATTTCTAAAAagaacaagaaaacaaaaaagaaagatgACTTAA
ATGACTTAAAGAAAGAACTTGAGCTAACTTGTCATAGTGAAAATTTGGAT
GATCTTATTGCTCAATATGAAACAAACCTTACAACCGGTCTGACTAAAGA
GATTGCTGCTCGAAACCTTGAACGTGATGGCCCAAATGCTCTCTCCCCTC
CAAAACAAACACCTGAATGGATCAAATTTTGTAAACAATTATTTGGGGGG
TTTTCAATGTTACTTTGGGTTGGTGCAATCCTTTGTTTCTTTGCTTATGG
TATTCGAACAGTCAGAGAGGATGATCCGAGTCAAGATGAGTTATATCTTG
GAATTGTACTTGCTGTTGTTGTCATTATTACTGGTTGTTTCTCTTATTAT
CAAGAAGCCAAAAGTTCAAAGATCATGGAAAGTTTTAAGAAGATGATCCC
ACAGGAGGCTACAGTATTACGTGATGGGGCAAAGATTCAAATCAATGCGG
AAGAATGTACCATTGGAGACATAGTATTTGTTAAGTTTGGTGACCGTATC
CCTGCGGATATTCGTGTTATCGAGTCAATGGGTTTCAAGGTTGACAACTC
TTCATTGACTGGTGAATCTGAACCACAATCTAGAAACAGTGAATGTACTT
CAGAGAATCCTTTGGAAACCAAAAACTTGGCTTTCTTTTCCACAAACGCT
GTTGAAGgtACTGCGACTGGTATGGTCGTTAACATTGGTGATAACACTGT
CATGGGACGTATTGCCAACTTGGCTTCTGGTCTCGGCGCTGGTAAAACGC
CTATTGCTCTTGAATTGGAACATTTTATTCATATCATTACTGGAGTTGCA
GTGTTCCTTGGTGTGACATTCCTCATCATTTCACTTGCTATGGATTACCA
TTGGTTAGAAGCGATCATCTTTTTGATTGGTATTATTGTAGCTAACGTCC
CTGAAGGTCTACTTGCCACTGTCACAGTATGTTTAACATTGACAGCAAAG
AAAATGGCAGCCAAGAATTGTTTAGTCAAACATTTGGAAGCTGTAGAAAC
CCTGGGAAGTACTTCTGTTATTTGCTCAGATAAAACTGGAACATTGACAC
AAAATCGTATGACCGTTGCACACATGTGGTTTGACAAGATGATTATTGAA
GCTGACACGACTGAAGATCAATCAGGACTTTCACATGACAAAGGTTCATC
TACATGGAAAGCCCTTGCCAAAATTGGTGGTCTGTGCAATCGTGCCGAGT
TCAAAGAAGGACAGGAAGATTTACCCATATTAAGGAAAGAGTGTAACGGT
GATGCTTCAGAGActgctattttgaaatttgttgaacTGTCTGTCGGCAA
TGTTATGGATATGCGTTCTAAGAATGGAAAGGTTGTTGAAATCCCATTCA
ATTCAACCAACAAATATCAAGTATCTATCCACAAACAAGAAGATGAGAAA
GACCCCCGATATCTTTTGGTTATGAAAGGTGCTCCTGAACGAATTCTAGA
CAGATGTTCAACAATCTTGCTCCAAGGTGAAGAGAAACCATTGGATGATG
AAATGAAGGACGCATTCAATGATGCATATCTTCAACTTGGTGGTCTTGGT
GAACGCGTCTTGGGATTCTGCCATTACTATCTTCCTGCTGAAAACTTTCC
TGAAGGATTCGAGTTTCAAACAGATGATCCATGTAATTTCCCACTTGATA
ACCTATGTTTCGTTGGTTTGATGAGTATGATTGATCCTCCAAGAGCTGCT
GTGCCCGATGCTGTCAGCAAGTGCCGAAGTGCAGGAATCAAGGTCATCAT
GGTTACAGGTGATCATCCAATCACAGCAAAAGCTATCGCCAAAGGTGTCG
GCATCATCTCCGAAGGAAATGAGACTGTTGAAGACATTGCTCAACGCTTG
AATATTCCTGTTGAAGAAGTCAATCCTCGTGATGCACACGCTGCTGTTGT
CCATGGAACTCAACTGAAAGACTTGTCAGCGGAGGACATTGACGACATTT
TGAAATACCACACTGAAATTGTGTTTGCCAGGACTTCACCACAACAAAAA
TTGATCATTGTTGAAGGATGTCAACGTCAAGGAGCTATCGTTGCTGTCAC
CGGAGATGGTGTTAATGATTCGCCTGCTTTGAAGAAAGCTGATATCGGTG
TTGCTATGGGGATTGCTGGCTCAGACGTTTCAAAACAAGCAGCTGACATG
ATCTTATTGGATGACAATTTCGCTTCCATTGTCACCGGAGTTGAAGAAGG
ACGTCTCATTTTTGACAATCTCAAAAAATCAATTGCTTACACCTTAACCA
GTAACATTCCAGAGATCTCGCCGTTCTTGATGTTTATTTTGCTCAGTATT
CCACTCCCTCTTGGTACTGTCACCATTCTGTGCATCGATTTAGGCACTGA
CTTGATACCCGCCATTTCTCTTGCTTACGAGAAGGCTGAGACTGACATCA
TGAAACGTAAACCACGTGACCCTATACGTGATAAATTGGTGAATGAACGT
TTGATCAGTTTGGCGTACGGTCAAATTGGTATGATCCAGGCTATTGCTGG
TTTTTTCACCTACTTTGTGATCATGGCTGAGAATGGTTTCTTGCCATCCT
TCCTAATGGGTATCCGATCCCAATGGGATGACAAAAACAATAATTCAGTC
ATCGATTCTTACGGTAGCGAATGGACGTACTCTCAACGCAAAGATTTGGA
GTTGACTTGTCACACAGCTTTCTTTACTACCATCGTTGTTGTCCAATGGG
CTGACGTCATCATCTCCAAAACAAGACGTCTCTCCGTATTTACGCAAGGA
ATGACaaACTGGATGTTGAATTTTGGTTTGGTTTTCGAAACTTTATTAGC
TGCCTTCTTGCAATACACACCAGGTTTGAGTACTGGCTTACGTTTACGCC
CATTGAACGCCTCGTGGTGGTTCTGTGGTGTCCCTTTTTCCTTGTTGATC
TGGATTTATGATGAAATCAGAAGATATTTGTTAAGAAAGTATCCTGGagG
ATGGGTGGAGCAAGAGACATATTATTAAatggctgacgaagGAAAAGAAG
AACTAACGAAAAATGAAGCAGAAACGCCTCAAGATCCTGCTGTAGAAGCG
CCAACTGTAGAAAACGATAACACAGAACAAAAGGGGGATGGAGATGATAC
AAGTAATAGCAGTTATATTGTGGCAGTTAAATCCAACACAAACTCTAAAG
CTGAAGGTGACAAAAAAGATGCCGCAATTTCTAAAAagaacaagaaaaca
aaaaagaaagatgACTTAAATGACTTAAAGAAAGAACTTGAGCTAACTTG
TCATAGTGAAAATTTGGATGATCTTATTGCTCAATATGAAACAAACCTTA
CAACCGGTCTGACTAAAGAGATTGCTGCTCGAAACCTTGAACGTGATGGC
CCAAATGCTCTCTCCCCTCCAAAACAAACACCTGAATGGATCAAATTTTG
TAAACAATTATTTGGGGGGTTTTCAATGTTACTTTGGGTTGGTGCAATCC
TTTGTTTCTTTGCTTATGGTATTCGAACAGTCAGAGAGGATGATCCGAGT
CAAGATGAGTTATATCTTGGAATTGTACTTGCTGTTGTTGTCATTATTAC
TGGTTGTTTCTCTTATTATCAAGAAGCCAAAAGTTCAAAGATCATGGAAA
GTTTTAAGAAGATGATCCCACAGGAGGCTACAGTATTACGTGATGGGGCA
AAGATTCAAATCAATGCGGAAGAATGTACCATTGGAGACATAGTATTTGT
TAAGTTTGGTGACCGTATCCCTGCGGATATTCGTGTTATCGAGTCAATGG
GTTTCAAGGTTGACAACTCTTCATTGACTGGTGAATCTGAACCACAATCT
AGAAACAGTGAATGTACTTCAGAGAATCCTTTGGAAACCAAAAACTTGGC
TTTCTTTTCCACAAACGCTGTTGAAGgtACTGCGACTGGTATGGTCGTTA
ACATTGGTGATAACACTGTCATGGGACGTATTGCCAACTTGGCTTCTGGT
CTCGGCGCTGGTAAAACGCCTATTGCTCTTGAATTGGAACATTTTATTCA
TATCATTACTGGAGTTGCAGTGTTCCTTGGTGTGACATTCCTCATCATTT
CACTTGCTATGGATTACCATTGGTTAGAAGCGATCATCTTTTTGATTGGT
ATTATTGTAGCTAACGTCCCTGAAGGTCTACTTGCCACTGTCACAGTATG
TTTAACATTGACAGCAAAGAAAATGGCAGCCAAGAATTGTTTAGTCAAAC
ATTTGGAAGCTGTAGAAACCCTGGGAAGTACTTCTGTTATTTGCTCAGAT
AAAACTGGAACATTGACACAAAATCGTATGACCGTTGCACACATGTGGTT
TGACAAGATGATTATTGAAGCTGACACGACTGAAGATCAATCAGGACTTT
CACATGACAAAGGTTCATCTACATGGAAAGCCCTTGCCAAAATTGGTGGT
CTGTGCAATCGTGCCGAGTTCAAAGAAGGACAGGAAGATTTACCCATATT
AAGGAAAGAGTGTAACGGTGATGCTTCAGAGActgctattttgaaatttg
ttgaacTGTCTGTCGGCAATGTTATGGATATGCGTTCTAAGAATGGAAAG
GTTGTTGAAATCCCATTCAATTCAACCAACAAATATCAAGTATCTATCCA
CAAACAAGAAGATGAGAAAGACCCCCGATATCTTTTGGTTATGAAAGGTG
CTCCTGAACGAATTCTAGACAGATGTTCAACAATCTTGCTCCAAGGTGAA
GAGAAACCATTGGATGATGAAATGAAGGACGCATTCAATGATGCATATCT
TCAACTTGGTGGTCTTGGTGAACGCGTCTTGGGATTCTGCCATTACTATC
TTCCTGCTGAAAACTTTCCTGAAGGATTCGAGTTTCAAACAGATGATCCA
TGTAATTTCCCACTTGATAACCTATGTTTCGTTGGTTTGATGAGTATGAT
TGATCCTCCAAGAGCTGCTGTGCCCGATGCTGTCAGCAAGTGCCGAAGTG
CAGGAATCAAGGTCATCATGGTTACAGGTGATCATCCAATCACAGCAAAA
GCTATCGCCAAAGGTGTCGGCATCATCTCCGAAGGAAATGAGACTGTTGA
AGACATTGCTCAACGCTTGAATATTCCTGTTGAAGAAGTCAATCCTCGTG
ATGCACACGCTGCTGTTGTCCATGGAACTCAACTGAAAGACTTGTCAGCG
GAGGACATTGACGACATTTTGAAATACCACACTGAAATTGTGTTTGCCAG
GACTTCACCACAACAAAAATTGATCATTGTTGAAGGATGTCAACGTCAAG
GAGCTATCGTTGCTGTCACCGGAGATGGTGTTAATGATTCGCCTGCTTTG
AAGAAAGCTGATATCGGTGTTGCTATGGGGATTGCTGGCTCAGACGTTTC
AAAACAAGCAGCTGACATGATCTTATTGGATGACAATTTCGCTTCCATTG
TCACCGGAGTTGAAGAAGGACGTCTCATTTTTGACAATCTCAAAAAATCA
ATTGCTTACACCTTAACCAGTAACATTCCAGAGATCTCGCCGTTCTTGAT
GTTTATTTTGCTCAGTATTCCACTCCCTCTTGGTACTGTCACCATTCTGT
GCATCGATTTAGGCACTGACTTGATACCCGCCATTTCTCTTGCTTACGAG
AAGGCTGAGACTGACATCATGAAACGTAAACCACGTGACCCTATACGTGA
TAAATTGGTGAATGAACGTTTGATCAGTTTGGCGTACGGTCAAATTGGTA
TGATCCAGGCTATTGCTGGTTTTTTCACCTACTTTGTGATCATGGCTGAG
AATGGTTTCTTGCCATCCTTCCTAATGGGTATCCGATCCCAATGGGATGA
CAAAAACAATAATTCAGTCATCGATTCTTACGGTAGCGAATGGACGTACT
CTCAACGCAAAGATTTGGAGTTGACTTGTCACACAGCTTTCTTTACTACC
ATCGTTGTTGTCCAATGGGCTGACGTCATCATCTCCAAAACAAGACGTCT
CTCCGTATTTACGCAAGGAATGACaaACTGGATGTTGAATTTTGGTTTGG
TTTTCGAAACTTTATTAGCTGCCTTCTTGCAATACACACCAGGTTTGAGT
ACTGGCTTACGTTTACGCCCATTGAACGCCTCGTGGTGGTTCTGTGGTGT
CCCTTTTTCCTTGTTGATCTGGATTTATGATGAAATCAGAAGATATTTGT
TAAGAAAGTATCCTGGagGATGGGTGGAGCAAGAGACATATTATTAAatg
gctgacgaagGAAAAGAAGAACTAACGAAAAATGAAGCAGAAACGCCTCA
AGATCCTGCTGTAGAAGCGCCAACTGTAGAAAACGATAACACAGAACAAA
AGGGGGATGGAGATGATACAAGTAATAGCAGTTATATTGTGGCAGTTAAA
TCCAACACAAACTCTAAAGCTGAAGGTGACAAAAAAGATGCCGCAATTTC
TAAAAagaacaagaaaacaaaaaagaaagatgACTTAAATGACTTAAAGA
AAGAACTTGAGCTAACTTGTCATAGTGAAAATTTGGATGATCTTATTGCT
CAATATGAAACAAACCTTACAACCGGTCTGACTAAAGAGATTGCTGCTCG
AAACCTTGAACGTGATGGCCCAAATGCTCTCTCCCCTCCAAAACAAACAC
CTGAATGGATCAAATTTTGTAAACAATTATTTGGGGGGTTTTCAATGTTA
CTTTGGGTTGGTGCAATCCTTTGTTTCTTTGCTTATGGTATTCGAACAGT
CAGAGAGGATGATCCGAGTCAAGATGAGTTATATCTTGGAATTGTACTTG
CTGTTGTTGTCATTATTACTGGTTGTTTCTCTTATTATCAAGAAGCCAAA
AGTTCAAAGATCATGGAAAGTTTTAAGAAGATGATCCCACAGGAGGCTAC
AGTATTACGTGATGGGGCAAAGATTCAAATCAATGCGGAAGAATGTACCA
TTGGAGACATAGTATTTGTTAAGTTTGGTGACCGTATCCCTGCGGATATT
CGTGTTATCGAGTCAATGGGTTTCAAGGTTGACAACTCTTCATTGACTGG
TGAATCTGAACCACAATCTAGAAACAGTGAATGTACTTCAGAGAATCCTT
TGGAAACCAAAAACTTGGCTTTCTTTTCCACAAACGCTGTTGAAGgtACT
GCGACTGGTATGGTCGTTAACATTGGTGATAACACTGTCATGGGACGTAT
TGCCAACTTGGCTTCTGGTCTCGGCGCTGGTAAAACGCCTATTGCTCTTG
AATTGGAACATTTTATTCATATCATTACTGGAGTTGCAGTGTTCCTTGGT
GTGACATTCCTCATCATTTCACTTGCTATGGATTACCATTGGTTAGAAGC
GATCATCTTTTTGATTGGTATTATTGTAGCTAACGTCCCTGAAGGTCTAC
TTGCCACTGTCACAGTATGTTTAACATTGACAGCAAAGAAAATGGCAGCC
AAGAATTGTTTAGTCAAACATTTGGAAGCTGTAGAAACCCTGGGAAGTAC
TTCTGTTATTTGCTCAGATAAAACTGGAACATTGACACAAAATCGTATGA
CCGTTGCACACATGTGGTTTGACAAGATGATTATTGAAGCTGACACGACT
GAAGATCAATCAGGACTTTCACATGACAAAGGTTCATCTACATGGAAAGC
CCTTGCCAAAATTGGTGGTCTGTGCAATCGTGCCGAGTTCAAAGAAGGAC
AGGAAGATTTACCCATATTAAGGAAAGAGTGTAACGGTGATGCTTCAGAG
ActgctattttgaaatttgttgaacTGTCTGTCGGCAATGTTATGGATAT
GCGTTCTAAGAATGGAAAGGTTGTTGAAATCCCATTCAATTCAACCAACA
AATATCAAGTATCTATCCACAAACAAGAAGATGAGAAAGACCCCCGATAT
CTTTTGGTTATGAAAGGTGCTCCTGAACGAATTCTAGACAGATGTTCAAC
AATCTTGCTCCAAGGTGAAGAGAAACCATTGGATGATGAAATGAAGGACG
CATTCAATGATGCATATCTTCAACTTGGTGGTCTTGGTGAACGCGTCTTG
GGATTCTGCCATTACTATCTTCCTGCTGAAAACTTTCCTGAAGGATTCGA
GTTTCAAACAGATGATCCATGTAATTTCCCACTTGATAACCTATGTTTCG
TTGGTTTGATGAGTATGATTGATCCTCCAAGAGCTGCTGTGCCCGATGCT
GTCAGCAAGTGCCGAAGTGCAGGAATCAAGGTCATCATGGTTACAGGTGA
TCATCCAATCACAGCAAAAGCTATCGCCAAAGGTGTCGGCATCATCTCCG
AAGGAAATGAGACTGTTGAAGACATTGCTCAACGCTTGAATATTCCTGTT
GAAGAAGTCAATCCTCGTGATGCACACGCTGCTGTTGTCCATGGAACTCA
ACTGAAAGACTTGTCAGCGGAGGACATTGACGACATTTTGAAATACCACA
CTGAAATTGTGTTTGCCAGGACTTCACCACAACAAAAATTGATCATTGTT
GAAGGATGTCAACGTCAAGGAGCTATCGTTGCTGTCACCGGAGATGGTGT
TAATGATTCGCCTGCTTTGAAGAAAGCTGATATCGGTGTTGCTATGGGGA
TTGCTGGCTCAGACGTTTCAAAACAAGCAGCTGACATGATCTTATTGGAT
GACAATTTCGCTTCCATTGTCACCGGAGTTGAAGAAGGACGTCTCATTTT
TGACAATCTCAAAAAATCAATTGCTTACACCTTAACCAGTAACATTCCAG
AGATCTCGCCGTTCTTGATGTTTATTTTGCTCAGTATTCCACTCCCTCTT
GGTACTGTCACCATTCTGTGCATCGATTTAGGCACTGACTTGATACCCGC
CATTTCTCTTGCTTACGAGAAGGCTGAGACTGACATCATGAAACGTAAAC
CACGTGACCCTATACGTGATAAATTGGTGAATGAACGTTTGATCAGTTTG
GCGTACGGTCAAATTGGTATGATCCAGGCTATTGCTGGTTTTTTCACCTA
CTTTGTGATCATGGCTGAGAATGGTTTCTTGCCATCCTTCCTAATGGGTA
TCCGATCCCAATGGGATGACAAAAACAATAATTCAGTCATCGATTCTTAC
GGTAGCGAATGGACGTACTCTCAACGCAAAGATTTGGAGTTGACTTGTCA
CACAGCTTTCTTTACTACCATCGTTGTTGTCCAATGGGCTGACGTCATCA
TCTCCAAAACAAGACGTCTCTCCGTATTTACGCAAGGAATGACaaACTGG
ATGTTGAATTTTGGTTTGGTTTTCGAAACTTTATTAGCTGCCTTCTTGCA
ATACACACCAGGTTTGAGTACTGGCTTACGTTTACGCCCATTGAACGCCT
CGTGGTGGTTCTGTGGTGTCCCTTTTTCCTTGTTGATCTGGATTTATGAT
GAAATCAGAAGATATTTGTTAAGAAAGTATCCTGGagGATGGGTGGAGCA
AGAGACATATTATTAAatggctgacgaagGAAAAGAAGAACTAACGAAAA
ATGAAGCAGAAACGCCTCAAGATCCTGCTGTAGAAGCGCCAACTGTAGAA
AACGATAACACAGAACAAAAGGGGGATGGAGATGATACAAGTAATAGCAG
TTATATTGTGGCAGTTAAATCCAACACAAACTCTAAAGCTGAAGGTGACA
AAAAAGATGCCGCAATTTCTAAAAagaacaagaaaacaaaaaagaaagat
gACTTAAATGACTTAAAGAAAGAACTTGAGCTAACTTGTCATAGTGAAAA
TTTGGATGATCTTATTGCTCAATATGAAACAAACCTTACAACCGGTCTGA
CTAAAGAGATTGCTGCTCGAAACCTTGAACGTGATGGCCCAAATGCTCTC
TCCCCTCCAAAACAAACACCTGAATGGATCAAATTTTGTAAACAATTATT
TGGGGGGTTTTCAATGTTACTTTGGGTTGGTGCAATCCTTTGTTTCTTTG
CTTATGGTATTCGAACAGTCAGAGAGGATGATCCGAGTCAAGATGAGTTA
TATCTTGGAATTGTACTTGCTGTTGTTGTCATTATTACTGGTTGTTTCTC
TTATTATCAAGAAGCCAAAAGTTCAAAGATCATGGAAAGTTTTAAGAAGA
TGATCCCACAGGAGGCTACAGTATTACGTGATGGGGCAAAGATTCAAATC
AATGCGGAAGAATGTACCATTGGAGACATAGTATTTGTTAAGTTTGGTGA
CCGTATCCCTGCGGATATTCGTGTTATCGAGTCAATGGGTTTCAAGGTTG
ACAACTCTTCATTGACTGGTGAATCTGAACCACAATCTAGAAACAGTGAA
TGTACTTCAGAGAATCCTTTGGAAACCAAAAACTTGGCTTTCTTTTCCAC
AAACGCTGTTGAAGgtACTGCGACTGGTATGGTCGTTAACATTGGTGATA
ACACTGTCATGGGACGTATTGCCAACTTGGCTTCTGGTCTCGGCGCTGGT
AAAACGCCTATTGCTCTTGAATTGGAACATTTTATTCATATCATTACTGG
AGTTGCAGTGTTCCTTGGTGTGACATTCCTCATCATTTCACTTGCTATGG
ATTACCATTGGTTAGAAGCGATCATCTTTTTGATTGGTATTATTGTAGCT
AACGTCCCTGAAGGTCTACTTGCCACTGTCACAGTATGTTTAACATTGAC
AGCAAAGAAAATGGCAGCCAAGAATTGTTTAGTCAAACATTTGGAAGCTG
TAGAAACCCTGGGAAGTACTTCTGTTATTTGCTCAGATAAAACTGGAACA
TTGACACAAAATCGTATGACCGTTGCACACATGTGGTTTGACAAGATGAT
TATTGAAGCTGACACGACTGAAGATCAATCAGGACTTTCACATGACAAAG
GTTCATCTACATGGAAAGCCCTTGCCAAAATTGGTGGTCTGTGCAATCGT
GCCGAGTTCAAAGAAGGACAGGAAGATTTACCCATATTAAGGAAAGAGTG
TAACGGTGATGCTTCAGAGActgctattttgaaatttgttgaacTGTCTG
TCGGCAATGTTATGGATATGCGTTCTAAGAATGGAAAGGTTGTTGAAATC
CCATTCAATTCAACCAACAAATATCAAGTATCTATCCACAAACAAGAAGA
TGAGAAAGACCCCCGATATCTTTTGGTTATGAAAGGTGCTCCTGAACGAA
TTCTAGACAGATGTTCAACAATCTTGCTCCAAGGTGAAGAGAAACCATTG
GATGATGAAATGAAGGACGCATTCAATGATGCATATCTTCAACTTGGTGG
TCTTGGTGAACGCGTCTTGGGATTCTGCCATTACTATCTTCCTGCTGAAA
ACTTTCCTGAAGGATTCGAGTTTCAAACAGATGATCCATGTAATTTCCCA
CTTGATAACCTATGTTTCGTTGGTTTGATGAGTATGATTGATCCTCCAAG
AGCTGCTGTGCCCGATGCTGTCAGCAAGTGCCGAAGTGCAGGAATCAAGG
TCATCATGGTTACAGGTGATCATCCAATCACAGCAAAAGCTATCGCCAAA
GGTGTCGGCATCATCTCCGAAGGAAATGAGACTGTTGAAGACATTGCTCA
ACGCTTGAATATTCCTGTTGAAGAAGTCAATCCTCGTGATGCACACGCTG
CTGTTGTCCATGGAACTCAACTGAAAGACTTGTCAGCGGAGGACATTGAC
GACATTTTGAAATACCACACTGAAATTGTGTTTGCCAGGACTTCACCACA
ACAAAAATTGATCATTGTTGAAGGATGTCAACGTCAAGGAGCTATCGTTG
CTGTCACCGGAGATGGTGTTAATGATTCGCCTGCTTTGAAGAAAGCTGAT
ATCGGTGTTGCTATGGGGATTGCTGGCTCAGACGTTTCAAAACAAGCAGC
TGACATGATCTTATTGGATGACAATTTCGCTTCCATTGTCACCGGAGTTG
AAGAAGGACGTCTCATTTTTGACAATCTCAAAAAATCAATTGCTTACACC
TTAACCAGTAACATTCCAGAGATCTCGCCGTTCTTGATGTTTATTTTGCT
CAGTATTCCACTCCCTCTTGGTACTGTCACCATTCTGTGCATCGATTTAG
GCACTGACTTGATACCCGCCATTTCTCTTGCTTACGAGAAGGCTGAGACT
GACATCATGAAACGTAAACCACGTGACCCTATACGTGATAAATTGGTGAA
TGAACGTTTGATCAGTTTGGCGTACGGTCAAATTGGTATGATCCAGGCTA
TTGCTGGTTTTTTCACCTACTTTGTGATCATGGCTGAGAATGGTTTCTTG
CCATCCTTCCTAATGGGTATCCGATCCCAATGGGATGACAAAAACAATAA
TTCAGTCATCGATTCTTACGGTAGCGAATGGACGTACTCTCAACGCAAAG
ATTTGGAGTTGACTTGTCACACAGCTTTCTTTACTACCATCGTTGTTGTC
CAATGGGCTGACGTCATCATCTCCAAAACAAGACGTCTCTCCGTATTTAC
GCAAGGAATGACaaACTGGATGTTGAATTTTGGTTTGGTTTTCGAAACTT
TATTAGCTGCCTTCTTGCAATACACACCAGGTTTGAGTACTGGCTTACGT
TTACGCCCATTGAACGCCTCGTGGTGGTTCTGTGGTGTCCCTTTTTCCTT
GTTGATCTGGATTTATGATGAAATCAGAAGATATTTGTTAAGAAAGTATC
CTGGagGATGGGTGGAGCAAGAGACATATTATTAAatggctgacgaagGA
AAAGAAGAACTAACGAAAAATGAAGCAGAAACGCCTCAAGATCCTGCTGT
AGAAGCGCCAACTGTAGAAAACGATAACACAGAACAAAAGGGGGATGGAG
ATGATACAAGTAATAGCAGTTATATTGTGGCAGTTAAATCCAACACAAAC
TCTAAAGCTGAAGGTGACAAAAAAGATGCCGCAATTTCTAAAAagaacaa
gaaaacaaaaaagaaagatgACTTAAATGACTTAAAGAAAGAACTTGAGC
TAACTTGTCATAGTGAAAATTTGGATGATCTTATTGCTCAATATGAAACA
AACCTTACAACCGGTCTGACTAAAGAGATTGCTGCTCGAAACCTTGAACG
TGATGGCCCAAATGCTCTCTCCCCTCCAAAACAAACACCTGAATGGATCA
AATTTTGTAAACAATTATTTGGGGGGTTTTCAATGTTACTTTGGGTTGGT
GCAATCCTTTGTTTCTTTGCTTATGGTATTCGAACAGTCAGAGAGGATGA
TCCGAGTCAAGATGAGTTATATCTTGGAATTGTACTTGCTGTTGTTGTCA
TTATTACTGGTTGTTTCTCTTATTATCAAGAAGCCAAAAGTTCAAAGATC
ATGGAAAGTTTTAAGAAGATGATCCCACAGGAGGCTACAGTATTACGTGA
TGGGGCAAAGATTCAAATCAATGCGGAAGAATGTACCATTGGAGACATAG
TATTTGTTAAGTTTGGTGACCGTATCCCTGCGGATATTCGTGTTATCGAG
TCAATGGGTTTCAAGGTTGACAACTCTTCATTGACTGGTGAATCTGAACC
ACAATCTAGAAACAGTGAATGTACTTCAGAGAATCCTTTGGAAACCAAAA
ACTTGGCTTTCTTTTCCACAAACGCTGTTGAAGgtACTGCGACTGGTATG
GTCGTTAACATTGGTGATAACACTGTCATGGGACGTATTGCCAACTTGGC
TTCTGGTCTCGGCGCTGGTAAAACGCCTATTGCTCTTGAATTGGAACATT
TTATTCATATCATTACTGGAGTTGCAGTGTTCCTTGGTGTGACATTCCTC
ATCATTTCACTTGCTATGGATTACCATTGGTTAGAAGCGATCATCTTTTT
GATTGGTATTATTGTAGCTAACGTCCCTGAAGGTCTACTTGCCACTGTCA
CAGTATGTTTAACATTGACAGCAAAGAAAATGGCAGCCAAGAATTGTTTA
GTCAAACATTTGGAAGCTGTAGAAACCCTGGGAAGTACTTCTGTTATTTG
CTCAGATAAAACTGGAACATTGACACAAAATCGTATGACCGTTGCACACA
TGTGGTTTGACAAGATGATTATTGAAGCTGACACGACTGAAGATCAATCA
GGACTTTCACATGACAAAGGTTCATCTACATGGAAAGCCCTTGCCAAAAT
TGGTGGTCTGTGCAATCGTGCCGAGTTCAAAGAAGGACAGGAAGATTTAC
CCATATTAAGGAAAGAGTGTAACGGTGATGCTTCAGAGActgctattttg
aaatttgttgaacTGTCTGTCGGCAATGTTATGGATATGCGTTCTAAGAA
TGGAAAGGTTGTTGAAATCCCATTCAATTCAACCAACAAATATCAAGTAT
CTATCCACAAACAAGAAGATGAGAAAGACCCCCGATATCTTTTGGTTATG
AAAGGTGCTCCTGAACGAATTCTAGACAGATGTTCAACAATCTTGCTCCA
AGGTGAAGAGAAACCATTGGATGATGAAATGAAGGACGCATTCAATGATG
CATATCTTCAACTTGGTGGTCTTGGTGAACGCGTCTTGGGATTCTGCCAT
TACTATCTTCCTGCTGAAAACTTTCCTGAAGGATTCGAGTTTCAAACAGA
TGATCCATGTAATTTCCCACTTGATAACCTATGTTTCGTTGGTTTGATGA
GTATGATTGATCCTCCAAGAGCTGCTGTGCCCGATGCTGTCAGCAAGTGC
CGAAGTGCAGGAATCAAGGTCATCATGGTTACAGGTGATCATCCAATCAC
AGCAAAAGCTATCGCCAAAGGTGTCGGCATCATCTCCGAAGGAAATGAGA
CTGTTGAAGACATTGCTCAACGCTTGAATATTCCTGTTGAAGAAGTCAAT
CCTCGTGATGCACACGCTGCTGTTGTCCATGGAACTCAACTGAAAGACTT
GTCAGCGGAGGACATTGACGACATTTTGAAATACCACACTGAAATTGTGT
TTGCCAGGACTTCACCACAACAAAAATTGATCATTGTTGAAGGATGTCAA
CGTCAAGGAGCTATCGTTGCTGTCACCGGAGATGGTGTTAATGATTCGCC
TGCTTTGAAGAAAGCTGATATCGGTGTTGCTATGGGGATTGCTGGCTCAG
ACGTTTCAAAACAAGCAGCTGACATGATCTTATTGGATGACAATTTCGCT
TCCATTGTCACCGGAGTTGAAGAAGGACGTCTCATTTTTGACAATCTCAA
AAAATCAATTGCTTACACCTTAACCAGTAACATTCCAGAGATCTCGCCGT
TCTTGATGTTTATTTTGCTCAGTATTCCACTCCCTCTTGGTACTGTCACC
ATTCTGTGCATCGATTTAGGCACTGACTTGATACCCGCCATTTCTCTTGC
TTACGAGAAGGCTGAGACTGACATCATGAAACGTAAACCACGTGACCCTA
TACGTGATAAATTGGTGAATGAACGTTTGATCAGTTTGGCGTACGGTCAA
ATTGGTATGATCCAGGCTATTGCTGGTTTTTTCACCTACTTTGTGATCAT
GGCTGAGAATGGTTTCTTGCCATCCTTCCTAATGGGTATCCGATCCCAAT
GGGATGACAAAAACAATAATTCAGTCATCGATTCTTACGGTAGCGAATGG
ACGTACTCTCAACGCAAAGATTTGGAGTTGACTTGTCACACAGCTTTCTT
TACTACCATCGTTGTTGTCCAATGGGCTGACGTCATCATCTCCAAAACAA
GACGTCTCTCCGTATTTACGCAAGGAATGACaaACTGGATGTTGAATTTT
GGTTTGGTTTTCGAAACTTTATTAGCTGCCTTCTTGCAATACACACCAGG
TTTGAGTACTGGCTTACGTTTACGCCCATTGAACGCCTCGTGGTGGTTCT
GTGGTGTCCCTTTTTCCTTGTTGATCTGGATTTATGATGAAATCAGAAGA
TATTTGTTAAGAAAGTATCCTGGagGATGGGTGGAGCAAGAGACATATTA
TTAAatggctgacgaagGAAAAGAAGAACTAACGAAAAATGAAGCAGAAA
CGCCTCAAGATCCTGCTGTAGAAGCGCCAACTGTAGAAAACGATAACACA
GAACAAAAGGGGGATGGAGATGATACAAGTAATAGCAGTTATATTGTGGC
AGTTAAATCCAACACAAACTCTAAAGCTGAAGGTGACAAAAAAGATGCCG
CAATTTCTAAAAagaacaagaaaacaaaaaagaaagatgACTTAAATGAC
TTAAAGAAAGAACTTGAGCTAACTTGTCATAGTGAAAATTTGGATGATCT
TATTGCTCAATATGAAACAAACCTTACAACCGGTCTGACTAAAGAGATTG
CTGCTCGAAACCTTGAACGTGATGGCCCAAATGCTCTCTCCCCTCCAAAA
CAAACACCTGAATGGATCAAATTTTGTAAACAATTATTTGGGGGGTTTTC
AATGTTACTTTGGGTTGGTGCAATCCTTTGTTTCTTTGCTTATGGTATTC
GAACAGTCAGAGAGGATGATCCGAGTCAAGATGAGTTATATCTTGGAATT
GTACTTGCTGTTGTTGTCATTATTACTGGTTGTTTCTCTTATTATCAAGA
AGCCAAAAGTTCAAAGATCATGGAAAGTTTTAAGAAGATGATCCCACAGG
AGGCTACAGTATTACGTGATGGGGCAAAGATTCAAATCAATGCGGAAGAA
TGTACCATTGGAGACATAGTATTTGTTAAGTTTGGTGACCGTATCCCTGC
GGATATTCGTGTTATCGAGTCAATGGGTTTCAAGGTTGACAACTCTTCAT
TGACTGGTGAATCTGAACCACAATCTAGAAACAGTGAATGTACTTCAGAG
AATCCTTTGGAAACCAAAAACTTGGCTTTCTTTTCCACAAACGCTGTTGA
AGgtACTGCGACTGGTATGGTCGTTAACATTGGTGATAACACTGTCATGG
GACGTATTGCCAACTTGGCTTCTGGTCTCGGCGCTGGTAAAACGCCTATT
GCTCTTGAATTGGAACATTTTATTCATATCATTACTGGAGTTGCAGTGTT
CCTTGGTGTGACATTCCTCATCATTTCACTTGCTATGGATTACCATTGGT
TAGAAGCGATCATCTTTTTGATTGGTATTATTGTAGCTAACGTCCCTGAA
GGTCTACTTGCCACTGTCACAGTATGTTTAACATTGACAGCAAAGAAAAT
GGCAGCCAAGAATTGTTTAGTCAAACATTTGGAAGCTGTAGAAACCCTGG
GAAGTACTTCTGTTATTTGCTCAGATAAAACTGGAACATTGACACAAAAT
CGTATGACCGTTGCACACATGTGGTTTGACAAGATGATTATTGAAGCTGA
CACGACTGAAGATCAATCAGGACTTTCACATGACAAAGGTTCATCTACAT
GGAAAGCCCTTGCCAAAATTGGTGGTCTGTGCAATCGTGCCGAGTTCAAA
GAAGGACAGGAAGATTTACCCATATTAAGGAAAGAGTGTAACGGTGATGC
TTCAGAGActgctattttgaaatttgttgaacTGTCTGTCGGCAATGTTA
TGGATATGCGTTCTAAGAATGGAAAGGTTGTTGAAATCCCATTCAATTCA
ACCAACAAATATCAAGTATCTATCCACAAACAAGAAGATGAGAAAGACCC
CCGATATCTTTTGGTTATGAAAGGTGCTCCTGAACGAATTCTAGACAGAT
GTTCAACAATCTTGCTCCAAGGTGAAGAGAAACCATTGGATGATGAAATG
AAGGACGCATTCAATGATGCATATCTTCAACTTGGTGGTCTTGGTGAACG
CGTCTTGGGATTCTGCCATTACTATCTTCCTGCTGAAAACTTTCCTGAAG
GATTCGAGTTTCAAACAGATGATCCATGTAATTTCCCACTTGATAACCTA
TGTTTCGTTGGTTTGATGAGTATGATTGATCCTCCAAGAGCTGCTGTGCC
CGATGCTGTCAGCAAGTGCCGAAGTGCAGGAATCAAGGTCATCATGGTTA
CAGGTGATCATCCAATCACAGCAAAAGCTATCGCCAAAGGTGTCGGCATC
ATCTCCGAAGGAAATGAGACTGTTGAAGACATTGCTCAACGCTTGAATAT
TCCTGTTGAAGAAGTCAATCCTCGTGATGCACACGCTGCTGTTGTCCATG
GAACTCAACTGAAAGACTTGTCAGCGGAGGACATTGACGACATTTTGAAA
TACCACACTGAAATTGTGTTTGCCAGGACTTCACCACAACAAAAATTGAT
CATTGTTGAAGGATGTCAACGTCAAGGAGCTATCGTTGCTGTCACCGGAG
ATGGTGTTAATGATTCGCCTGCTTTGAAGAAAGCTGATATCGGTGTTGCT
ATGGGGATTGCTGGCTCAGACGTTTCAAAACAAGCAGCTGACATGATCTT
ATTGGATGACAATTTCGCTTCCATTGTCACCGGAGTTGAAGAAGGACGTC
TCATTTTTGACAATCTCAAAAAATCAATTGCTTACACCTTAACCAGTAAC
ATTCCAGAGATCTCGCCGTTCTTGATGTTTATTTTGCTCAGTATTCCACT
CCCTCTTGGTACTGTCACCATTCTGTGCATCGATTTAGGCACTGACTTGA
TACCCGCCATTTCTCTTGCTTACGAGAAGGCTGAGACTGACATCATGAAA
CGTAAACCACGTGACCCTATACGTGATAAATTGGTGAATGAACGTTTGAT
CAGTTTGGCGTACGGTCAAATTGGTATGATCCAGGCTATTGCTGGTTTTT
TCACCTACTTTGTGATCATGGCTGAGAATGGTTTCTTGCCATCCTTCCTA
ATGGGTATCCGATCCCAATGGGATGACAAAAACAATAATTCAGTCATCGA
TTCTTACGGTAGCGAATGGACGTACTCTCAACGCAAAGATTTGGAGTTGA
CTTGTCACACAGCTTTCTTTACTACCATCGTTGTTGTCCAATGGGCTGAC
GTCATCATCTCCAAAACAAGACGTCTCTCCGTATTTACGCAAGGAATGAC
aaACTGGATGTTGAATTTTGGTTTGGTTTTCGAAACTTTATTAGCTGCCT
TCTTGCAATACACACCAGGTTTGAGTACTGGCTTACGTTTACGCCCATTG
AACGCCTCGTGGTGGTTCTGTGGTGTCCCTTTTTCCTTGTTGATCTGGAT
TTATGATGAAATCAGAAGATATTTGTTAAGAAAGTATCCTGGagGATGGG
TGGAGCAAGAGACATATTATTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000743XLOC_000743Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001405-exon-sc0000010-1491911889:1110798..1111000TCONS_00001405-exon-sc0000010-1491911889:1110798..1111000Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1110798..1111000TCONS_00001405-exon-sc0000010-1510915933:1110798..1111000Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1110798..1111000TCONS_00001405-exon-sc0000010-1575043694:1110798..1111000Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1111667..1111816TCONS_00001405-exon-sc0000010-1491911889:1111667..1111816Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1111667..1111816TCONS_00001405-exon-sc0000010-1510915933:1111667..1111816Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1111667..1111816TCONS_00001405-exon-sc0000010-1575043694:1111667..1111816Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1113982..1114308TCONS_00001405-exon-sc0000010-1491911889:1113982..1114308Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1113982..1114308TCONS_00001405-exon-sc0000010-1510915933:1113982..1114308Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1113982..1114308TCONS_00001405-exon-sc0000010-1575043694:1113982..1114308Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1114623..1114808TCONS_00001405-exon-sc0000010-1491911889:1114623..1114808Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1114623..1114808TCONS_00001405-exon-sc0000010-1510915933:1114623..1114808Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1114623..1114808TCONS_00001405-exon-sc0000010-1575043694:1114623..1114808Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1114977..1115094TCONS_00001405-exon-sc0000010-1491911889:1114977..1115094Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1114977..1115094TCONS_00001405-exon-sc0000010-1510915933:1114977..1115094Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1114977..1115094TCONS_00001405-exon-sc0000010-1575043694:1114977..1115094Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1115405..1115673TCONS_00001405-exon-sc0000010-1491911889:1115405..1115673Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1115405..1115673TCONS_00001405-exon-sc0000010-1510915933:1115405..1115673Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1115405..1115673TCONS_00001405-exon-sc0000010-1575043694:1115405..1115673Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1121001..1121142TCONS_00001405-exon-sc0000010-1491911889:1121001..1121142Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1121001..1121142TCONS_00001405-exon-sc0000010-1510915933:1121001..1121142Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1121001..1121142TCONS_00001405-exon-sc0000010-1575043694:1121001..1121142Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1121463..1121628TCONS_00001405-exon-sc0000010-1491911889:1121463..1121628Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1121463..1121628TCONS_00001405-exon-sc0000010-1510915933:1121463..1121628Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1121463..1121628TCONS_00001405-exon-sc0000010-1575043694:1121463..1121628Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1122638..1122858TCONS_00001405-exon-sc0000010-1491911889:1122638..1122858Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1122638..1122858TCONS_00001405-exon-sc0000010-1510915933:1122638..1122858Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1122638..1122858TCONS_00001405-exon-sc0000010-1575043694:1122638..1122858Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1123231..1123362TCONS_00001405-exon-sc0000010-1491911889:1123231..1123362Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1123231..1123362TCONS_00001405-exon-sc0000010-1510915933:1123231..1123362Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1123231..1123362TCONS_00001405-exon-sc0000010-1575043694:1123231..1123362Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1123585..1123731TCONS_00001405-exon-sc0000010-1491911889:1123585..1123731Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1123585..1123731TCONS_00001405-exon-sc0000010-1510915933:1123585..1123731Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1123585..1123731TCONS_00001405-exon-sc0000010-1575043694:1123585..1123731Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1124209..1124382TCONS_00001405-exon-sc0000010-1491911889:1124209..1124382Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1124209..1124382TCONS_00001405-exon-sc0000010-1510915933:1124209..1124382Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1124209..1124382TCONS_00001405-exon-sc0000010-1575043694:1124209..1124382Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1124820..1125008TCONS_00001405-exon-sc0000010-1491911889:1124820..1125008Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1124820..1125008TCONS_00001405-exon-sc0000010-1510915933:1124820..1125008Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1124820..1125008TCONS_00001405-exon-sc0000010-1575043694:1124820..1125008Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1125306..1125697TCONS_00001405-exon-sc0000010-1491911889:1125306..1125697Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1125306..1125697TCONS_00001405-exon-sc0000010-1510915933:1125306..1125697Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1125306..1125697TCONS_00001405-exon-sc0000010-1575043694:1125306..1125697Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1126122..1126387TCONS_00001405-exon-sc0000010-1491911889:1126122..1126387Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1126122..1126387TCONS_00001405-exon-sc0000010-1510915933:1126122..1126387Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1126122..1126387TCONS_00001405-exon-sc0000010-1575043694:1126122..1126387Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1126929..1127122TCONS_00001405-exon-sc0000010-1491911889:1126929..1127122Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1126929..1127122TCONS_00001405-exon-sc0000010-1510915933:1126929..1127122Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1126929..1127122TCONS_00001405-exon-sc0000010-1575043694:1126929..1127122Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1491911889:1127848..1128334TCONS_00001405-exon-sc0000010-1491911889:1127848..1128334Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1510915933:1127848..1128334TCONS_00001405-exon-sc0000010-1510915933:1127848..1128334Clytia hemisphaericaexon
TCONS_00001405-exon-sc0000010-1575043694:1127848..1128334TCONS_00001405-exon-sc0000010-1575043694:1127848..1128334Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001405-proteinTCONS_00001405-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:1110798..1128334 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
5.51121 4.50768 2.57747 1.75703 6.66436 5.40415 12.0512 14.8269 27.1996 14.0577 19.6827 19.6552 21.9702 20.4112 15.646 30.2224 22.0733 21.3867 7.42903 12.2596 17.2782 16.3795 9.96004 12.3184 15.7942 17.7202 3.35403 1.7532 1.30757 1.50153
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004014ATPase_P-typ_cation-transptr_N
IPR005775P-type_ATPase_IIC
IPR006068ATPase_P-typ_cation-transptr_C
IPR001757P_typ_ATPase
IPR023299ATPase_P-typ_cyto_domN
IPR018303ATPase_P-typ_P_site
IPR023214HAD-like_dom
IPR023298ATPase_P-typ_TM_dom
IPR008250ATPase_P-typ_transduc_dom_A
Vocabulary: Molecular Function
TermDefinition
GO:0005391sodium:potassium-exchanging ATPase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0006814sodium ion transport
GO:0006813potassium ion transport
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006813 potassium ion transport
biological_process GO:0006814 sodium ion transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005524 ATP binding
molecular_function GO:0000166 nucleotide binding
molecular_function GO:0005391 sodium:potassium-exchanging ATPase activity
Blast
BLAST of TCONS_00001405 vs. Swiss-Prot (Human)
Match: AT1A1 (Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1)

HSP 1 Score: 1539.24 bits (3984), Expect = 0.000e+0
Identity = 744/987 (75.38%), Postives = 857/987 (86.83%), Query Frame = 3
Query:  342 ELELTCHSENLDDLIAQYETNLTTGLTKEIAARNLERDGPNALSPPKQTPEWIKFCKQLFGGFSMLLWVGAILCFFAYGIRTVREDDPSQDELYLGIVLAVVVIITGCFSYYQEAKSSKIMESFKKMIPQEATVLRDGAKIQINAEECTIGDIVFVKFGDRIPADIRVIESMGFKVDNSSLTGESEPQSRNSECTSENPLETKNLAFFSTNAVEGTATGMVVNIGDNTVMGRIANLASGLGAGKTPIALELEHFIHIITGVAVFLGVTFLIISLAMDYHWLEAIIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAAKNCLVKHLEAVETLGSTSVICSDKTGTLTQNRMTVAHMWFDKMIIEADTTEDQSGLSHDKGSSTWKALAKIGGLCNRAEFKEGQEDLPILRKECNGDASETAILKFVELSVGNVMDMRSKNGKVVEIPFNSTNKYQVSIHKQEDEKDPRYLLVMKGAPERILDRCSTILLQGEEKPLDDEMKDAFNDAYLQLGGLGERVLGFCHYYLPAENFPEGFEFQTDDPCNFPLDNLCFVGLMSMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAQRLNIPVEEVNPRDAHAAVVHGTQLKDLSAEDIDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFILLSIPLPLGTVTILCIDLGTDLIPAISLAYEKAETDIMKRKPRDPIRDKLVNERLISLAYGQIGMIQAIAGFFTYFVIMAENGFLPSFLMGIRSQWDDKNNNSVIDSYGSEWTYSQRKDLELTCHTAFFTTIVVVQWADVIISKTRRLSVFTQGMTNWMLNFGLVFETLLAAFLQYTPGLSTGLRLRPLNASWWFCGVPFSLLIWIYDEIRRYLLRKYPGGWVEQETYY 3302
            E+ +  H  +LD+L  +Y T+L+ GLT   AA  L RDGPNAL+PP  TPEWIKFC+QLFGGFSMLLW+GAILCF AY I+   E++P  D LYLG+VL+ VVIITGCFSYYQEAKSSKIMESFK M+PQ+A V+R+G K+ INAEE  +GD+V VK GDRIPAD+R+I + G KVDNSSLTGESEPQ+R+ + T+ENPLET+N+AFFSTN VEGTA G+VV  GD TVMGRIA LASGL  G+TPIA E+EHFIHIITGVAVFLGV+F I+SL ++Y WLEA+IFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVK+LEAVETLGSTS ICSDKTGTLTQNRMTVAHMWFD  I EADTTE+QSG+S DK S+TW AL++I GLCNRA F+  QE+LPIL++   GDASE+A+LK +EL  G+V +MR +  K+VEIPFNSTNKYQ+SIHK  +  +P++LLVMKGAPERILDRCS+ILL G+E+PLD+E+KDAF +AYL+LGGLGERVLGFCH +LP E FPEGF+F TDD  NFP+DNLCFVGL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIA RLNIPV +VNPRDA A VVHG+ LKD+++E +DDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEI+PFL+FI+ +IPLPLGTVTILCIDLGTD++PAISLAYE+AE+DIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA+ GFFTYFVI+AENGFLP  L+G+R  WDD+  N V DSYG +WTY QRK +E TCHTAFF +IVVVQWAD++I KTRR SVF QGM N +L FGL  ET LAAFL Y PG+   LR+ PL  +WWFC  P+SLLI++YDE+R+ ++R+ PGGWVE+ETYY
Sbjct:   38 EVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDD-VNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY 1023          
The following BLAST results are available for this feature:
BLAST of TCONS_00001405 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
AT1A10.000e+075.38Sodium/potassium-transporting ATPase subunit alpha... [more]
back to top