Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001402 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001402
Unique NameTCONS_00001402
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3906

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001402 ID=TCONS_00001402|Name=TCONS_00001402|organism=Clytia hemisphaerica|type=transcript|length=3906bp
ttatttctaatttcAGTTGAGCAATAATCTAAGAATGTTTGTCTGTATGT
CCGTAAACTTTGAGGCAACCTAGAAAGACAGAATAATTCTACGGAGCTAA
AATTTGGCATGCATTCTATTAAGtttttttctctcaaaaataaACAGAGG
TATGGCGATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTC
ATCTTGCagGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGT
GCTTGTACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACG
AATATGTAAAAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTC
GCAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTTACATTATCA
AAATGTAAACATGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTAT
ACAGAACAAAGGTGTTATCTACATAAACGATTTAACAGATTCTGGAGTTA
TGGAATCATTCTCCGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATG
ACAGGTTGTATGTATGGGAAATTTAAATGCTGGGCTCATACACAACCTCT
TCTTCCTCGTTACGAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGG
TAAAGGACATTTGTAGAAaacCGCTCGATGGGGACTGGTCACAATGGGGC
CCTTGGGATGTTTGTCGCAGACcatgtttccatggtgatcAATTTAGGAG
AAGGACATGTACTAATCCAGCACCTCAGAAGGGTGGACGTGGTTGCCCAG
AGTCTAGTGGTCATCATCGGATGTGCAATCCAAACAGTTGTAAAGATTTA
GATTTACATTCATCATGCAAAAGAGAACAAGGGGAGTGTCTTGATGAAAG
CGGCCGTGGACGCATTCAGACAATGGGTAAGAAGCTAAATCATGGAAAAG
AGAAAGATTGTCTCGAAAAATGTATGGACCAGCTCTACTACGGTTCAGGT
TGTACTTTCATCAAAAGTACTGGTTATTGCTATACTCATACAAAAAGAGT
GGCAGGAGGAAATGGAGATGATGGAGCTTTTTGTTgggtatttaaaaaat
gtaaaaTTAATGGCAAATGGTCAAAATGGGGCGCATGGGGAGAGTGCAGT
GTATCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAACATGCAACAA
TCCCATACCTAATGCGGGTGGATTGGATTGTCCAAAATCTGATAATGACA
GTCAAACTCGGAATTGCAAAACACGCNACAATCCCATACCTAATGCTGGT
GGATTGGATTGTCCAAAATCTGACAATGACAGTCAAACTCGGAATTGCAA
AACACGCATTTGTCCAACTCATGGCAAATGGTCGGCATGGGGCTCATGGG
GAAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAAACTAGAACAAGAACA
TGTACCAACCCTGCACCTCGGCATGGTGGAATGGATTGTGGAGACTCTAT
ACCTCATATTTTGAATTGCAATTTAAAGTCCTGTCCTCCAACTCATGGCA
AATGGTCGGAATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGCT
GGTCAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGG
CGGAAGGGATTGTACAGACAttaaaaatgatattgaaaatcAGAAATGCA
ATACGAACACATGTCCAAACAATAACGAAGTTGCTGAAAAAGTTTGTAAG
ATGCAATGTGTCCATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGG
AGAAGCCCAATTAGATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAA
CGAGTCataCGACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaa
aagcgATGTTTTCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGG
AGATACCAAATTAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCA
CGACTCatgGGACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaa
aagcGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGC
GGGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTC
acAAAGATAACGACAAAGTTGCtgaaaaagtttgtaaaaagCGATGTGTT
CATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAATACCAAATT
TGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCGACTCTTTGTGAAC
CTAAAAAAGAAGCAATGGTTATGTGTCATGGACGGTCCTATACATTACAT
GGGAAAGCAAAGAATGGTGCCAGCGCTAAACAATATGAATGGTACAAAAA
GAGCAAAAAGGATTCGCTATTACGATTGGATAGCGATTCTCAATACTCAA
TTACATACTCCGACCGTGATCCAACAAAAAGCAGTTTGACTATTCTTTCT
TTCAGTATGGTTAAACACGAAGGACTTTACGCTTTCAGAGAAGCTAATCT
AAAATACATCGATTGCTATGATTATAAAGTGAAAGGAGTTCTTCAAGTTG
AATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGAGAATATA
ACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCTGGTCTGT
TGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCACATTATA
ACTTGCCATCTACTGATGATTTTGGCCCTACTACACAAATGTTGGAGATT
CTTAATCCTCAACGGAGACATGGTGGAATGTACAAGCTTAAATGGTCAAC
TGATTTTGATCAATGCCCGATTGCCGATATTTTATTCAACGTTACTGTGA
GAGAACGGAATATAACAGCATCCACTATGGACAATACGAACAACGGTGTA
AATACAACAACCTCACCTAACCAGGAACTCAATGCTGGTCAACGAATTGG
TACAGAGGAAGAGAGTGATGATTCTGTAGGCTATATTCCATTGATTTTCG
GTTCATTCTTACTTGGTATAGCGAAAGGATCTATTGTACTTTGGTTTCTT
TATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCATCTAATTCATT
GCTGCTAAAAGCAAATGATGATAAACCCGACTCAGGGCGAATTGATCAGA
ATAGCTTAGATGGTGACACTATTCCTGAACCGCAGTACAACGCTCAGCCT
GTGGAACAGAATAGCTTCGATGGAGACACTAGTCCTGTATGGCAGAACAA
CGCTCAGCCTGTGGAACAGAATAGCTTCGATTGTGACACTATTCCTGAAC
CACAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACAGT
AGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTTGA
TGGAGACACTAGTCCTGTATGGCAGAACAACGCTTACCCTGAGGCACAGA
ATAGCTTAGATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAACAACAAT
CAACCTGAAGCACAGAATAGCTTAGATGCTGAAAATCACCCTTTTGGTCC
TGTAATACAATTTAAGAAACAACCTATAACAACAGAGAGTATGTTAGATG
AGAACACTGATGAGACCAATGACCCTTTTGGTCCTGTTCTGCAAAATACG
AAACAACCTATAACAACACGGAATAGCTTAGATCAGGATAATGAAAAAAC
ACTCGAGACTATCTCCATCTTCAACAAATTGGCTTCTACTTCTTCCCGTA
AATTTAAAAGGATGTAAAGCATATTTGGACGTGCTcagttgttttatttt
tttcaattttatataGTACTTTTAATGACTTGAAAGATTATTTggataat
aaaaat
Run BLAST on NCBI

protein sequence of TCONS_00001402-protein

>TCONS_00001402-protein ID=TCONS_00001402-protein|Name=TCONS_00001402-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1221bp
MAMRFTILYNVLFILLHLAGATDGSWTQWGSWSACTPQCYQTRKRTCTAR
ICKNYDTDTQFCNAAGRSCSKWKADGSAPFTLSKCKHEEGRCLTGLRRRI
QNKGVIYINDLTDSGVMESFSDCFELCQRIPGMTGCMYGKFKCWAHTQPL
LPRYEESFKDPSHICWVKDICRKPLDGDWSQWGPWDVCRRPCFHGDQFRR
RTCTNPAPQKGGRGCPESSGHHRMCNPNSCKDLDLHSSCKREQGECLDES
GRGRIQTMGKKLNHGKEKDCLEKCMDQLYYGSGCTFIKSTGYCYTHTKRV
AGGNGDDGAFCWVFKKCKINGKWSKWGAWGECSVSCGPGGKQTRRRTCNN
PIPNAGGLDCPKSDNDSQTRNCKTRXNPIPNAGGLDCPKSDNDSQTRNCK
TRICPTHGKWSAWGSWGKCSASCGGGKKTRTRTCTNPAPRHGGMDCGDSI
PHILNCNLKSCPPTHGKWSEWGSWGKCSASCGAGQKTRTRTCTNPAPQNG
GRDCTDIKNDIENQKCNTNTCPNNNEVAEKVCKMQCVHLKGKCGQMLKCG
EAQLDVSNLCPKTCAATSHTTKDNNEVAENFCKKRCFHLIENCGQMVRCG
DTKLDVSNLCPKTCATTTHGTKDNNELAEKICKKRCDQLERNCGEIKRCA
GYTMLDVSNVCPETCAHKDNDKVAEKVCKKRCVHFKGNCGQMVKCGNTKF
DVSNHCPKTCAATLCEPKKEAMVMCHGRSYTLHGKAKNGASAKQYEWYKK
SKKDSLLRLDSDSQYSITYSDRDPTKSSLTILSFSMVKHEGLYAFREANL
KYIDCYDYKVKGVLQVEYIDGKDMFDVVAGENITLAVKAKDPASKTSWSV
DGQSLIEPLIKASPHYNLPSTDDFGPTTQMLEILNPQRRHGGMYKLKWST
DFDQCPIADILFNVTVRERNITASTMDNTNNGVNTTTSPNQELNAGQRIG
TEEESDDSVGYIPLIFGSFLLGIAKGSIVLWFLYKRGLARKNQRSSSNSL
LLKANDDKPDSGRIDQNSLDGDTIPEPQYNAQPVEQNSFDGDTSPVWQNN
AQPVEQNSFDCDTIPEPQYNAQPVEQNSFDGDSSPVWQNNAQPVEQNSFD
GDTSPVWQNNAYPEAQNSLDGENSFAPQSQNNNQPEAQNSLDAENHPFGP
VIQFKKQPITTESMLDENTDETNDPFGPVLQNTKQPITTRNSLDQDNEKT
LETISIFNKLASTSSRKFKRM
Run BLAST on NCBI

transcript from alignment at sc0000010:1069472..1103646+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001402 ID=TCONS_00001402|Name=TCONS_00001402|organism=Clytia hemisphaerica|type=transcript|length=34175bp|location=Sequence derived from alignment at sc0000010:1069472..1103646+ (Clytia hemisphaerica)
ttatttctaatttcAGTTGAGCAATAATCTAAGAATGTTTGTCTGTATGT CCGTAAACTTTGAGGCAACCTAGAAAGACAGAATAATTCTACGGAGCTAA AATTTGGCATGCATTCTATTAAGGTGAAAGcccttttattttttgaattt ccattCTTTTCGTGAGCTATGTGTCCATCTTTCGAGCAATAACACCATCT AAactaaaataattgacgtcaaatagcTTTTTTAGCGACGTGAATTAGTT TCTCTCGGGAACGAGCGCAAGTTTACAGTTGAGCCTTCAAATACAAAGTA ACCAACACCCTGAATTTGAAATAAAGTCCTCTTTAAATCTAACGCCCAGG TTTTACAAAACTGAGATTTCTCTAATCTTAAAAACACATCATCCCAGCTT TACAATTGTGTTTTCCAAATGGCAAGCAACTACTATCACCCTGTTTTGGT ACACAAATTAACCTTTTCaagattaaaaacatttttatcttGGCTTGGCG TTGTGTCTTCCCTCTTTTTCCCAAATAAACCAATTAAATTCCATCTAGCT ACTGAAGCTGAACCCAGTACACGCTCCTTTTTAAGATAGtggcatggcgt tctaaatctggatttagaacgccatggatAATAGAGTAAATGcttgcgaa aaaaaaatttgacgtcagaTAATATTCTTCTTCATAACACTGttgtaaaa tttttcttattttttagtttttttctctcaaaaataaACAGAGGTATGGC GATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTCATCTTG CaggtaaagaaaatttcatctGATGTTGAATTTTAAAGTCTAATTTATGC TGGAATTATAAAGAGTATTTTTTGCGAGGGTTTCCCCTTGACGGGAACTG ATCTTTcttttgaattatagaaaaataaGTTTGAGGGGTTACTTCAATCA ATAATTGTCTTCATTCCTTAACTTATTTTGATATCAAATGCACGTCTACA AACctagtctgtacacagacccgatatctacggctaatttcagaattcat tgccgtagagggtctgttctgatttgaaatttttcaaaccgaccactGCA ATGAAGTGCGGGTGAGCGAGGGAAAGAaagagagaagtgttgctatttat ataATGTACTTCAttgcagaggtctccgtacgggaattttttatcaaaca gacaatgcgcaggAGTGTACTACGaggcgataaacgtgagatacactcgg GTACAGAGTACTACAAACCGAACTAAGAAGAAACTTTTTCACTTGATGTC TTTTATTCTAGCGGAGAAAAAAGGCGGCATATGTTGCGGCGCTCCTAGGT ccaatttctttttattgaacGTTTTTAtttcattcgaaattcattttacg agaaagaaaaagagtctgctaaatcacgCCCCTTACGCGCTCTCATTTTT TAGTGGCCATTGCGTAAAACATGTAGCTCATCCATGGAGTACTCCATTAG TGTAATTTGATTACCGACCAACAATGCAACAGAAAATTTATAAATGCAGC TCTTCAAAGTGTAGCTCAGGCTTTATGTGCCATTGCTCTAAAACCACTTT CTTTGTAATTGCCACCACAGGGAGCCTAAAGtgaccgaggatggcattca tagcttcacgcctAAGGATAATTCACAAATAGCTCACAATTTTGCGAAAT TGTTTGTCACTTTCTTATACCGGTTAAATGATTAACCGTTTAAATGGTTA ACCGGTTAAATGGTAGCCCGGTAttaagtttgtctttttcttatccctag aGAATTAATGAATCTAGGAAATTCTTGtcatattaattaaaatggaaatc tgtactaatttgttcttagattttggccaaatttcagcattgtattttta taaaattgttcttataaaaaagcgtgtaaacgCACGAATGTAACTATAAG TAGACGCTAAAACAAAACGggctttattttgaaaactataactgtaaatc actcccttgacacatttgttagcatttgaagactgaattttgtctcagat cagATGAGAAgtcaaaaattactgtagggctaataNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNaaggaatccccttttctggcatttcaaatcaaac aaaggaaccaaaacaaagagaaaaaatgacatttttgattttttaaagta tttgtacgttttttattcagttctttctatagaaatttgcaagatttgcc atagcctagccctacggcaaaaagtttcagtctaaatgactgcagttttt gagaaattccatgcttttcattgtttgatctgtcaaagatgaacttgagg gaatccccttttcagtaatgactctaaaaagacgattccttaaatgccat gacagaaaatacaatggaaaagctattaaaNACTAGATGGGTTCGTATTA TGCGCCATCCCATCGCTTTTTCATAAagtaaagcaaaaatgaaaaaaact tcacgAAAAATGAAAGCGCGTGAATATATATGAAGGCGCGTGAATATATT AAAACGCGGAGGCGCGTAGGGCGAGTGATTTATAGCAGACTCAAAGAAAA ACTATGAACTtaacaataaataaaaacataaaaagaagAGTCAAATAATA CTTTCACTGTAATTTTCTTTCACAACGGANTCAAAGTAGCGAAACCAATT GTGCAATTagctcgttatcatgtgattacatatacaaattGCAATACGAT TATACTATAAGTTTTACTGGATTTTTGCTTTCATTACCTATTACAATTTC TAAAATTCACTTATCTGGAATGTTAGATTTTCTTTTCCTGTTTCCTGGCT CAAGTTGATGTGTAAGCTTGACTAACAGGTTATATGTTACTTTCACTATT TTCAGGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGTGCTT GTACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACGAATA TGTAAAAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTCGCAG CTGCTCAAAATGGAAAGCAGGTAGGAAAAAATACTTAATCTCATACCTAT TTCAATACCTATCCCAACCGTATTTTCTggcaacttttttttctttatct ttttgaaAACGCAAAAGACTCTGGAGAATACTTGCTTGATGTGAAGTTTA TCATCAGCTATAGGTTAATGTATAAAAGTTTTTTCCGAGCCGTCGTAAAG AGTTCTGTATTGCAATTTTATCACAAAACGAAAAACATTTCATCCATTGA TTACATTTTAGACGGTTCTGCCCCTTTTACATTATCAAAATGTAAACATG AAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTATACAGAACAAAGGT GTTATCTACATAAACGATTTAACAGATTCTGGAGTTATGGAATCATTCTC CGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATGACAGGTTGTATGT ATGGGAAATTTAAATGCTGGGCTCATACACAACCTCTTCTTCCTCGTTAC GAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGGTAAAGGACATTTG TAGAAGTAAGctgtattttctttttattgaccTTGTTTAGCTTAACGTGT TGTGTTGTCATTGACGGCCCTTATTTCGCTGTCAGTAATGTACATGATTT TAAAACTTGCTCAAAAATCGATAATCATTTACAGGTTGTCTGAAAAAAAG AGTATCGAGCTTGGATATATCATTGTGTCATTGCGTAGAGAAGAGTTACA AGTCTgtctcaatagaccttttcataaattgtgtcacgaacatcacttgc ctcgttttgaaattattgccatggtgattaaaggcttggggacacctCAA CAATTACCATGGCTATTATGCcccttgaaaaaaatgatttttttattcga ATAGAaagtaattttaataaaatctgctgggacCTGGgagttaaggcttg gggacacgagaagtttatttcgcgttggtgcaatgcaacatgctctatcc catcaatctgaaacgctttcttgtgacgttatttatgaaaaggcctatat aatctgcagcggagacaGAAAAGGCTTTAACTTTAGATTGAAAAGTTACT GGCCACAAATTCACAAATTCATCCATCGATGCTCTTTTATTCAAAAAACC ACCCTTTGCAACAAACCATGagcatataaacgactggacatccatctcct ttttatttttgtagaaagcactactagcttcgttgccgccaaGTTAAAAA TATaagatgaaacaataaattttgatgatattgtTGCCGCATTGAGTGCA AGTAGGCCTCCACTCTACGCGGGAGTATATGGTTCTCCTCCGTAACGTAT TTCTCAATGTTTCGTGCGCGTCTATTGTCTTGTTTTATGTATTATATTTA TCTTGTCTTGTCCCTTGTGAATTTgtattgtgacgtcacttaTCTACTTA TATTTTGCAGGtgttttaaaatgttattttttgaatgttgttTTATACTG AACTGTTGTGTGTTGTGAAAGAACTTTagtattttctatgtttgtgATAT GTACAATGCTCAGGTTCTTGGGCTTTCGTCTTCTGTGTGTCTTCCGTGCT TCGTTTTCAGTGTGATTCGTTTCGGTTTTGTTTGGGGGTTTGCGTCTTTT CTGTCTGCCAGCTTTTATCGTATCTTTTGGGTCTAACTTATgatattttc agtttcttgtAACTACCGTaatttggtctaatgtcgacattccTCATCGA ATCCCGACACCCTTTTATCAGCTGACATTGATAGAAAggtcaaaactatt tttctttgcttagtggtcagagaggaataatccttcttcaatcagtgatt caagctttcatattattcctgtctctaaagaagggtgtcggaattagacg aaggatgtcgatattagaccaacctACGGTAGTTTATTGGCAAGTTTTCG AACTTCTAATTTTGTGCATTTGTTTTAGCGTCCCTGAATAGCAGTAAAAT ACTAAAAGTTAAAGTAGCTTGTCATCTAGTACTCACCTTTTTGTTATGTC ATACATTCAGTCAGCAAGAGGCAGCAGCAAAAGGGAAATTAAAATTCCAG CCAGATCTCTTTGGAATACCTtactaacaacgtcaaaacttgaaCAAAAG TTTATATTGttctaccgtcaactgctctaacttactgacaaaacatggga cggcaattcggtaaccatttcaccgaacctccaaagtcatttgatttgag ttaatgaacggcgtattaaaaatacacgatttctttttcgcactgagtag gcttttaaatcgaaatatgaaaacatCCCTTCGAAATTCATCAAGCCAGT GTCGCAATATCTCACATCACCTCTAACCGATATCATCAATAACTAAATCC AATCATCGACCTTCCCAGAAGAATGGAAAATTAGTCGAATTTGCCCAGTG TCCAAAGTCACCGACCCCAATTCTTGATAGACTTTAGACCAATCAGCATA TTGCCAATCTtgtcaaaattctttgaaagaattaTCCTCCAACAATTAAC CGAGCACATCGAAGAAAAATCGATTTACCTCGAGAGTCAATCTGGTTTCA GAAAACCGTATTCAACTATAATCGTTCCTACtactaattcaaattctatc aaaaattattgaggtttgaaaaagcagtaccagctaatttgaaatagact tcaGGCGGAAATTTTGTCCGCTCGGGCGAAAAATAGTCAGAGGGGCGCAA TGTCACAGACTCTATTTTCCGCCGCGCAatatattacgttttataatata caactatgttatatcataatatcataataatatattatacagacgatagc atcgtctaacggcaacgaagctcgcttaaaataccgtgaaaagcacagtc cgaaatcatatatcgacctgtaccgaccaatccagatttagcgtgcaatc aacgcagagaaaagtaaccataacgacaatccaagatcttggatgaagtt caaagttcatatttttattcccgtcgtttaaaacacaactcaaaaatgtc attaatgCTCTTTAAAAagagtgatagagaatcataacataaagtctgtc tattaattcgattcaattaaagtaacatttccataattaatagtttaatA TTTACTGATTATACATTTGGGgttcatgtaaaagatttcttacgaaagaa actcatttcaattacacttggaggtttctggggaattcttaaatagtaaa ctgcatactgatagtctgctagacattaatatggcaatatttgctcttca tctttgattctttcttcagtgattagattgacacatgcgcgataaaattt ctattattgatatacacgtttttttttttataagaacaaactatataaga acataaggcttcgaggcccaaaaatttaagaacattctaagaacattcta aggctttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtaagaaca ttttaagaacatttttaggcttcaaatccaaaaaactaagaacatccgaa ggcttcgaaaatttttgacgttcttataaaaaaaaaacgtgtattctttg aaaactcaacctctgatattCAAGGTACGATTCAAAGACACAATGGAAGA TAGACTTCCAGGCGtttttatatgttcatgttacACCATACGTAGTTTTA GCTAGATTCAATTGCGTGAGatattaaagggacattaaagtagtaaaatg taaacattgcgcgaaccacgtgttatcaaagagaacaattaaaatcacgt gtccaaaacaaacttgtaaaacaattgaacaatcaaaattagccatattt ggtttgattttttattttgacatgtgacatttgttttgattttgtatccg ctgcatacagtttgtttacaaatttcgcaagtactgttatgtccctttaa gcaaGAATATTTAGCAAAGTTTGATAAGATAAGTTTTGCAAAGACTACCC TATAGTAATGAtatccaatttttttcttttcataccaAAATGATCGATTT GTGCATGTAATTAGCTGTCAGGTTAAAATccgtattttgtttttttagaa cCGCTCGATGGGGACTGGTCACAATGGGGCCCTTGGGATGTTTGTCGCAG ACcatgtttccatggtgatcAATTTAGGAGAAGGACATGTACTAATCCAG CACCTCAGAAGGGTGGACGTGGTTGCCCAGAGTCTAGTGGTCATCATCGG ATGTGCAATCCAAACAGTTGTAAAGGTATAAATAATCACTTTATCTTtaa tctcataaccgatcaccattgctacggcatatgatgatctgaaaagtttA TGCAGCGGAATTTTACAAAACCGCGTTCGAGGTCTGGGGAaaaaactaca cgtttttttcattagaacacctaaaatttggctgaggctggatgtgctta ttcttttagcaattttcaggctgaaatgttcttaaatgcgttcttatttt tcagactcctttaaatcgacaatatcatgcaaaataaagagcacttaaaa ttggtaaaatccggacaatatttgactcttgattttagaaaatccatccc taattcagttaaaactgcttgaaaagaggaaaaaattgtagtttttttgt tattttttccaaactgaggctgggcatgttcttacaatgttcttatacac taggttctaataaaaaaaaaacgtgagTGACACGTGACCAGATACCGGTA TCCGATTGGCCCGCAGTTTTCAAGATTTATCTATCATTTtataggaaaat tttttttgtaagaactagtAGCAAAAACCCCTGTATCTTTTGAAATAGTg aatattttccaagaatttgTTCAGATGGTAACAGGCAATTGTACATGGAA CAATCTGAATCTTCACCTGCCAAAAATACTAACCTTTTTGCTGCCGAAAT TTCCTTTGAGCACCTGAAAATATCATGTAAACAGTATCATTTAAATCTTT TTCTCATTTAgaccttttcaagccaaaaataCATTCCAGAACTTAGAGTT GgtatttgtttattttccaaATCTATTAAATTTCACACACGTTAAGTTAT AATTATTCTGAAAAAATGCTTGATTCCAGTCAATCATTAAGGAGATAGTA GGAATGAAGTACACATTACATAAAAGAACACACCTGTAACAATTTGCTTG GTGTTTGAGCCTTCATCttgaacaaaaatgagaaaacatccAAGCTAAAT CTGTGTGAAAAAATGCAACTTTTAAAACAGTCTTTCAAAGCTTTTAAGTC AATAAGTATGAACAGCCACTTCTGTTGGTGTAAGTTAAGTTAAGTGTAGC TCCGCATTTATTGAactttcctttaaaagtctcaaaatccataaacaaat caaaacattgagtaACAGTTAAAACGTGAATTTTAggcgccatcttgaat tttgttcGGAGCAAGAAAGCCACTGTCGCAGTAGAATCGATTTTCTTTAG CCCACGCATCCTATGACGGCCCAAGCAAATCGATTTAATTTTATGCGAAT GCCCGCGATTAAATCGCGAAAAGTcctctgaaatttcagagtgtcGGCCA TCAAAGAAAACCCGAGAACCTTCGCAGGTCTTCTTGCAAAACCATTGTGG AGCACGAAGAGCTGCTTGGAGGTTCCTTCATCTTAAGATGGAATATCTTA ACACAGACCCGTAAAAGCAAATAAACTCGCAAATTGATAGAAATTGCATT ACCCTCTGATAAGCGCCCCCGCTAAttaatctttcgaaaattttccaccc tgGACATTtctattccaatccccccgtaTTAGGTACCCAAGGGTATGAAT TATACGAAAAAATGACATCACTCGCACGTCGCAGACTacatttaaaatag ttctagccAACGTCGAAACCAAGCcactttgaatttcaaaatacgaaaat taaaGCTAATCTATACTGATAAATAAACAATCATCGTGCGCTGCTTTGTT TCGATGATTCATTTAAatatggaggtaataaaaatatagatggagatacc actcctactattctattAGTTCGAGAGCTGTCGGCCTTTTTATTAGGTCA TAAGCCTCAGAATTTTAACCATCCTCAACGTGTTTGCCGTatcgaaaact gtcaaaaaagaTTGTCAGATCGAACACTAGCGGTCTCTTTGAtctccacg agcccaaaaaGGAGGTCAAAAAAGGGCTTAAATTTAGGTCACGAGCCTCA TGGCTGAAATTTTACAGGTGATTAGTACAACCCTTAAggacaatgaaaat cgaaaatctaaccaaaaaatcCAGTTTCTTGACCTGGTCAGATGCCCAAA AAAGAAGTCAAAAAAGGGCCTAAATTTAGGTCATGAGCCTCATGGCTGAA ATTTTACAGGTGATAAGTACAACCCTTAAGGACAATGAAAANATCATTGT GTCGTAATGTTatcatcagttgctcaaaatagccaaaatctttagttttt cttactttttactcattttaattcaatttttctatATATCAGATGCTCCC CTTNagaaaatcgaaaatctaaccaaaaaatTCGGTTCCTTGACCAGGTC AGATGCCcctgaagttgaaaaatttgagaattttcggGGGGTCGAAAATG ACCCCCCTCTTAGACGAAACTTTCTATAGCGTTTGATCTACTCAATATNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCATTCtccag tgtgtccataacatccaattacactttggggaaaatttatgtcatttttt atgacgtcattgtgttaatatgacgtcatcagttgctCGTCAGTCGCTCA TCAGTTGCTCGTCAGTCGCTCATCAGTTGCTCCTTATGGCCAAAAGGGGa ctcatttttaagtttttcttacttttacctATTTTATTTGGTAgataccc ctttttcattctcctGTTATCTCTTTGGGCTGTTTGAAAGACGAAGTGGT ACTCTGGGTTTCCTCTTATACGCCAGACAAGTTTTGAATCAGTGATCCAG TATTTTGTTTTCTCTTAcctgtttcttttctttgataTTGAAATCTTTCC TTATGCAGAACCTCTActtaagtgaagaaatttttgcagaatttaatttc gtggttttttgacaaatccacGTTATTAAATTCCGCCGAACACTAATATC CTCAAGATTTAAAAATCACCTCTAAATTTGGTCTTTTAACGAGAAAATAG Gccatattgtaaacaaaaattatcttaaccgtgaaattaaattacgcgaa aattccgaattttgagctgtgaaccgcgaaattaaattctgtgaaaattc cTTTCCATGAAAATTTCTCCACTTAAGGTAAATAATGGGAGCATTTTGAA AATGAGACTAGGATTGGTGTAATACATCTCTGGGTTACAGCATTTTTCAA GTCATCGTGGAGTAACTAATGGAGTGACTCTGAATTTACGGATCCAACAA CATTTTACCCAATGCCTAACTATAGTATATAGCTTTTTAATTATAGACGT ACGCCAATCTATGAGTTGATATCATTGCGCTGATTATGGCGTAAATGACT CCcaaatttgtgaaaatcgcaAATAAGGctaaaagaaaatcatcaaaTCG AGGATTTATAGTAAAATTACATTGAAACTGCTGTTTTAGTTAAGTTATAT GGATTTGGAGAGACAAATTGGACAAATTTGGCCAGAGGAACTAATTATTA AGACACTTAAAAATTGACGATCAAACAAAGTTTTACCAGTTATTTGACTT TTGAATATAACCTCATTCGAAAGTCAATGTAAAAATTCgtctccaaaacc atccccaacGGATTTAGCtgagaataataaaatttctatccttGTCGGGC TTTTGATAGAGAACTTTTTATTCcccctttttgaaaatgttccaCCGGGA CTGTTAGACAGGGTTGTTAAACTCCCACAATACACCTTTCTTTTATATCT TAATAATGTAACTAGAAGAACTTGCCGTGGGTGTATGAATTTTACACTGT GATGACAGATCACCATTATATCGCCTTAAGATCTACGCTGTAGTTTGTCG GGATCAACCCAGCGTTTGTCTGAAATCCACGCGGGTCACGCAGGTCACAC ACTTTAGATTTGAAATTTGTGgctttatttttcaacctaagaGATTTCTT ACTCTCCCTTCGGGCCTCCAATTGAAGTAAATTAAAGTAATCTTAATTTA GAGCACTTATTAACGACAGACGTTGGTACAATCGTGAGCGCTATTGGAAT CACAAAAAGGCGAGCTAAGGGAATGGCTTCGAGTCTgatatttcaatttt cgaagtctaatttttaaaacatcataATAAATTGTTTCATTGTACGACTA AGATTTACAGATACCTTAATGATAAGAAGCTCTCACGATCATAGGTCTTA ACCCGTGAAATTCTGAAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNattttgagcaactgatgatGACATTACGacataatgacgtcatc aaataatgacataaatttccaACAAAGTttaattggatgttatggacaca cttgAAAACGAAAAAGTGGTATCTGTTATGAAAATATGAGTAAAAAGTAA GGTGAACTTAAAAAGACTccccttttggccattttgagcaactgatgagc agtcgatgacgtcattacgacacaatgacgtcatcgaaaatgaCATTAAT TTTCCCcaaagtgtaattggatgttatggacacactggaGAATGAAAAAG GGAGCATCagatatattaaaaaaattgaattaaaatgagtaaaaagtaag aaaaatttcaaattttggccattttgagtaactgatgacgtcattatgac acaatgacgtcatcaaataatgacataaatttcccacaaagtgtaattgg atgttatggacacactgtCCAAATTTCATCGCTAAATATTGAGTAGATCA AACGCTATAGAAAGTTTCGTCTAAGAGGGGGTCATTTTCGACCCCccgaa aattctcaaatttatCAACTTCAGGGGCATCTGACCAGGTCAAGGAACCA gattttttggttagattttcgattttcactgTCCCTAGCGGTTGTACTTA TCACCTGTAAAATTTCAGCCATGAGGCTCATGACCTAAATTTAGGCCAtt ttttgacctcttttttgggcatctgaccaggtcaagaaaccggatttttt ggttagattttcgattttcattgtccTTAAGGGTTGTACTAATCACCTGT AAAATTTTAGCCGTGAGGCTCATGACCTAAATACAAGCccttttttgacc tcttttttgggctcgtggagaTCAAAGAGACCGCTAGTGTTCGATCTGAC AAAATTTATTTGACAGTTTTCGATACGGCGAACACGTTGAGGATGGTTAA AATTCTGAGGCTTATGACCTAATAAAAAGGCCGACAGCTCTCGAACTATA TTGTATTGTTGTATTATTGACTATCAATgattggtaatcaaaggaggccg atttgaaagaaatttctaaagagttttatgaaTTATTTggctattacaga aaagttgttactccatctaacttttattacctctatgatttgaacaaatg ccagttggtctaaacgcagccatatTTTTCATAAGCGATTCCGACCTCCT CTTGAATACCACTATGGAATTATCATAGACACTGAAAAAACAActatttt tgccgatttctcatGTTCAAGTCTTGTCAGAACAGAAGTAATTCTAGCTT TTACTATTATCAAACATTTGCCCagtaaaagaacaaaaagaaaaagatag aGAACAGCTTCCATGaaagttgtcctttgcggacaaagccgattattttt tgaaacaatagaaatacaaTACTTCACTCTTCACCGTTTTATGcaatgtt tatccagagtctctataataaatccatgtaCACCGTTAACTTAGCTTTAA CACAAGATATCTGCATAAACTTTTCAGCATTCAAACCATGCTGTtgtgcg cagaaatgtaatacttgcgcagaaatgtaatacctgcgcagaaatgtaat acttcctgcgcagaaatgtaatacctgcacaaaaatgtaatacttcctgc gcaaatttgtaatactcgagctgcgcagaaatgtaatacttgtctgcgca gaaatgtaatttgGAATTCGTTATCCTTTCAAATATCATATTCTATTCTT CGAAGAAATTAACTTCAacaaaaagacttagaaaattttcgaaaaaaatt tgaatttctttataagaattaaatctataactctcgttttagggcaaatt tacTGTCGGTATatatggttcttacaaagtaaacaagtaacgatgcaaaa gatgggcaaatttgtttttcttataagaattttttttataggaaacgAAT CTATAACTATCGTTTTAGGGTGAATTGGCTGTCGGTttatggttcttaca aagtaaacaagtaacgatgcaaaagatgggcaaattcgtttttcttataa gaattttttttataggaaacaaaTCTATAACTCTCCTTTTAGGGCAAATT TACTGTCGGTATATGGTTCTTACGAAGTAAACAAGTAACGATGCAAAAAA tgggcaaatttatttttctcataagaattttttttataagaaacaaatct atATCTCTCGTTTAAGGGCAAATTTACTGTCGGTatatggttcttacaaa gtaaacaagtaacgatgcaaaaaatgggcaaatttatttttcttataaga atttttttataagaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTACATTTTTGCG Caggtattacatttctgcgcaggaagtattacatttctgcgcaggtatta catttctgcgcaagtattacatttctgcgcacaACACATGCAATATAATG AACCGTCTCTTTTTATAGATTTAGATTTACATTCATCATGCAAAAGAGAA CAAGGGGAGTGTCTTGATGAAAGCGGCCGTGGACGCATTCAGACAATGGG TAAGAAGCTAAATCATGGAAAAGAGAAAGATTGTCTCGAAAAATGTATGG ACCAGCTCTACTACGGTTCAGGTTGTACTTTCATCAAAAGTACTGGTTAT TGCTATACTCATACAAAAAGAGTGGCAGGAGGAAATGGAGATGATGGAGC TTTTTGTTgggtatttaaaaaatgtaaaagtaaGACGTCTTATATTTTTG TCTTTGTTCGTTGACTCCAGATTTCTAACAGTGTTTTGTGTCACATACAT CATAATTATTTGTAAGACTTTCATACAATTGCAAGCATTTagggtgtttt tccactgacGGCTTAAGCTAAATGGATTACTGTAatgtaactttttataa aacgatGAATAGCCCaaacttttcaaataatttttggatgaaaagagatg gttgcacattaactttttctattcagaaaaatattgtattttCTATAGCA ACACAGGAGAAAAATAGTATTTTGCACGCATTTTCTAATTAAAAGATTCA ACGatttttctaccatttttaaaaaaagtggtaccctaatagTAGCACTA CTCagtagcggtgtaaatgcatccaGAGCGCTAAAAACacttttcctcga atacttttgatgatgtagcgtgACNATAGcagtgtaaatgcatcgagagc gctaaaaacacttttcctggaatacttttgatgatgtagcgacgttagac gttaatttttaacaccgCAAAGACTTTTGTGCTGTTACCACTTGCTGGTA TCACTtccaaaaaaaaactccgattaaAGCAGACAGCAGATATAGCTTTG CCCAGGTTATTATAAAGGTCAGCGAATTCAATCTAGCGGAAACTGTTTAA cagattattattatttaatttatccCTCAGTTAATGGCAAATGGTCAAAA TGGGGCGCATGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGCA AACTAGAAGAAGAACATGCAACAATCCCATACCTAATGCGGGTGGATTGG ATTGTCCAAAATCTGATAATGACAGTCAAACTCGGAATTGCAAAACACGC NACAATCCCATACCTAATGCTGGTGGATTGGATTGTCCAAAATCTGACAA TGACAGTCAAACTCGGAATTGCAAAACACGCATTTGTCCAAGTAAGAAAT GTTTGTCCTATATAAATAAATGTCTCAACCAACAGCAAATTGATATTTAT TGAAAAGTGTTCTATTCGTATTCTAGACTGGCACACCAGTCGGCCTTGAA CGATATCACGCGAGAGAAAGTGAGCGTAAGAGGAAGATTTTTTGCCGAGA GGGACTGAAAGGACACCTCCTATTTCAACAAAAATCCTTTACCCTTTGAT TCCCACCCTCATAATcattgatgatgtcatcattatttaaaaatgctgaa aataggGCCCCCATCCTTCCTTATTTTCAATCTTGAATTCTTCTTTTGAA TTCAGGTCAATTTTTTTGCCACTGcatcgtgtattttacagatcaACCCA AATTTGCCTTGTCTGCCTATTGCCTAAAGTAGTTCTAGATTACTGTAGCT ATctgcaatcatggtcgtaatatttgagaaaaaagggaaaaccactggga agttttgaaaccacaatcgatttgtaagtgctctaaagtaggttggaagg gtagctTTAACTCCGAGCTTTAACAATttgagagatggcccaaaatcaac tttctcgcccaaactccaaatttcgaataAATTTCGACCATGATTATGGA TTGGAAAATATtatggcttgaaattttgataagTGCGATGTATTGACGAA AATCGGACCCGTgtttaaatattaaaatcagtattttgggtaagggagcg gtcattaagtatagCATATACCGGGTGGAAGGGATTTGGGCAGggcaaga aatttttttccctCTTTTGGGTAGTGTATGAAAAAAACTTGAGGGCTTTG AGTAGGGTACGAAAATAATTTTAGCAGAATcttatttcaacaaaaatttc aattttgtcaattttaaaacTCCATTATTCTTGCGAACCCTGAAATCtga gaaattttaaagtgcCATAAAGCTGCCATCTGGTAAGGGGTagggtaaaa aaattttcatccagtTTTTGGAAGggtatgaaatttatttgagaACTTTT GGTAGGGTATGAAAATAAGAAGTCTGCCAAAAAATCCCTTCCACCCCGGT ATATGctatacttaatgaccgctcccTAAAATAGGACCAGTCTGTAACTG ACCAACCACGTTTATGGCCGTCTTCAAGTGTCAATATCTATAACTAATGA AAGTTTTAAGTCAAATTTATCAAGCTTATTGGCCGTATTCTAGTCTGACC TAACCAAAATTTTGCAGATCATCACAGTTTTCTGACATCCTACCAGTGGT CAGAATTCAAGGTCATTAGGTTTTCTCGGTCATGAGATTTCATATAGGGC TAGAGCACCCCCTTACAAAAAAGAGAGGTCTTTCAGTTCAGAACTCCACG ATCTGTGTAATTTCTCAGTTTGTATTTCTTCGATTACAATCTTCCTTAGC AGTAAATCTTTTTAGTTCAGTCAATATGGGTGACCTTAAAATTGCCTACC AAGCAGTATAATATTTTTACTTGATGAATTTTCAGCTCATGGCAAATGGT CGGCATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGTAAG AAAACTAGAACAAGAACATGTACCAACCCTGCACCTCGGCATGGTGGAAT GGATTGTGGAGACTCTATACCTCATATTTTGAATTGCAATTTAAAGTCCT GTCCTCCAAGTAAGTAATGCGACTCATTATTTGATCCCTTTTGATCCTCT CATAATTAAAAAATAGGATCATAGCTGCAGTCGAGCACAAACCTATAAGG TTTCAGAACTAATACTTGAGTAAAATACATATAGATCTGTAATGTATTAC TCATGTGCAGGATCGATCAATTTTACACACTATATTTGATGACCAATACA TATCGTCGGTGAAAACTTATGACAAACCCCAGATAGTTCCTGAGTTTTGA AATGGGTGTGTATTTAACAGacgtttttacaaaaaaatcgaTTCAAATTT ATCAAGCTTATTGGCCGTAttctcccagctggcacacaacgttggttcaa cgttcatctaacgttatatggatgttgtgaacattagattaacgttgaaa caacgttgtgtgccagctgggctggTATGACCTAACCAAAATTTTGCGGA TCACCCCTGTTTTCTCACATCATACCAGTGGTCAGAATTCAAGGTCATGG TAGGTTATTCTCGGTCTTGAGATTTCATATAGGGCTAGAGCACCCCCTTA CAAAAAAGAGAGGTCTTTTCAGTTCGGAACTCCACGATCTGTGTAATTTC TCAGTTTGTATTTCTTCGATTATAATCTTTCTTAGCAGTAAATCTTCTTA GTTCAGTCAATGGGTGACCTTAAAATTACCTACTAAGCAGTATAATATTT TTACTTGATCAATTTTCAGCTCATGGCAAATGGTCGGAATGGGGCTCATG GGGAAAGTGCAGTGCATCATGTGGTGCTGGTCAGAAAACTAGAACAAGAA CATGTACCAACCCTGCACCTCGGCATGGCGGAAGGGAGTGTGGAGACTCT AATACTCATACTTTGAATTGCAATTTAAAGTCCTGTCCAAGTAAGTAATG CGACTTATTATTTGATCCCTTTTGATCCTCTCATAATTAAAAAATAGGCT CATAGCTGCAGTCGAGCACAAACCTATAAGGTTTCAGAACTAATATATGG GTGNGATCCTCTCATAATTAAAAAATAGGATCATAGCTGCAGTCGAGCAC AAACCTATAAGGTTTCAGAACTAATACTTGAGTAAAATACATATAGATCT GTAATGTATTACTCATGTGCAGGGTCGATCAATTTTACACACTATATTTG ATGACCAATACATATCGTCGGTGAAAACTTATGACAAACCCCAGATAGCT CCTGAGTTTTGAAGTGGGTGTGTATTTAACAGacgtttttacaaaaaaaa tctaTTCAAATTTATCAAGCTTATTGGCTATATTCTGGTAtgaccatgaa catataaacgactggacatccatctcctttgtcgttttgtagaaaaggct gctagcttcgttgccgcctcgttaaaagcataaaatgaaacaaaagattt tgatgatataccacttgggaataccttgctaacaactcagaacttcgaca aaagtctctctgttgttctactcttctcaagtcgtttatctatatcataa caaagataacagaggcaaaatcatcgtcagcttgtcaaaactccgactaa tatttctaaattttgacttgaaaatgtctaataattttagagagtgtcac attctaatttcgatattcttatgaaacaggctctcaactttgacaagcta ttttttttaagtcataaaaaaaattattggggtgacaaaagggattcaaa agtatacacgcagttgaaattctgcattttagagttgaaaatgtagataa aatatattgcaaacttgtgaaaaaattcgaaaataatttttttgtgcatt aggagtaatgttcaagctctatcattccttttacctaaataattcaaaga aataaaattatgacggaatattgtcggatttttcataccaattttgaaat acaggcggcaacgaagctcgattcaaagagacaataaaagatagacgtcc agtcgtttatatgttcatggtatgACCTAACCAAAATATTGCGGATCACC CCTGTTTTCGCACATCATACCAGTGGTCAGAATTCAAGGTCATGGTATGT TATTCTCGGTCTTGAGATTTCATATAGGGCTAGAGCACCCctttataaaa aagagaagTCTTTTCAGTTCAGAACTCCACGATCTGTGTAATTTCTCAGT TTGTATTTCTTCGATTACAATTTTCTTAGTAGTAAATCTTTTCAGTTCAG TCGGTGACAACTGGGCGACTTCCTTTAACCTAGAATCATAATAACCTAGT TGTAAATATTGTTATTTGATAAAGTTGTAGTCCATGGCAAATGGTCGGAA TGGGGCTCGTGGGGAAAGTGCAGTGCATCATGTGGTAGTGGTCAGAAAAC TAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGGCGGAAGGGATT GTACAGACAttaaaaatgatattgaaaatcAGAAATGCAATACGAACACA TGTCCAAGTAAGCAACCACTACTTTTTTTTGACCCATTGAGTTTGAAATC TTAAAGAGGATTGTAAGACACTAACCAGGCAGattcatcttcatctttat tcatcATTGGTCTAAATTTCAAGTTCATCACAGTGCTCAATCTTAAGATT ATAATAGGGGtggccattttgaaaaaatcgaaGGATGCTCGGAGGATTAT GATTATTAGAAATCCAACCAAAGATAATAACGAGCTAGCTGAAAAAGTTT GTAGAATCAATGTGTTCATTTGAAACCAGACTGCTTAAATGTAGAGatac aaaattaaacaaaaatcaGAAGTGTTTATACTAATTTTAACGGAGAGAAT TTTCTTatatccaagccacgataaacttccaatcccgggggggggggggN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNcccgggggggggggtactagggttgcgagctga cgggggggagccgcccgactttcgaactttggacccttactgggactaaa aaggagaagacagaggaaaattttgggaattttacgacccttagcgggac aaatttgaccaattttgatcaaattttgatctttcagggggtaaaaagtt gaaattttcctatttttccgacccttagtgggactgaaattagattttct gttttttccgacccttagtgggactttggaagtccaaaaaaggtactctt aagggcggcacataccgtaccctccatttgcctaagtacccccccccccg ggctNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNGGAATTGTGGTCAGATGCTTAGATGTGGAGATAT CGAATTAGACGTTTCAAACCTTTGCCCTGAAACCTGTGCTGCCACGACTC GTAAGTTCTCTAAATCTGCATTAtaattacacttttttcttttataagaa catcgaggctgaaaatcaccaaaaattaagaacaatttaaggacAATGCT GAGCCTAAAATTATTTAacttcaagcaatttaggggtcaaagtagtaaaa agaGGGTATAACGCCtataattataattataattGGTTAATTTTTCCCAT TTGGTGCGCCTTCAAATAGaacaattaatcgttaattgcattctgaagag agcaattaatcgttatcACACTCTTTAATGAAGCGCTAATGTTTACAAAA TATAGAGTTTAATGTTCTTCTaatgttttaatttcatttatatTACATTC TGTGAGaaagaaaaactatgaacatcaATTAAAGAAAAACATAGAGAGAC AGcgaaaaagaaatacttttagTGTAATTTTCTTTCACAACAGAAAAAAG TAGCGAAACCCATTGTGTGATTAGcttgtaatcacatgataactcaTGCA GTTCGAAAATCACACTCGCGTTATCACGTGATTACACATACtaatacctc aattacaccctataaATGAGAATAGGATAAGATCAATTTGAGACtcaagt gccaaaaaaataggaacagccgagcctcagcaaaattttactggttgtta taaaaaaaatgtcacatatcATACTAACATATACCAGAAAGTATGCATTA CCTAATccgggaaaacttcgtcgggaaaaattttcgtcggggaaaaatat tcctcacttggccaaaatttcgtcacttNCAATACGAACACATGTCCAAG TAAGCAACCACTACTTTTTTTTGACCCATTGAGTTTGAAATCTTAAAGAG GATTGTAAGACACTAACCAGTCAGAtggatttccaaaaattttgcaattc atcttcatcttccatTATCCATATCTACCATTGGTCTAAATTTCAAGTTC ATCACAGTGCTCAATCTTGAGATTATAAGAGGGGTGGCCATTTTGCTCGG AGGATTATGATTATTAGAAATCCAACCAAAGATAATAACGAGCTAGCTGA AAAAGTTTGTAGAATCAATGTGTTCATTTGAAACCAGACTGCTGAAATGT AGAGatacaaaattaaacaaaaatcaGAAGTGTTTATACTAATGAAGACA AATTTTCACAGAGAGAATTTTCTTatatccaagccacgataaacttccaa tcccggggggggggggactagggNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNgtgtaataaagtctctctaagggta tgacttttttcaaaaatcgaaaaaaaaaaatcaaaaagtctctctaaggg tcggttttcggaggtcccgtccgcacatacccctcattctccaaccctag tacccccccggagtaacttttcaaccaaaaagtatttcttactTATAATG TCGAAGGATTATGTTTTAgctgaaaaatttttcttgattttagtTGGGAC TAAAGACAATAACGAAGTTGCTGAAAAAGTTTGTAAGATGCAATGTGTCC ATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGGAGAAGCCCAATTA GATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAACGAGTCGTAagtt ttctaaatttgaattttagctAATTTTTCGTTAACATGGAAAGTATGAGC AATCTTATTGACTTAAAACGCGTACATAACTGCCGTCGGAATACCAGACC GCGTTCAAAGAAAGGGGCCttatccagggggggggggtacttaggcaaac agagggtacggtatgtgccgcccttaagggtaccttttttggatttcaaa agtcccgctaagggtcagaaaaatcagaaaatcaaatttcggtcccgcta agggtcggaaaaataggaacatttcaactttttacccccggaaagatcAA AATTACGGGTCGTataattcacaaaattttcgtttgttttctccttttta gtcctggTAAAGGTCCAAGGGTCGTAAGTtgggcggcaccccccgtcagt tcgcaatcctagtaccccccgggggtCTTGTAAGCGAGAGCCCgtatttt gtataattttacgAATAGAAAAGTTTTCTTCTCGCTCGCAATACACAGCA ACTTAGAATCAAAAGAATGTTGTTACCTTTTTAATGACCATTCGattctt tttcgaatgtttcgatATTGATTTCATCCAAATGAaagagagaaaaacaa aacaaagaaaagagaCACAAGTAGGCCCCTCAAGTAGAAAGAAAAGTTTG TTGTAAAACAGTATCATACTTttacaatatgggatatatttttctcgtCT AAAGGCTcgaaaaatctgaactcgaaaaatggGTATATCTGATATTGTAC TCGTTACCAATTACCATGCCATAACTATTATATATCAGAtcccaataaaa aataaacccctgttttgtgacatttttactgtcagccAATAAATTTACCA TAACTAGGGAAAATTATGTTACACTTAGAATCGCTTTGATGGTTAAGCTG ATGAAATTAGCTATCCATTGCATAAAGTCCATAAGGGGCGAATTTTTGTA GCTTAGTTAAAGGGGAGTTACAAGCAAATGAAGTGTGGGAAAAATGTGGC TTACTGGTCATGTGGCTTACCCAACCAAGAAATTTTGAAGGCTGAGTTCC CAATAATGGAAACAGTCAGAAATATACTTTCTTTTCAACATTGCCAGCAA AGGGCTAAATTTTTCATTAGCTGCACTGATTTGTGGCTTAAAGTTTGTTA AGTGGGCAAAAATGTGGCTTACACAAGGAAAATATAGGTGAATAGGTGAA TAGGTGAAATATAGgtgaaattttaagtttttagcACTCAATCATTAAAG TATAGCACCAGTAAGTGTACAATTTTGTGGCTTACAAAATCACATTAAAA ACTATCGAAAAGTGAGCCACAAAAAAGTACATTTAACAGCTAGAAAGTAT GaacatttaacattttttttaagattcaaCCTTTCCTCTGTCAAGTAAAG AAAGACTCGCATTCTAAGACCTCTTATCTAATTTGTGTGGCTtacatttc taaaaaagatacaaattttGAGTTGGAGCCACTTTTTTAGCCCAATTAAC gagaaaaagttgtaaaatcTCAAGACTTACCGATTAAGACTTCATCAGCT Atgacaaaaagttgtttttgggcatttttcaaaatgtcacactattttta aTTGGGATCATCAGCCAAAAAAGTGTAATAGATATATACTAAAATTGGCA AAaaggatttcattttttattggaaagaatgtttttgaattttagataCG ACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaaaagcgATGTTT TCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGGAGATACCAAAT TAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCACGACTCGTAAG TTTTCTAAGTTTGTCTTATAACTAACATCTTAaccaaaaatcataaaagt ttgttttcatACCAATAAAGTCGAATTTTAACagcaaagatttttttgaa atctagatgGGACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaa aagcGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGC GGGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTC GTAAGTGTTCTAAATTTGTATCATATCTAACATATCAACCAAAAAATATA CCagaattaccttaagggaactttttttggcgagaaataattttggcgaa ccaggattttttttaattttggcgagaacttatctTGGCGAATCAacgat ttttttaattgtggcgagaacttattttggcgtaaatctgttctattttg cctcatttgaagcttttttgtgaactcaagaagttatttaggcaaaatac caaaaattttaattttggcgagaactaattttggcgaaccaggaattatt ttaattttggcgagaacttaattTGGTGAATGGCctaaaaagttaatttt ggtgggaactaagtTTGGCGAATTTGGAATTCGCTTGCCaatttcaccaa aattagttctcgccNaaatttttttaattttggcgagaacttaattTGGT GAATGGCctaaaaagttaattttggtgggaactaagtTTGGCGAATTTGG AATTCGCTTGccaatttcgccaaaattagttctcgccaaaattagttccc ttaaggtattaaaaTAATGTCGAAGGATTATATTTTAACCGATagaattt tctttcattttagacAAAGATAACGACAAAGTTGCtgaaaaagtttgtaa aaagCGATGTGTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTG GAAATACCAAATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCG ACTCGTAAGTATTCTAAGGTTCAATTAAAATTAACATCTCAACCGAAAGT TATAACAAATGTTTTTACGAGAATAAGCTCGAAGGATTATGTTTTAACGG AAAGCCGAAATTAGTAGTTAGAGGTAGTTTTTTTATCCCTATGTATTATA attaaataagaacaatttgaggttcaaagtgccaaaaaaaacccaaaaaa tcaGCCTCAGCAAAATTATACTGGTTTTACTGATTTATTTTCATGCTTTC ATTGTAGTTTGTGAACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACG GTCCTATACATTACATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAAT ATGAATGGTACAAAAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGC GATTCTCAATACTCAATTACATACTCCGACCGTGATCCAACAAAAAGCAG TTTGACTATTCTTTCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTT TCAGAGAAGCTAATCTAAAATACATCGATTGCTATGATTATAAAGTGAAA GGAGTTCGTAAGTTAAATTGCTCCTTAACACCTACACCCCCCCCCCCNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNccccccccccccccccccgatcaCTG CCCGCCCAATTCTTGACAACCACTAATTCTTAAAAGGATCCCATAATTAT CAAtaaataaaatctcaaaaagggATGACCAATCAAGACCAGTCAAATAC CAACGAATAAGGGCGGCTTAACATAAACGTCCAAGTATCTGTTTAGCcct taaaaaatattataaagttTTAATCCGCACCCTAACCATACTCGAAAAgt tattgaaaaaaagtttgcatcTGATCTAATTAATCGTATTTAGTACCTGA GAGGTGCATTgttggatttcaaaaaaataaatgtctTTCGGTGGTCCTGG ggtttttgctgacgtcagcaattacgtcatttttcaaacaacGTTCCGCA AAAACTTCttttggcttcattttcagacacgggttgtaatgtttttctaa acgagaatgaaaaatgctttccaacggtatgtaacatgacatactttgga gaaaaaaaattcattttagcctgggaacctgttttggtctgtaaaataca caaacaggtgccaattttttgtgtctgagatttaaatccatttttgagcC CTAAACTACAATTGTGCAAAGTCTCATGCTTGTACGCCTTTGTGCACAAT GTTAATGACTTTTGGCACATTTAGACTGCACTATAATGACGAATTGACAC TTAAAAATATGTCTGAAAATTCAACTTATTTAGTTAGTTATTGAAGGTAA TAACTTTTTTCTTTGCAATTCATAGTTCAAGTTGAATATATTGATGGTAA AGATATGTTTGATGTTGTGGCTGGCGAGAATATAACACTTGCAGTGAAAG CAAAAGACCCTGCATCTAAAACAAGNGTCTTTTATTTGCAATTCATAGTT CAAGTTGAATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGA GAATATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCT GGTCTGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCA CATTATAACTTGCCATCTACTGATGATTTTGGCCCTACTACACAAAGTAA GTAAAAGCATCAATCATAAAGATATTCCAATtttaggaaaatattttgac agAGTTTTGGGTGGGCAACTTTGACACAGTCTCGTTTTTTGTGTCTTTAA TGTtacagagaggcatcaagttcAAATTTAGTACTAAGTACGTTGGTATG AACCATTGACCCTACACACCGTAGCCGAATGCTCTAACCTCATGTGCGGT CGTTGCATACATCATACCAAATAGTCGTTTAGTAGTTTTTTGAACTACCA TCCTCGGTCCCTATCACGCTTTCTTTAGTGAAAGAAAACCATTTACAGGG AGCCCAATTGGTGTATTTATCACCTTTAAATTATTCTGTATCTATTGTTT CAGTGTTGGAGATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAAG CTTAAATGGTCAACTGATTTTGATCAATGCCCGATTGCCGATATTTTATT CAACGTTACTGTGAGAGGTATGACAatccattttgattttgaactcTCCT GTGTCACCCAACTGCAAAATTACCCGGTAGGAAAATAACctggaatttca gtcccgctGGGGAAtggactttgatttcatcccccatccaaaattcaatg tttaaaaattgcactccaaaaccatcttcactggattttttaaccttgga acgaTAGCTATCGATTCTATCCCCAccgggatttcaataggaatttttat ccccaccgaGGAAAAAATTCCAACGGGGCTGTGGAGCAGGGTGATGTTTT AAAAACGAAGCAAGCCAATCTAAAAGATGCATCTAGTATCTCTTCAAAAC TGAAAGTGAAAAGAAAGAATGACGAGTCATGATAATGCTCGCCATCGCCA TTTTGACAATCCAAAAACATACTAAATTGAAACTAGAAGGGTTAAAAGTT AGGAAAACCGCATAATTCCGCAGTGTTGTAATTTTCTGCGACGTTGCGGT GTTTCGAAACGCTTCCACAGAAGTGCTCTGGGTATACAACGCTTCCAATT TAAGTGTGTGATTTCAAATTCTGAACGCCGATCAGTTTTCGCTTTTTCTG AATAAAGTAGCCTGACTGTGAAGAATGATTGTGAAAAATCTTAAGGTAGG AAAATAAAATCCAAGGTTGAAAAGTTGACTTTTGCGTCGTTCTACACTTG ACAACGCTAAAGTTGCGGAATTTCCCGATTCTACGCAATTTCCCGTATGG TAGTACTTATTTATCTCTGAATACCTAGAACGGAATATAACAGCATCCAC TATGGACAATACGAACAACGGTGTAAATACAACAACCTCACCTAACCAGG AACTCAATGCTGGTCAACGAATTGGTACAGAGGAAGAGAGTGATGATTCT GTAGGCTATATTCCATTGATTTTCGGTTCATTCTTACTTGGTATAGCGAA AGGATCTATTGTACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGA ATCAGAggtaagttatttttttcaactttgtaCAGCTTGTCCAAGAAATA GTATCGGAACGGCATATATGTGTATCACAAAATATAAATAGCCCCAAAAA CTGGCCCCGGAAaccctagtctgaatcgcatacctctatagatatacttc ctatatagaaatatttttcgctagaggataaACAGAAGCCTACGGAAACC CCTTTGATGAATCCGacctttcatttttatattattGCCATGGCTACAAA ATGGGCTTGGTTATTTTATAGAAttcaaaataaagtatttattaaTTTCA GGAGCTCATCTAATTCATTGCTGCTAAAAGCAAATGATGATAAACCCGAC TCAGGGCGAATTGATCAGAATAGCTTAGATGGTGACACTATTCCTGAACC GCAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACACTA GTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTCGAT TGTGACACTATTCCTGAACCACAGTACAACGCTCAGCCTGTGGAACAGAA TAGCTTCGATGGAGACAGTAGTCCTGTATGGCAGAACAACGCTCAGCCTG TGGAACAGAATAGCTTTGATGGAGACACTAGTCCTGTATGGCAGAACAAC GCTTACCCTGAGGCACAGAATAGCTTAGATGGTGAAAATAGTTTTGCACC CCAGAGCCAGAACAACAATCAACCTGAAGCACAGAATAGCTTAGATGCTG AAAATCACCCTTTTGGTCCTGTAATACAATTTAAGAAACAACCTATAACA ACAGAGAGTATGTTAGATGAGAACACTGATGAGACCAATGACCCTTTTGG TCCTGTTCTGCAAAATACGAAACAACCTATAACAACACGGAATAGCTTAG ATCAGGATAATGAAAAAACACTCGAGACTATCTCCATCTTCAACAAATTG GCTTCTACTTCTTCCCGTAAATTTAAAAGGATGTAAAGCATATTTGGACG TGCTcagttgttttatttttttcaattttatataGTACTTTTAATGACTT GAAAGATTATTTggataataaaaat

Coding sequence (CDS) from alignment at sc0000010:1069472..1103646+

>TCONS_00001402 ID=TCONS_00001402|Name=TCONS_00001402|organism=Clytia hemisphaerica|type=CDS|length=65988bp|location=Sequence derived from alignment at sc0000010:1069472..1103646+ (Clytia hemisphaerica)
ATGGCGATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTCA
TCTTGCagGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGTG
CTTGTACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACGA
ATATGTAAAAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTCG
CAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTTACATTATCAA
AATGTAAACATGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTATA
CAGAACAAAGGTGTTATCTACATAAACGATTTAACAGATTCTGGAGTTAT
GGAATCATTCTCCGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATGA
CAGGTTGTATGTATGGGAAATTTAAATGCTGGGCTCATACACAACCTCTT
CTTCCTCGTTACGAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGGT
AAAGGACATTTGTAGAAaacCGCTCGATGGGGACTGGTCACAATGGGGCC
CTTGGGATGTTTGTCGCAGACcatgtttccatggtgatcAATTTAGGAGA
AGGACATGTACTAATCCAGCACCTCAGAAGGGTGGACGTGGTTGCCCAGA
GTCTAGTGGTCATCATCGGATGTGCAATCCAAACAGTTGTAAAGATTTAG
ATTTACATTCATCATGCAAAAGAGAACAAGGGGAGTGTCTTGATGAAAGC
GGCCGTGGACGCATTCAGACAATGGGTAAGAAGCTAAATCATGGAAAAGA
GAAAGATTGTCTCGAAAAATGTATGGACCAGCTCTACTACGGTTCAGGTT
GTACTTTCATCAAAAGTACTGGTTATTGCTATACTCATACAAAAAGAGTG
GCAGGAGGAAATGGAGATGATGGAGCTTTTTGTTgggtatttaaaaaatg
taaaaTTAATGGCAAATGGTCAAAATGGGGCGCATGGGGAGAGTGCAGTG
TATCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAACATGCAACAAT
CCCATACCTAATGCGGGTGGATTGGATTGTCCAAAATCTGATAATGACAG
TCAAACTCGGAATTGCAAAACACGCNACAATCCCATACCTAATGCTGGTG
GATTGGATTGTCCAAAATCTGACAATGACAGTCAAACTCGGAATTGCAAA
ACACGCATTTGTCCAACTCATGGCAAATGGTCGGCATGGGGCTCATGGGG
AAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAAACTAGAACAAGAACAT
GTACCAACCCTGCACCTCGGCATGGTGGAATGGATTGTGGAGACTCTATA
CCTCATATTTTGAATTGCAATTTAAAGTCCTGTCCTCCAACTCATGGCAA
ATGGTCGGAATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGCTG
GTCAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGGC
GGAAGGGATTGTACAGACAttaaaaatgatattgaaaatcAGAAATGCAA
TACGAACACATGTCCAAACAATAACGAAGTTGCTGAAAAAGTTTGTAAGA
TGCAATGTGTCCATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGGA
GAAGCCCAATTAGATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAAC
GAGTCataCGACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaaa
agcgATGTTTTCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGGA
GATACCAAATTAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCAC
GACTCatgGGACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaaa
agcGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGCG
GGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTCa
cAAAGATAACGACAAAGTTGCtgaaaaagtttgtaaaaagCGATGTGTTC
ATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAATACCAAATTT
GACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCGACTCTTTGTGAACC
TAAAAAAGAAGCAATGGTTATGTGTCATGGACGGTCCTATACATTACATG
GGAAAGCAAAGAATGGTGCCAGCGCTAAACAATATGAATGGTACAAAAAG
AGCAAAAAGGATTCGCTATTACGATTGGATAGCGATTCTCAATACTCAAT
TACATACTCCGACCGTGATCCAACAAAAAGCAGTTTGACTATTCTTTCTT
TCAGTATGGTTAAACACGAAGGACTTTACGCTTTCAGAGAAGCTAATCTA
AAATACATCGATTGCTATGATTATAAAGTGAAAGGAGTTCTTCAAGTTGA
ATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGAGAATATAA
CACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCTGGTCTGTT
GATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCACATTATAA
CTTGCCATCTACTGATGATTTTGGCCCTACTACACAAATGTTGGAGATTC
TTAATCCTCAACGGAGACATGGTGGAATGTACAAGCTTAAATGGTCAACT
GATTTTGATCAATGCCCGATTGCCGATATTTTATTCAACGTTACTGTGAG
AGAACGGAATATAACAGCATCCACTATGGACAATACGAACAACGGTGTAA
ATACAACAACCTCACCTAACCAGGAACTCAATGCTGGTCAACGAATTGGT
ACAGAGGAAGAGAGTGATGATTCTGTAGGCTATATTCCATTGATTTTCGG
TTCATTCTTACTTGGTATAGCGAAAGGATCTATTGTACTTTGGTTTCTTT
ATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCATCTAATTCATTG
CTGCTAAAAGCAAATGATGATAAACCCGACTCAGGGCGAATTGATCAGAA
TAGCTTAGATGGTGACACTATTCCTGAACCGCAGTACAACGCTCAGCCTG
TGGAACAGAATAGCTTCGATGGAGACACTAGTCCTGTATGGCAGAACAAC
GCTCAGCCTGTGGAACAGAATAGCTTCGATTGTGACACTATTCCTGAACC
ACAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACAGTA
GTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTTGAT
GGAGACACTAGTCCTGTATGGCAGAACAACGCTTACCCTGAGGCACAGAA
TAGCTTAGATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAACAACAATC
AACCTGAAGCACAGAATAGCTTAGATGCTGAAAATCACCCTTTTGGTCCT
GTAATACAATTTAAGAAACAACCTATAACAACAGAGAGTATGTTAGATGA
GAACACTGATGAGACCAATGACCCTTTTGGTCCTGTTCTGCAAAATACGA
AACAACCTATAACAACACGGAATAGCTTAGATCAGGATAATGAAAAAACA
CTCGAGACTATCTCCATCTTCAACAAATTGGCTTCTACTTCTTCCCGTAA
ATTTAAAAGGATGTAAATGGCGATGCGCTTCACCATTCTTTACAATGTTC
TATTCATTTTGCTTCATCTTGCagGTGCAACTGATGGGAGCTGGACGCAA
TGGGGCTCATGGAGTGCTTGTACACCACAGTGCTATCAAACTAGAAAAAG
AACGTGTACTGCACGAATATGTAAAAACTATGATACCGACACTCAGTTTT
GTAATGCTGCCGGTCGCAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCC
CCTTTTACATTATCAAAATGTAAACATGAAGAAGGACGCTGTTTAACGGG
CCTGCGCAGACGTATACAGAACAAAGGTGTTATCTACATAAACGATTTAA
CAGATTCTGGAGTTATGGAATCATTCTCCGACTGTTTTGAATTATGTCAA
AGAATCCCTGGTATGACAGGTTGTATGTATGGGAAATTTAAATGCTGGGC
TCATACACAACCTCTTCTTCCTCGTTACGAAGAATCTTTTAAAGACCCAT
CTCATATTTGTTGGGTAAAGGACATTTGTAGAAaacCGCTCGATGGGGAC
TGGTCACAATGGGGCCCTTGGGATGTTTGTCGCAGACcatgtttccatgg
tgatcAATTTAGGAGAAGGACATGTACTAATCCAGCACCTCAGAAGGGTG
GACGTGGTTGCCCAGAGTCTAGTGGTCATCATCGGATGTGCAATCCAAAC
AGTTGTAAAGATTTAGATTTACATTCATCATGCAAAAGAGAACAAGGGGA
GTGTCTTGATGAAAGCGGCCGTGGACGCATTCAGACAATGGGTAAGAAGC
TAAATCATGGAAAAGAGAAAGATTGTCTCGAAAAATGTATGGACCAGCTC
TACTACGGTTCAGGTTGTACTTTCATCAAAAGTACTGGTTATTGCTATAC
TCATACAAAAAGAGTGGCAGGAGGAAATGGAGATGATGGAGCTTTTTGTT
gggtatttaaaaaatgtaaaaTTAATGGCAAATGGTCAAAATGGGGCGCA
TGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGCAAACTAGAAG
AAGAACATGCAACAATCCCATACCTAATGCGGGTGGATTGGATTGTCCAA
AATCTGATAATGACAGTCAAACTCGGAATTGCAAAACACGCNACAATCCC
ATACCTAATGCTGGTGGATTGGATTGTCCAAAATCTGACAATGACAGTCA
AACTCGGAATTGCAAAACACGCATTTGTCCAACTCATGGCAAATGGTCGG
CATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAA
ACTAGAACAAGAACATGTACCAACCCTGCACCTCGGCATGGTGGAATGGA
TTGTGGAGACTCTATACCTCATATTTTGAATTGCAATTTAAAGTCCTGTC
CTCCAACTCATGGCAAATGGTCGGAATGGGGCTCATGGGGAAAGTGCAGT
GCATCATGTGGTGCTGGTCAGAAAACTAGAACAAGAACATGTACCAACCC
TGCACCTCAGAATGGCGGAAGGGATTGTACAGACAttaaaaatgatattg
aaaatcAGAAATGCAATACGAACACATGTCCAAACAATAACGAAGTTGCT
GAAAAAGTTTGTAAGATGCAATGTGTCCATTTGAAAGGGAAATGTGGTCA
AATGCTTAAATGTGGAGAAGCCCAATTAGATGTTTCAAACCTCTGCCCTA
AAACATGTGCTGCAACGAGTCataCGACCAAAGATAACAACGAAGTTgct
gaaaatttttgtaaaaagcgATGTTTTCATCTAATTGAGAATTGTGGTCA
AATGGTTAGGTGTGGAGATACCAAATTAGACGTTTCAAACCTTTGCCCTA
AAACGTGCGCCACCACGACTCatgGGACCAAAGACAACAACGAACTTGCt
gaaaaaatttgtaaaaagcGATGTGATCAATTGGAACGCAATTGTGGTGA
AATAAAAAGATGTGCGGGATATACAATGTTAGACGTTTCAAACGTTTGCC
CTGAAACCTGTGCTCacAAAGATAACGACAAAGTTGCtgaaaaagtttgt
aaaaagCGATGTGTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTG
TGGAAATACCAAATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCG
CGACTCTTTGTGAACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACGG
TCCTATACATTACATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAATA
TGAATGGTACAAAAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGCG
ATTCTCAATACTCAATTACATACTCCGACCGTGATCCAACAAAAAGCAGT
TTGACTATTCTTTCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTTT
CAGAGAAGCTAATCTAAAATACATCGATTGCTATGATTATAAAGTGAAAG
GAGTTCTTCAAGTTGAATATATTGATGGTAAAGATATGTTTGATGTTGTG
GCTGGCGAGAATATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAA
AACAAGCTGGTCTGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAG
CATCTCCACATTATAACTTGCCATCTACTGATGATTTTGGCCCTACTACA
CAAATGTTGGAGATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAA
GCTTAAATGGTCAACTGATTTTGATCAATGCCCGATTGCCGATATTTTAT
TCAACGTTACTGTGAGAGAACGGAATATAACAGCATCCACTATGGACAAT
ACGAACAACGGTGTAAATACAACAACCTCACCTAACCAGGAACTCAATGC
TGGTCAACGAATTGGTACAGAGGAAGAGAGTGATGATTCTGTAGGCTATA
TTCCATTGATTTTCGGTTCATTCTTACTTGGTATAGCGAAAGGATCTATT
GTACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAG
CTCATCTAATTCATTGCTGCTAAAAGCAAATGATGATAAACCCGACTCAG
GGCGAATTGATCAGAATAGCTTAGATGGTGACACTATTCCTGAACCGCAG
TACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACACTAGTCC
TGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATTGTG
ACACTATTCCTGAACCACAGTACAACGCTCAGCCTGTGGAACAGAATAGC
TTCGATGGAGACAGTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGA
ACAGAATAGCTTTGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTT
ACCCTGAGGCACAGAATAGCTTAGATGGTGAAAATAGTTTTGCACCCCAG
AGCCAGAACAACAATCAACCTGAAGCACAGAATAGCTTAGATGCTGAAAA
TCACCCTTTTGGTCCTGTAATACAATTTAAGAAACAACCTATAACAACAG
AGAGTATGTTAGATGAGAACACTGATGAGACCAATGACCCTTTTGGTCCT
GTTCTGCAAAATACGAAACAACCTATAACAACACGGAATAGCTTAGATCA
GGATAATGAAAAAACACTCGAGACTATCTCCATCTTCAACAAATTGGCTT
CTACTTCTTCCCGTAAATTTAAAAGGATGTAAATGGCGATGCGCTTCACC
ATTCTTTACAATGTTCTATTCATTTTGCTTCATCTTGCagGTGCAACTGA
TGGGAGCTGGACGCAATGGGGCTCATGGAGTGCTTGTACACCACAGTGCT
ATCAAACTAGAAAAAGAACGTGTACTGCACGAATATGTAAAAACTATGAT
ACCGACACTCAGTTTTGTAATGCTGCCGGTCGCAGCTGCTCAAAATGGAA
AGCAGACGGTTCTGCCCCTTTTACATTATCAAAATGTAAACATGAAGAAG
GACGCTGTTTAACGGGCCTGCGCAGACGTATACAGAACAAAGGTGTTATC
TACATAAACGATTTAACAGATTCTGGAGTTATGGAATCATTCTCCGACTG
TTTTGAATTATGTCAAAGAATCCCTGGTATGACAGGTTGTATGTATGGGA
AATTTAAATGCTGGGCTCATACACAACCTCTTCTTCCTCGTTACGAAGAA
TCTTTTAAAGACCCATCTCATATTTGTTGGGTAAAGGACATTTGTAGAAa
acCGCTCGATGGGGACTGGTCACAATGGGGCCCTTGGGATGTTTGTCGCA
GACcatgtttccatggtgatcAATTTAGGAGAAGGACATGTACTAATCCA
GCACCTCAGAAGGGTGGACGTGGTTGCCCAGAGTCTAGTGGTCATCATCG
GATGTGCAATCCAAACAGTTGTAAAGATTTAGATTTACATTCATCATGCA
AAAGAGAACAAGGGGAGTGTCTTGATGAAAGCGGCCGTGGACGCATTCAG
ACAATGGGTAAGAAGCTAAATCATGGAAAAGAGAAAGATTGTCTCGAAAA
ATGTATGGACCAGCTCTACTACGGTTCAGGTTGTACTTTCATCAAAAGTA
CTGGTTATTGCTATACTCATACAAAAAGAGTGGCAGGAGGAAATGGAGAT
GATGGAGCTTTTTGTTgggtatttaaaaaatgtaaaaTTAATGGCAAATG
GTCAAAATGGGGCGCATGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTG
GTAAGCAAACTAGAAGAAGAACATGCAACAATCCCATACCTAATGCGGGT
GGATTGGATTGTCCAAAATCTGATAATGACAGTCAAACTCGGAATTGCAA
AACACGCNACAATCCCATACCTAATGCTGGTGGATTGGATTGTCCAAAAT
CTGACAATGACAGTCAAACTCGGAATTGCAAAACACGCATTTGTCCAACT
CATGGCAAATGGTCGGCATGGGGCTCATGGGGAAAGTGCAGTGCATCATG
TGGTGGTGGTAAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTC
GGCATGGTGGAATGGATTGTGGAGACTCTATACCTCATATTTTGAATTGC
AATTTAAAGTCCTGTCCTCCAACTCATGGCAAATGGTCGGAATGGGGCTC
ATGGGGAAAGTGCAGTGCATCATGTGGTGCTGGTCAGAAAACTAGAACAA
GAACATGTACCAACCCTGCACCTCAGAATGGCGGAAGGGATTGTACAGAC
AttaaaaatgatattgaaaatcAGAAATGCAATACGAACACATGTCCAAA
CAATAACGAAGTTGCTGAAAAAGTTTGTAAGATGCAATGTGTCCATTTGA
AAGGGAAATGTGGTCAAATGCTTAAATGTGGAGAAGCCCAATTAGATGTT
TCAAACCTCTGCCCTAAAACATGTGCTGCAACGAGTCataCGACCAAAGA
TAACAACGAAGTTgctgaaaatttttgtaaaaagcgATGTTTTCATCTAA
TTGAGAATTGTGGTCAAATGGTTAGGTGTGGAGATACCAAATTAGACGTT
TCAAACCTTTGCCCTAAAACGTGCGCCACCACGACTCatgGGACCAAAGA
CAACAACGAACTTGCtgaaaaaatttgtaaaaagcGATGTGATCAATTGG
AACGCAATTGTGGTGAAATAAAAAGATGTGCGGGATATACAATGTTAGAC
GTTTCAAACGTTTGCCCTGAAACCTGTGCTCacAAAGATAACGACAAAGT
TGCtgaaaaagtttgtaaaaagCGATGTGTTCATTTTAAAGGGAATTGTG
GTCAAATGGTTAAGTGTGGAAATACCAAATTTGACGTTTCAAACCATTGT
CCAAAAACTTGTGCCGCGACTCTTTGTGAACCTAAAAAAGAAGCAATGGT
TATGTGTCATGGACGGTCCTATACATTACATGGGAAAGCAAAGAATGGTG
CCAGCGCTAAACAATATGAATGGTACAAAAAGAGCAAAAAGGATTCGCTA
TTACGATTGGATAGCGATTCTCAATACTCAATTACATACTCCGACCGTGA
TCCAACAAAAAGCAGTTTGACTATTCTTTCTTTCAGTATGGTTAAACACG
AAGGACTTTACGCTTTCAGAGAAGCTAATCTAAAATACATCGATTGCTAT
GATTATAAAGTGAAAGGAGTTCTTCAAGTTGAATATATTGATGGTAAAGA
TATGTTTGATGTTGTGGCTGGCGAGAATATAACACTTGCAGTGAAAGCAA
AAGACCCTGCATCTAAAACAAGCTGGTCTGTTGATGGACAAAGTTTGATA
GAACCTTTAATTAAAGCATCTCCACATTATAACTTGCCATCTACTGATGA
TTTTGGCCCTACTACACAAATGTTGGAGATTCTTAATCCTCAACGGAGAC
ATGGTGGAATGTACAAGCTTAAATGGTCAACTGATTTTGATCAATGCCCG
ATTGCCGATATTTTATTCAACGTTACTGTGAGAGAACGGAATATAACAGC
ATCCACTATGGACAATACGAACAACGGTGTAAATACAACAACCTCACCTA
ACCAGGAACTCAATGCTGGTCAACGAATTGGTACAGAGGAAGAGAGTGAT
GATTCTGTAGGCTATATTCCATTGATTTTCGGTTCATTCTTACTTGGTAT
AGCGAAAGGATCTATTGTACTTTGGTTTCTTTATAAAAGAGGATTAGCTC
GCAAGAATCAGAgGAGCTCATCTAATTCATTGCTGCTAAAAGCAAATGAT
GATAAACCCGACTCAGGGCGAATTGATCAGAATAGCTTAGATGGTGACAC
TATTCCTGAACCGCAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCG
ATGGAGACACTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAG
AATAGCTTCGATTGTGACACTATTCCTGAACCACAGTACAACGCTCAGCC
TGTGGAACAGAATAGCTTCGATGGAGACAGTAGTCCTGTATGGCAGAACA
ACGCTCAGCCTGTGGAACAGAATAGCTTTGATGGAGACACTAGTCCTGTA
TGGCAGAACAACGCTTACCCTGAGGCACAGAATAGCTTAGATGGTGAAAA
TAGTTTTGCACCCCAGAGCCAGAACAACAATCAACCTGAAGCACAGAATA
GCTTAGATGCTGAAAATCACCCTTTTGGTCCTGTAATACAATTTAAGAAA
CAACCTATAACAACAGAGAGTATGTTAGATGAGAACACTGATGAGACCAA
TGACCCTTTTGGTCCTGTTCTGCAAAATACGAAACAACCTATAACAACAC
GGAATAGCTTAGATCAGGATAATGAAAAAACACTCGAGACTATCTCCATC
TTCAACAAATTGGCTTCTACTTCTTCCCGTAAATTTAAAAGGATGTAAAT
GGCGATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTCATC
TTGCagGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGTGCT
TGTACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACGAAT
ATGTAAAAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTCGCA
GCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTTACATTATCAAAA
TGTAAACATGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTATACA
GAACAAAGGTGTTATCTACATAAACGATTTAACAGATTCTGGAGTTATGG
AATCATTCTCCGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATGACA
GGTTGTATGTATGGGAAATTTAAATGCTGGGCTCATACACAACCTCTTCT
TCCTCGTTACGAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGGTAA
AGGACATTTGTAGAAaacCGCTCGATGGGGACTGGTCACAATGGGGCCCT
TGGGATGTTTGTCGCAGACcatgtttccatggtgatcAATTTAGGAGAAG
GACATGTACTAATCCAGCACCTCAGAAGGGTGGACGTGGTTGCCCAGAGT
CTAGTGGTCATCATCGGATGTGCAATCCAAACAGTTGTAAAGATTTAGAT
TTACATTCATCATGCAAAAGAGAACAAGGGGAGTGTCTTGATGAAAGCGG
CCGTGGACGCATTCAGACAATGGGTAAGAAGCTAAATCATGGAAAAGAGA
AAGATTGTCTCGAAAAATGTATGGACCAGCTCTACTACGGTTCAGGTTGT
ACTTTCATCAAAAGTACTGGTTATTGCTATACTCATACAAAAAGAGTGGC
AGGAGGAAATGGAGATGATGGAGCTTTTTGTTgggtatttaaaaaatgta
aaaTTAATGGCAAATGGTCAAAATGGGGCGCATGGGGAGAGTGCAGTGTA
TCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAACATGCAACAATCC
CATACCTAATGCGGGTGGATTGGATTGTCCAAAATCTGATAATGACAGTC
AAACTCGGAATTGCAAAACACGCNACAATCCCATACCTAATGCTGGTGGA
TTGGATTGTCCAAAATCTGACAATGACAGTCAAACTCGGAATTGCAAAAC
ACGCATTTGTCCAACTCATGGCAAATGGTCGGCATGGGGCTCATGGGGAA
AGTGCAGTGCATCATGTGGTGGTGGTAAGAAAACTAGAACAAGAACATGT
ACCAACCCTGCACCTCGGCATGGTGGAATGGATTGTGGAGACTCTATACC
TCATATTTTGAATTGCAATTTAAAGTCCTGTCCTCCAACTCATGGCAAAT
GGTCGGAATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGCTGGT
CAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGGCGG
AAGGGATTGTACAGACAttaaaaatgatattgaaaatcAGAAATGCAATA
CGAACACATGTCCAAACAATAACGAAGTTGCTGAAAAAGTTTGTAAGATG
CAATGTGTCCATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGGAGA
AGCCCAATTAGATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAACGA
GTCataCGACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaaaag
cgATGTTTTCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGGAGA
TACCAAATTAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCACGA
CTCatgGGACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaaaag
cGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGCGGG
ATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTCacA
AAGATAACGACAAAGTTGCtgaaaaagtttgtaaaaagCGATGTGTTCAT
TTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAATACCAAATTTGA
CGTTTCAAACCATTGTCCAAAAACTTGTGCCGCGACTCTTTGTGAACCTA
AAAAAGAAGCAATGGTTATGTGTCATGGACGGTCCTATACATTACATGGG
AAAGCAAAGAATGGTGCCAGCGCTAAACAATATGAATGGTACAAAAAGAG
CAAAAAGGATTCGCTATTACGATTGGATAGCGATTCTCAATACTCAATTA
CATACTCCGACCGTGATCCAACAAAAAGCAGTTTGACTATTCTTTCTTTC
AGTATGGTTAAACACGAAGGACTTTACGCTTTCAGAGAAGCTAATCTAAA
ATACATCGATTGCTATGATTATAAAGTGAAAGGAGTTCTTCAAGTTGAAT
ATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGAGAATATAACA
CTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCTGGTCTGTTGA
TGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCACATTATAACT
TGCCATCTACTGATGATTTTGGCCCTACTACACAAATGTTGGAGATTCTT
AATCCTCAACGGAGACATGGTGGAATGTACAAGCTTAAATGGTCAACTGA
TTTTGATCAATGCCCGATTGCCGATATTTTATTCAACGTTACTGTGAGAG
AACGGAATATAACAGCATCCACTATGGACAATACGAACAACGGTGTAAAT
ACAACAACCTCACCTAACCAGGAACTCAATGCTGGTCAACGAATTGGTAC
AGAGGAAGAGAGTGATGATTCTGTAGGCTATATTCCATTGATTTTCGGTT
CATTCTTACTTGGTATAGCGAAAGGATCTATTGTACTTTGGTTTCTTTAT
AAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCATCTAATTCATTGCT
GCTAAAAGCAAATGATGATAAACCCGACTCAGGGCGAATTGATCAGAATA
GCTTAGATGGTGACACTATTCCTGAACCGCAGTACAACGCTCAGCCTGTG
GAACAGAATAGCTTCGATGGAGACACTAGTCCTGTATGGCAGAACAACGC
TCAGCCTGTGGAACAGAATAGCTTCGATTGTGACACTATTCCTGAACCAC
AGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACAGTAGT
CCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTTGATGG
AGACACTAGTCCTGTATGGCAGAACAACGCTTACCCTGAGGCACAGAATA
GCTTAGATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAACAACAATCAA
CCTGAAGCACAGAATAGCTTAGATGCTGAAAATCACCCTTTTGGTCCTGT
AATACAATTTAAGAAACAACCTATAACAACAGAGAGTATGTTAGATGAGA
ACACTGATGAGACCAATGACCCTTTTGGTCCTGTTCTGCAAAATACGAAA
CAACCTATAACAACACGGAATAGCTTAGATCAGGATAATGAAAAAACACT
CGAGACTATCTCCATCTTCAACAAATTGGCTTCTACTTCTTCCCGTAAAT
TTAAAAGGATGTAAATGGCGATGCGCTTCACCATTCTTTACAATGTTCTA
TTCATTTTGCTTCATCTTGCagGTGCAACTGATGGGAGCTGGACGCAATG
GGGCTCATGGAGTGCTTGTACACCACAGTGCTATCAAACTAGAAAAAGAA
CGTGTACTGCACGAATATGTAAAAACTATGATACCGACACTCAGTTTTGT
AATGCTGCCGGTCGCAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCC
TTTTACATTATCAAAATGTAAACATGAAGAAGGACGCTGTTTAACGGGCC
TGCGCAGACGTATACAGAACAAAGGTGTTATCTACATAAACGATTTAACA
GATTCTGGAGTTATGGAATCATTCTCCGACTGTTTTGAATTATGTCAAAG
AATCCCTGGTATGACAGGTTGTATGTATGGGAAATTTAAATGCTGGGCTC
ATACACAACCTCTTCTTCCTCGTTACGAAGAATCTTTTAAAGACCCATCT
CATATTTGTTGGGTAAAGGACATTTGTAGAAaacCGCTCGATGGGGACTG
GTCACAATGGGGCCCTTGGGATGTTTGTCGCAGACcatgtttccatggtg
atcAATTTAGGAGAAGGACATGTACTAATCCAGCACCTCAGAAGGGTGGA
CGTGGTTGCCCAGAGTCTAGTGGTCATCATCGGATGTGCAATCCAAACAG
TTGTAAAGATTTAGATTTACATTCATCATGCAAAAGAGAACAAGGGGAGT
GTCTTGATGAAAGCGGCCGTGGACGCATTCAGACAATGGGTAAGAAGCTA
AATCATGGAAAAGAGAAAGATTGTCTCGAAAAATGTATGGACCAGCTCTA
CTACGGTTCAGGTTGTACTTTCATCAAAAGTACTGGTTATTGCTATACTC
ATACAAAAAGAGTGGCAGGAGGAAATGGAGATGATGGAGCTTTTTGTTgg
gtatttaaaaaatgtaaaaTTAATGGCAAATGGTCAAAATGGGGCGCATG
GGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAA
GAACATGCAACAATCCCATACCTAATGCGGGTGGATTGGATTGTCCAAAA
TCTGATAATGACAGTCAAACTCGGAATTGCAAAACACGCNACAATCCCAT
ACCTAATGCTGGTGGATTGGATTGTCCAAAATCTGACAATGACAGTCAAA
CTCGGAATTGCAAAACACGCATTTGTCCAACTCATGGCAAATGGTCGGCA
TGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAAAC
TAGAACAAGAACATGTACCAACCCTGCACCTCGGCATGGTGGAATGGATT
GTGGAGACTCTATACCTCATATTTTGAATTGCAATTTAAAGTCCTGTCCT
CCAACTCATGGCAAATGGTCGGAATGGGGCTCATGGGGAAAGTGCAGTGC
ATCATGTGGTGCTGGTCAGAAAACTAGAACAAGAACATGTACCAACCCTG
CACCTCAGAATGGCGGAAGGGATTGTACAGACAttaaaaatgatattgaa
aatcAGAAATGCAATACGAACACATGTCCAAACAATAACGAAGTTGCTGA
AAAAGTTTGTAAGATGCAATGTGTCCATTTGAAAGGGAAATGTGGTCAAA
TGCTTAAATGTGGAGAAGCCCAATTAGATGTTTCAAACCTCTGCCCTAAA
ACATGTGCTGCAACGAGTCataCGACCAAAGATAACAACGAAGTTgctga
aaatttttgtaaaaagcgATGTTTTCATCTAATTGAGAATTGTGGTCAAA
TGGTTAGGTGTGGAGATACCAAATTAGACGTTTCAAACCTTTGCCCTAAA
ACGTGCGCCACCACGACTCatgGGACCAAAGACAACAACGAACTTGCtga
aaaaatttgtaaaaagcGATGTGATCAATTGGAACGCAATTGTGGTGAAA
TAAAAAGATGTGCGGGATATACAATGTTAGACGTTTCAAACGTTTGCCCT
GAAACCTGTGCTCacAAAGATAACGACAAAGTTGCtgaaaaagtttgtaa
aaagCGATGTGTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTG
GAAATACCAAATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCG
ACTCTTTGTGAACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACGGTC
CTATACATTACATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAATATG
AATGGTACAAAAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGCGAT
TCTCAATACTCAATTACATACTCCGACCGTGATCCAACAAAAAGCAGTTT
GACTATTCTTTCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTTTCA
GAGAAGCTAATCTAAAATACATCGATTGCTATGATTATAAAGTGAAAGGA
GTTCTTCAAGTTGAATATATTGATGGTAAAGATATGTTTGATGTTGTGGC
TGGCGAGAATATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAA
CAAGCTGGTCTGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCA
TCTCCACATTATAACTTGCCATCTACTGATGATTTTGGCCCTACTACACA
AATGTTGGAGATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAAGC
TTAAATGGTCAACTGATTTTGATCAATGCCCGATTGCCGATATTTTATTC
AACGTTACTGTGAGAGAACGGAATATAACAGCATCCACTATGGACAATAC
GAACAACGGTGTAAATACAACAACCTCACCTAACCAGGAACTCAATGCTG
GTCAACGAATTGGTACAGAGGAAGAGAGTGATGATTCTGTAGGCTATATT
CCATTGATTTTCGGTTCATTCTTACTTGGTATAGCGAAAGGATCTATTGT
ACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCT
CATCTAATTCATTGCTGCTAAAAGCAAATGATGATAAACCCGACTCAGGG
CGAATTGATCAGAATAGCTTAGATGGTGACACTATTCCTGAACCGCAGTA
CAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACACTAGTCCTG
TATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATTGTGAC
ACTATTCCTGAACCACAGTACAACGCTCAGCCTGTGGAACAGAATAGCTT
CGATGGAGACAGTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAAC
AGAATAGCTTTGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTTAC
CCTGAGGCACAGAATAGCTTAGATGGTGAAAATAGTTTTGCACCCCAGAG
CCAGAACAACAATCAACCTGAAGCACAGAATAGCTTAGATGCTGAAAATC
ACCCTTTTGGTCCTGTAATACAATTTAAGAAACAACCTATAACAACAGAG
AGTATGTTAGATGAGAACACTGATGAGACCAATGACCCTTTTGGTCCTGT
TCTGCAAAATACGAAACAACCTATAACAACACGGAATAGCTTAGATCAGG
ATAATGAAAAAACACTCGAGACTATCTCCATCTTCAACAAATTGGCTTCT
ACTTCTTCCCGTAAATTTAAAAGGATGTAAATGGCGATGCGCTTCACCAT
TCTTTACAATGTTCTATTCATTTTGCTTCATCTTGCagGTGCAACTGATG
GGAGCTGGACGCAATGGGGCTCATGGAGTGCTTGTACACCACAGTGCTAT
CAAACTAGAAAAAGAACGTGTACTGCACGAATATGTAAAAACTATGATAC
CGACACTCAGTTTTGTAATGCTGCCGGTCGCAGCTGCTCAAAATGGAAAG
CAGACGGTTCTGCCCCTTTTACATTATCAAAATGTAAACATGAAGAAGGA
CGCTGTTTAACGGGCCTGCGCAGACGTATACAGAACAAAGGTGTTATCTA
CATAAACGATTTAACAGATTCTGGAGTTATGGAATCATTCTCCGACTGTT
TTGAATTATGTCAAAGAATCCCTGGTATGACAGGTTGTATGTATGGGAAA
TTTAAATGCTGGGCTCATACACAACCTCTTCTTCCTCGTTACGAAGAATC
TTTTAAAGACCCATCTCATATTTGTTGGGTAAAGGACATTTGTAGAAaac
CGCTCGATGGGGACTGGTCACAATGGGGCCCTTGGGATGTTTGTCGCAGA
CcatgtttccatggtgatcAATTTAGGAGAAGGACATGTACTAATCCAGC
ACCTCAGAAGGGTGGACGTGGTTGCCCAGAGTCTAGTGGTCATCATCGGA
TGTGCAATCCAAACAGTTGTAAAGATTTAGATTTACATTCATCATGCAAA
AGAGAACAAGGGGAGTGTCTTGATGAAAGCGGCCGTGGACGCATTCAGAC
AATGGGTAAGAAGCTAAATCATGGAAAAGAGAAAGATTGTCTCGAAAAAT
GTATGGACCAGCTCTACTACGGTTCAGGTTGTACTTTCATCAAAAGTACT
GGTTATTGCTATACTCATACAAAAAGAGTGGCAGGAGGAAATGGAGATGA
TGGAGCTTTTTGTTgggtatttaaaaaatgtaaaaTTAATGGCAAATGGT
CAAAATGGGGCGCATGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGT
AAGCAAACTAGAAGAAGAACATGCAACAATCCCATACCTAATGCGGGTGG
ATTGGATTGTCCAAAATCTGATAATGACAGTCAAACTCGGAATTGCAAAA
CACGCNACAATCCCATACCTAATGCTGGTGGATTGGATTGTCCAAAATCT
GACAATGACAGTCAAACTCGGAATTGCAAAACACGCATTTGTCCAACTCA
TGGCAAATGGTCGGCATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTG
GTGGTGGTAAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCGG
CATGGTGGAATGGATTGTGGAGACTCTATACCTCATATTTTGAATTGCAA
TTTAAAGTCCTGTCCTCCAACTCATGGCAAATGGTCGGAATGGGGCTCAT
GGGGAAAGTGCAGTGCATCATGTGGTGCTGGTCAGAAAACTAGAACAAGA
ACATGTACCAACCCTGCACCTCAGAATGGCGGAAGGGATTGTACAGACAt
taaaaatgatattgaaaatcAGAAATGCAATACGAACACATGTCCAAACA
ATAACGAAGTTGCTGAAAAAGTTTGTAAGATGCAATGTGTCCATTTGAAA
GGGAAATGTGGTCAAATGCTTAAATGTGGAGAAGCCCAATTAGATGTTTC
AAACCTCTGCCCTAAAACATGTGCTGCAACGAGTCataCGACCAAAGATA
ACAACGAAGTTgctgaaaatttttgtaaaaagcgATGTTTTCATCTAATT
GAGAATTGTGGTCAAATGGTTAGGTGTGGAGATACCAAATTAGACGTTTC
AAACCTTTGCCCTAAAACGTGCGCCACCACGACTCatgGGACCAAAGACA
ACAACGAACTTGCtgaaaaaatttgtaaaaagcGATGTGATCAATTGGAA
CGCAATTGTGGTGAAATAAAAAGATGTGCGGGATATACAATGTTAGACGT
TTCAAACGTTTGCCCTGAAACCTGTGCTCacAAAGATAACGACAAAGTTG
CtgaaaaagtttgtaaaaagCGATGTGTTCATTTTAAAGGGAATTGTGGT
CAAATGGTTAAGTGTGGAAATACCAAATTTGACGTTTCAAACCATTGTCC
AAAAACTTGTGCCGCGACTCTTTGTGAACCTAAAAAAGAAGCAATGGTTA
TGTGTCATGGACGGTCCTATACATTACATGGGAAAGCAAAGAATGGTGCC
AGCGCTAAACAATATGAATGGTACAAAAAGAGCAAAAAGGATTCGCTATT
ACGATTGGATAGCGATTCTCAATACTCAATTACATACTCCGACCGTGATC
CAACAAAAAGCAGTTTGACTATTCTTTCTTTCAGTATGGTTAAACACGAA
GGACTTTACGCTTTCAGAGAAGCTAATCTAAAATACATCGATTGCTATGA
TTATAAAGTGAAAGGAGTTCTTCAAGTTGAATATATTGATGGTAAAGATA
TGTTTGATGTTGTGGCTGGCGAGAATATAACACTTGCAGTGAAAGCAAAA
GACCCTGCATCTAAAACAAGCTGGTCTGTTGATGGACAAAGTTTGATAGA
ACCTTTAATTAAAGCATCTCCACATTATAACTTGCCATCTACTGATGATT
TTGGCCCTACTACACAAATGTTGGAGATTCTTAATCCTCAACGGAGACAT
GGTGGAATGTACAAGCTTAAATGGTCAACTGATTTTGATCAATGCCCGAT
TGCCGATATTTTATTCAACGTTACTGTGAGAGAACGGAATATAACAGCAT
CCACTATGGACAATACGAACAACGGTGTAAATACAACAACCTCACCTAAC
CAGGAACTCAATGCTGGTCAACGAATTGGTACAGAGGAAGAGAGTGATGA
TTCTGTAGGCTATATTCCATTGATTTTCGGTTCATTCTTACTTGGTATAG
CGAAAGGATCTATTGTACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGC
AAGAATCAGAgGAGCTCATCTAATTCATTGCTGCTAAAAGCAAATGATGA
TAAACCCGACTCAGGGCGAATTGATCAGAATAGCTTAGATGGTGACACTA
TTCCTGAACCGCAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGAT
GGAGACACTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAA
TAGCTTCGATTGTGACACTATTCCTGAACCACAGTACAACGCTCAGCCTG
TGGAACAGAATAGCTTCGATGGAGACAGTAGTCCTGTATGGCAGAACAAC
GCTCAGCCTGTGGAACAGAATAGCTTTGATGGAGACACTAGTCCTGTATG
GCAGAACAACGCTTACCCTGAGGCACAGAATAGCTTAGATGGTGAAAATA
GTTTTGCACCCCAGAGCCAGAACAACAATCAACCTGAAGCACAGAATAGC
TTAGATGCTGAAAATCACCCTTTTGGTCCTGTAATACAATTTAAGAAACA
ACCTATAACAACAGAGAGTATGTTAGATGAGAACACTGATGAGACCAATG
ACCCTTTTGGTCCTGTTCTGCAAAATACGAAACAACCTATAACAACACGG
AATAGCTTAGATCAGGATAATGAAAAAACACTCGAGACTATCTCCATCTT
CAACAAATTGGCTTCTACTTCTTCCCGTAAATTTAAAAGGATGTAAATGG
CGATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTCATCTT
GCagGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGTGCTTG
TACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACGAATAT
GTAAAAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTCGCAGC
TGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTTACATTATCAAAATG
TAAACATGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTATACAGA
ACAAAGGTGTTATCTACATAAACGATTTAACAGATTCTGGAGTTATGGAA
TCATTCTCCGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATGACAGG
TTGTATGTATGGGAAATTTAAATGCTGGGCTCATACACAACCTCTTCTTC
CTCGTTACGAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGGTAAAG
GACATTTGTAGAAaacCGCTCGATGGGGACTGGTCACAATGGGGCCCTTG
GGATGTTTGTCGCAGACcatgtttccatggtgatcAATTTAGGAGAAGGA
CATGTACTAATCCAGCACCTCAGAAGGGTGGACGTGGTTGCCCAGAGTCT
AGTGGTCATCATCGGATGTGCAATCCAAACAGTTGTAAAGATTTAGATTT
ACATTCATCATGCAAAAGAGAACAAGGGGAGTGTCTTGATGAAAGCGGCC
GTGGACGCATTCAGACAATGGGTAAGAAGCTAAATCATGGAAAAGAGAAA
GATTGTCTCGAAAAATGTATGGACCAGCTCTACTACGGTTCAGGTTGTAC
TTTCATCAAAAGTACTGGTTATTGCTATACTCATACAAAAAGAGTGGCAG
GAGGAAATGGAGATGATGGAGCTTTTTGTTgggtatttaaaaaatgtaaa
aTTAATGGCAAATGGTCAAAATGGGGCGCATGGGGAGAGTGCAGTGTATC
ATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAACATGCAACAATCCCA
TACCTAATGCGGGTGGATTGGATTGTCCAAAATCTGATAATGACAGTCAA
ACTCGGAATTGCAAAACACGCNACAATCCCATACCTAATGCTGGTGGATT
GGATTGTCCAAAATCTGACAATGACAGTCAAACTCGGAATTGCAAAACAC
GCATTTGTCCAACTCATGGCAAATGGTCGGCATGGGGCTCATGGGGAAAG
TGCAGTGCATCATGTGGTGGTGGTAAGAAAACTAGAACAAGAACATGTAC
CAACCCTGCACCTCGGCATGGTGGAATGGATTGTGGAGACTCTATACCTC
ATATTTTGAATTGCAATTTAAAGTCCTGTCCTCCAACTCATGGCAAATGG
TCGGAATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGCTGGTCA
GAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGGCGGAA
GGGATTGTACAGACAttaaaaatgatattgaaaatcAGAAATGCAATACG
AACACATGTCCAAACAATAACGAAGTTGCTGAAAAAGTTTGTAAGATGCA
ATGTGTCCATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGGAGAAG
CCCAATTAGATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAACGAGT
CataCGACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaaaagcg
ATGTTTTCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGGAGATA
CCAAATTAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCACGACT
CatgGGACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaaaagcG
ATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGCGGGAT
ATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTCacAAA
GATAACGACAAAGTTGCtgaaaaagtttgtaaaaagCGATGTGTTCATTT
TAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAATACCAAATTTGACG
TTTCAAACCATTGTCCAAAAACTTGTGCCGCGACTCTTTGTGAACCTAAA
AAAGAAGCAATGGTTATGTGTCATGGACGGTCCTATACATTACATGGGAA
AGCAAAGAATGGTGCCAGCGCTAAACAATATGAATGGTACAAAAAGAGCA
AAAAGGATTCGCTATTACGATTGGATAGCGATTCTCAATACTCAATTACA
TACTCCGACCGTGATCCAACAAAAAGCAGTTTGACTATTCTTTCTTTCAG
TATGGTTAAACACGAAGGACTTTACGCTTTCAGAGAAGCTAATCTAAAAT
ACATCGATTGCTATGATTATAAAGTGAAAGGAGTTCTTCAAGTTGAATAT
ATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGAGAATATAACACT
TGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCTGGTCTGTTGATG
GACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCACATTATAACTTG
CCATCTACTGATGATTTTGGCCCTACTACACAAATGTTGGAGATTCTTAA
TCCTCAACGGAGACATGGTGGAATGTACAAGCTTAAATGGTCAACTGATT
TTGATCAATGCCCGATTGCCGATATTTTATTCAACGTTACTGTGAGAGAA
CGGAATATAACAGCATCCACTATGGACAATACGAACAACGGTGTAAATAC
AACAACCTCACCTAACCAGGAACTCAATGCTGGTCAACGAATTGGTACAG
AGGAAGAGAGTGATGATTCTGTAGGCTATATTCCATTGATTTTCGGTTCA
TTCTTACTTGGTATAGCGAAAGGATCTATTGTACTTTGGTTTCTTTATAA
AAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCATCTAATTCATTGCTGC
TAAAAGCAAATGATGATAAACCCGACTCAGGGCGAATTGATCAGAATAGC
TTAGATGGTGACACTATTCCTGAACCGCAGTACAACGCTCAGCCTGTGGA
ACAGAATAGCTTCGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTC
AGCCTGTGGAACAGAATAGCTTCGATTGTGACACTATTCCTGAACCACAG
TACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACAGTAGTCC
TGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTTGATGGAG
ACACTAGTCCTGTATGGCAGAACAACGCTTACCCTGAGGCACAGAATAGC
TTAGATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAACAACAATCAACC
TGAAGCACAGAATAGCTTAGATGCTGAAAATCACCCTTTTGGTCCTGTAA
TACAATTTAAGAAACAACCTATAACAACAGAGAGTATGTTAGATGAGAAC
ACTGATGAGACCAATGACCCTTTTGGTCCTGTTCTGCAAAATACGAAACA
ACCTATAACAACACGGAATAGCTTAGATCAGGATAATGAAAAAACACTCG
AGACTATCTCCATCTTCAACAAATTGGCTTCTACTTCTTCCCGTAAATTT
AAAAGGATGTAAATGGCGATGCGCTTCACCATTCTTTACAATGTTCTATT
CATTTTGCTTCATCTTGCagGTGCAACTGATGGGAGCTGGACGCAATGGG
GCTCATGGAGTGCTTGTACACCACAGTGCTATCAAACTAGAAAAAGAACG
TGTACTGCACGAATATGTAAAAACTATGATACCGACACTCAGTTTTGTAA
TGCTGCCGGTCGCAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTT
TTACATTATCAAAATGTAAACATGAAGAAGGACGCTGTTTAACGGGCCTG
CGCAGACGTATACAGAACAAAGGTGTTATCTACATAAACGATTTAACAGA
TTCTGGAGTTATGGAATCATTCTCCGACTGTTTTGAATTATGTCAAAGAA
TCCCTGGTATGACAGGTTGTATGTATGGGAAATTTAAATGCTGGGCTCAT
ACACAACCTCTTCTTCCTCGTTACGAAGAATCTTTTAAAGACCCATCTCA
TATTTGTTGGGTAAAGGACATTTGTAGAAaacCGCTCGATGGGGACTGGT
CACAATGGGGCCCTTGGGATGTTTGTCGCAGACcatgtttccatggtgat
cAATTTAGGAGAAGGACATGTACTAATCCAGCACCTCAGAAGGGTGGACG
TGGTTGCCCAGAGTCTAGTGGTCATCATCGGATGTGCAATCCAAACAGTT
GTAAAGATTTAGATTTACATTCATCATGCAAAAGAGAACAAGGGGAGTGT
CTTGATGAAAGCGGCCGTGGACGCATTCAGACAATGGGTAAGAAGCTAAA
TCATGGAAAAGAGAAAGATTGTCTCGAAAAATGTATGGACCAGCTCTACT
ACGGTTCAGGTTGTACTTTCATCAAAAGTACTGGTTATTGCTATACTCAT
ACAAAAAGAGTGGCAGGAGGAAATGGAGATGATGGAGCTTTTTGTTgggt
atttaaaaaatgtaaaaTTAATGGCAAATGGTCAAAATGGGGCGCATGGG
GAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGA
ACATGCAACAATCCCATACCTAATGCGGGTGGATTGGATTGTCCAAAATC
TGATAATGACAGTCAAACTCGGAATTGCAAAACACGCNACAATCCCATAC
CTAATGCTGGTGGATTGGATTGTCCAAAATCTGACAATGACAGTCAAACT
CGGAATTGCAAAACACGCATTTGTCCAACTCATGGCAAATGGTCGGCATG
GGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAAACTA
GAACAAGAACATGTACCAACCCTGCACCTCGGCATGGTGGAATGGATTGT
GGAGACTCTATACCTCATATTTTGAATTGCAATTTAAAGTCCTGTCCTCC
AACTCATGGCAAATGGTCGGAATGGGGCTCATGGGGAAAGTGCAGTGCAT
CATGTGGTGCTGGTCAGAAAACTAGAACAAGAACATGTACCAACCCTGCA
CCTCAGAATGGCGGAAGGGATTGTACAGACAttaaaaatgatattgaaaa
tcAGAAATGCAATACGAACACATGTCCAAACAATAACGAAGTTGCTGAAA
AAGTTTGTAAGATGCAATGTGTCCATTTGAAAGGGAAATGTGGTCAAATG
CTTAAATGTGGAGAAGCCCAATTAGATGTTTCAAACCTCTGCCCTAAAAC
ATGTGCTGCAACGAGTCataCGACCAAAGATAACAACGAAGTTgctgaaa
atttttgtaaaaagcgATGTTTTCATCTAATTGAGAATTGTGGTCAAATG
GTTAGGTGTGGAGATACCAAATTAGACGTTTCAAACCTTTGCCCTAAAAC
GTGCGCCACCACGACTCatgGGACCAAAGACAACAACGAACTTGCtgaaa
aaatttgtaaaaagcGATGTGATCAATTGGAACGCAATTGTGGTGAAATA
AAAAGATGTGCGGGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGA
AACCTGTGCTCacAAAGATAACGACAAAGTTGCtgaaaaagtttgtaaaa
agCGATGTGTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGA
AATACCAAATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCGAC
TCTTTGTGAACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACGGTCCT
ATACATTACATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAATATGAA
TGGTACAAAAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGCGATTC
TCAATACTCAATTACATACTCCGACCGTGATCCAACAAAAAGCAGTTTGA
CTATTCTTTCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTTTCAGA
GAAGCTAATCTAAAATACATCGATTGCTATGATTATAAAGTGAAAGGAGT
TCTTCAAGTTGAATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTG
GCGAGAATATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACA
AGCTGGTCTGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATC
TCCACATTATAACTTGCCATCTACTGATGATTTTGGCCCTACTACACAAA
TGTTGGAGATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAAGCTT
AAATGGTCAACTGATTTTGATCAATGCCCGATTGCCGATATTTTATTCAA
CGTTACTGTGAGAGAACGGAATATAACAGCATCCACTATGGACAATACGA
ACAACGGTGTAAATACAACAACCTCACCTAACCAGGAACTCAATGCTGGT
CAACGAATTGGTACAGAGGAAGAGAGTGATGATTCTGTAGGCTATATTCC
ATTGATTTTCGGTTCATTCTTACTTGGTATAGCGAAAGGATCTATTGTAC
TTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCA
TCTAATTCATTGCTGCTAAAAGCAAATGATGATAAACCCGACTCAGGGCG
AATTGATCAGAATAGCTTAGATGGTGACACTATTCCTGAACCGCAGTACA
ACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACACTAGTCCTGTA
TGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATTGTGACAC
TATTCCTGAACCACAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCG
ATGGAGACAGTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAG
AATAGCTTTGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTTACCC
TGAGGCACAGAATAGCTTAGATGGTGAAAATAGTTTTGCACCCCAGAGCC
AGAACAACAATCAACCTGAAGCACAGAATAGCTTAGATGCTGAAAATCAC
CCTTTTGGTCCTGTAATACAATTTAAGAAACAACCTATAACAACAGAGAG
TATGTTAGATGAGAACACTGATGAGACCAATGACCCTTTTGGTCCTGTTC
TGCAAAATACGAAACAACCTATAACAACACGGAATAGCTTAGATCAGGAT
AATGAAAAAACACTCGAGACTATCTCCATCTTCAACAAATTGGCTTCTAC
TTCTTCCCGTAAATTTAAAAGGATGTAAATGGCGATGCGCTTCACCATTC
TTTACAATGTTCTATTCATTTTGCTTCATCTTGCagGTGCAACTGATGGG
AGCTGGACGCAATGGGGCTCATGGAGTGCTTGTACACCACAGTGCTATCA
AACTAGAAAAAGAACGTGTACTGCACGAATATGTAAAAACTATGATACCG
ACACTCAGTTTTGTAATGCTGCCGGTCGCAGCTGCTCAAAATGGAAAGCA
GACGGTTCTGCCCCTTTTACATTATCAAAATGTAAACATGAAGAAGGACG
CTGTTTAACGGGCCTGCGCAGACGTATACAGAACAAAGGTGTTATCTACA
TAAACGATTTAACAGATTCTGGAGTTATGGAATCATTCTCCGACTGTTTT
GAATTATGTCAAAGAATCCCTGGTATGACAGGTTGTATGTATGGGAAATT
TAAATGCTGGGCTCATACACAACCTCTTCTTCCTCGTTACGAAGAATCTT
TTAAAGACCCATCTCATATTTGTTGGGTAAAGGACATTTGTAGAAaacCG
CTCGATGGGGACTGGTCACAATGGGGCCCTTGGGATGTTTGTCGCAGACc
atgtttccatggtgatcAATTTAGGAGAAGGACATGTACTAATCCAGCAC
CTCAGAAGGGTGGACGTGGTTGCCCAGAGTCTAGTGGTCATCATCGGATG
TGCAATCCAAACAGTTGTAAAGATTTAGATTTACATTCATCATGCAAAAG
AGAACAAGGGGAGTGTCTTGATGAAAGCGGCCGTGGACGCATTCAGACAA
TGGGTAAGAAGCTAAATCATGGAAAAGAGAAAGATTGTCTCGAAAAATGT
ATGGACCAGCTCTACTACGGTTCAGGTTGTACTTTCATCAAAAGTACTGG
TTATTGCTATACTCATACAAAAAGAGTGGCAGGAGGAAATGGAGATGATG
GAGCTTTTTGTTgggtatttaaaaaatgtaaaaTTAATGGCAAATGGTCA
AAATGGGGCGCATGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAA
GCAAACTAGAAGAAGAACATGCAACAATCCCATACCTAATGCGGGTGGAT
TGGATTGTCCAAAATCTGATAATGACAGTCAAACTCGGAATTGCAAAACA
CGCNACAATCCCATACCTAATGCTGGTGGATTGGATTGTCCAAAATCTGA
CAATGACAGTCAAACTCGGAATTGCAAAACACGCATTTGTCCAACTCATG
GCAAATGGTCGGCATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGT
GGTGGTAAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCGGCA
TGGTGGAATGGATTGTGGAGACTCTATACCTCATATTTTGAATTGCAATT
TAAAGTCCTGTCCTCCAACTCATGGCAAATGGTCGGAATGGGGCTCATGG
GGAAAGTGCAGTGCATCATGTGGTGCTGGTCAGAAAACTAGAACAAGAAC
ATGTACCAACCCTGCACCTCAGAATGGCGGAAGGGATTGTACAGACAtta
aaaatgatattgaaaatcAGAAATGCAATACGAACACATGTCCAAACAAT
AACGAAGTTGCTGAAAAAGTTTGTAAGATGCAATGTGTCCATTTGAAAGG
GAAATGTGGTCAAATGCTTAAATGTGGAGAAGCCCAATTAGATGTTTCAA
ACCTCTGCCCTAAAACATGTGCTGCAACGAGTCataCGACCAAAGATAAC
AACGAAGTTgctgaaaatttttgtaaaaagcgATGTTTTCATCTAATTGA
GAATTGTGGTCAAATGGTTAGGTGTGGAGATACCAAATTAGACGTTTCAA
ACCTTTGCCCTAAAACGTGCGCCACCACGACTCatgGGACCAAAGACAAC
AACGAACTTGCtgaaaaaatttgtaaaaagcGATGTGATCAATTGGAACG
CAATTGTGGTGAAATAAAAAGATGTGCGGGATATACAATGTTAGACGTTT
CAAACGTTTGCCCTGAAACCTGTGCTCacAAAGATAACGACAAAGTTGCt
gaaaaagtttgtaaaaagCGATGTGTTCATTTTAAAGGGAATTGTGGTCA
AATGGTTAAGTGTGGAAATACCAAATTTGACGTTTCAAACCATTGTCCAA
AAACTTGTGCCGCGACTCTTTGTGAACCTAAAAAAGAAGCAATGGTTATG
TGTCATGGACGGTCCTATACATTACATGGGAAAGCAAAGAATGGTGCCAG
CGCTAAACAATATGAATGGTACAAAAAGAGCAAAAAGGATTCGCTATTAC
GATTGGATAGCGATTCTCAATACTCAATTACATACTCCGACCGTGATCCA
ACAAAAAGCAGTTTGACTATTCTTTCTTTCAGTATGGTTAAACACGAAGG
ACTTTACGCTTTCAGAGAAGCTAATCTAAAATACATCGATTGCTATGATT
ATAAAGTGAAAGGAGTTCTTCAAGTTGAATATATTGATGGTAAAGATATG
TTTGATGTTGTGGCTGGCGAGAATATAACACTTGCAGTGAAAGCAAAAGA
CCCTGCATCTAAAACAAGCTGGTCTGTTGATGGACAAAGTTTGATAGAAC
CTTTAATTAAAGCATCTCCACATTATAACTTGCCATCTACTGATGATTTT
GGCCCTACTACACAAATGTTGGAGATTCTTAATCCTCAACGGAGACATGG
TGGAATGTACAAGCTTAAATGGTCAACTGATTTTGATCAATGCCCGATTG
CCGATATTTTATTCAACGTTACTGTGAGAGAACGGAATATAACAGCATCC
ACTATGGACAATACGAACAACGGTGTAAATACAACAACCTCACCTAACCA
GGAACTCAATGCTGGTCAACGAATTGGTACAGAGGAAGAGAGTGATGATT
CTGTAGGCTATATTCCATTGATTTTCGGTTCATTCTTACTTGGTATAGCG
AAAGGATCTATTGTACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAA
GAATCAGAgGAGCTCATCTAATTCATTGCTGCTAAAAGCAAATGATGATA
AACCCGACTCAGGGCGAATTGATCAGAATAGCTTAGATGGTGACACTATT
CCTGAACCGCAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGG
AGACACTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATA
GCTTCGATTGTGACACTATTCCTGAACCACAGTACAACGCTCAGCCTGTG
GAACAGAATAGCTTCGATGGAGACAGTAGTCCTGTATGGCAGAACAACGC
TCAGCCTGTGGAACAGAATAGCTTTGATGGAGACACTAGTCCTGTATGGC
AGAACAACGCTTACCCTGAGGCACAGAATAGCTTAGATGGTGAAAATAGT
TTTGCACCCCAGAGCCAGAACAACAATCAACCTGAAGCACAGAATAGCTT
AGATGCTGAAAATCACCCTTTTGGTCCTGTAATACAATTTAAGAAACAAC
CTATAACAACAGAGAGTATGTTAGATGAGAACACTGATGAGACCAATGAC
CCTTTTGGTCCTGTTCTGCAAAATACGAAACAACCTATAACAACACGGAA
TAGCTTAGATCAGGATAATGAAAAAACACTCGAGACTATCTCCATCTTCA
ACAAATTGGCTTCTACTTCTTCCCGTAAATTTAAAAGGATGTAAATGGCG
ATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTCATCTTGC
agGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGTGCTTGTA
CACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACGAATATGT
AAAAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTCGCAGCTG
CTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTTACATTATCAAAATGTA
AACATGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTATACAGAAC
AAAGGTGTTATCTACATAAACGATTTAACAGATTCTGGAGTTATGGAATC
ATTCTCCGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATGACAGGTT
GTATGTATGGGAAATTTAAATGCTGGGCTCATACACAACCTCTTCTTCCT
CGTTACGAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGGTAAAGGA
CATTTGTAGAAaacCGCTCGATGGGGACTGGTCACAATGGGGCCCTTGGG
ATGTTTGTCGCAGACcatgtttccatggtgatcAATTTAGGAGAAGGACA
TGTACTAATCCAGCACCTCAGAAGGGTGGACGTGGTTGCCCAGAGTCTAG
TGGTCATCATCGGATGTGCAATCCAAACAGTTGTAAAGATTTAGATTTAC
ATTCATCATGCAAAAGAGAACAAGGGGAGTGTCTTGATGAAAGCGGCCGT
GGACGCATTCAGACAATGGGTAAGAAGCTAAATCATGGAAAAGAGAAAGA
TTGTCTCGAAAAATGTATGGACCAGCTCTACTACGGTTCAGGTTGTACTT
TCATCAAAAGTACTGGTTATTGCTATACTCATACAAAAAGAGTGGCAGGA
GGAAATGGAGATGATGGAGCTTTTTGTTgggtatttaaaaaatgtaaaaT
TAATGGCAAATGGTCAAAATGGGGCGCATGGGGAGAGTGCAGTGTATCAT
GTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAACATGCAACAATCCCATA
CCTAATGCGGGTGGATTGGATTGTCCAAAATCTGATAATGACAGTCAAAC
TCGGAATTGCAAAACACGCNACAATCCCATACCTAATGCTGGTGGATTGG
ATTGTCCAAAATCTGACAATGACAGTCAAACTCGGAATTGCAAAACACGC
ATTTGTCCAACTCATGGCAAATGGTCGGCATGGGGCTCATGGGGAAAGTG
CAGTGCATCATGTGGTGGTGGTAAGAAAACTAGAACAAGAACATGTACCA
ACCCTGCACCTCGGCATGGTGGAATGGATTGTGGAGACTCTATACCTCAT
ATTTTGAATTGCAATTTAAAGTCCTGTCCTCCAACTCATGGCAAATGGTC
GGAATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGCTGGTCAGA
AAACTAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGGCGGAAGG
GATTGTACAGACAttaaaaatgatattgaaaatcAGAAATGCAATACGAA
CACATGTCCAAACAATAACGAAGTTGCTGAAAAAGTTTGTAAGATGCAAT
GTGTCCATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGGAGAAGCC
CAATTAGATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAACGAGTCa
taCGACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaaaagcgAT
GTTTTCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGGAGATACC
AAATTAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCACGACTCa
tgGGACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaaaagcGAT
GTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGCGGGATAT
ACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTCacAAAGA
TAACGACAAAGTTGCtgaaaaagtttgtaaaaagCGATGTGTTCATTTTA
AAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAATACCAAATTTGACGTT
TCAAACCATTGTCCAAAAACTTGTGCCGCGACTCTTTGTGAACCTAAAAA
AGAAGCAATGGTTATGTGTCATGGACGGTCCTATACATTACATGGGAAAG
CAAAGAATGGTGCCAGCGCTAAACAATATGAATGGTACAAAAAGAGCAAA
AAGGATTCGCTATTACGATTGGATAGCGATTCTCAATACTCAATTACATA
CTCCGACCGTGATCCAACAAAAAGCAGTTTGACTATTCTTTCTTTCAGTA
TGGTTAAACACGAAGGACTTTACGCTTTCAGAGAAGCTAATCTAAAATAC
ATCGATTGCTATGATTATAAAGTGAAAGGAGTTCTTCAAGTTGAATATAT
TGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGAGAATATAACACTTG
CAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCTGGTCTGTTGATGGA
CAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCACATTATAACTTGCC
ATCTACTGATGATTTTGGCCCTACTACACAAATGTTGGAGATTCTTAATC
CTCAACGGAGACATGGTGGAATGTACAAGCTTAAATGGTCAACTGATTTT
GATCAATGCCCGATTGCCGATATTTTATTCAACGTTACTGTGAGAGAACG
GAATATAACAGCATCCACTATGGACAATACGAACAACGGTGTAAATACAA
CAACCTCACCTAACCAGGAACTCAATGCTGGTCAACGAATTGGTACAGAG
GAAGAGAGTGATGATTCTGTAGGCTATATTCCATTGATTTTCGGTTCATT
CTTACTTGGTATAGCGAAAGGATCTATTGTACTTTGGTTTCTTTATAAAA
GAGGATTAGCTCGCAAGAATCAGAgGAGCTCATCTAATTCATTGCTGCTA
AAAGCAAATGATGATAAACCCGACTCAGGGCGAATTGATCAGAATAGCTT
AGATGGTGACACTATTCCTGAACCGCAGTACAACGCTCAGCCTGTGGAAC
AGAATAGCTTCGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTCAG
CCTGTGGAACAGAATAGCTTCGATTGTGACACTATTCCTGAACCACAGTA
CAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACAGTAGTCCTG
TATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTTGATGGAGAC
ACTAGTCCTGTATGGCAGAACAACGCTTACCCTGAGGCACAGAATAGCTT
AGATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAACAACAATCAACCTG
AAGCACAGAATAGCTTAGATGCTGAAAATCACCCTTTTGGTCCTGTAATA
CAATTTAAGAAACAACCTATAACAACAGAGAGTATGTTAGATGAGAACAC
TGATGAGACCAATGACCCTTTTGGTCCTGTTCTGCAAAATACGAAACAAC
CTATAACAACACGGAATAGCTTAGATCAGGATAATGAAAAAACACTCGAG
ACTATCTCCATCTTCAACAAATTGGCTTCTACTTCTTCCCGTAAATTTAA
AAGGATGTAAATGGCGATGCGCTTCACCATTCTTTACAATGTTCTATTCA
TTTTGCTTCATCTTGCagGTGCAACTGATGGGAGCTGGACGCAATGGGGC
TCATGGAGTGCTTGTACACCACAGTGCTATCAAACTAGAAAAAGAACGTG
TACTGCACGAATATGTAAAAACTATGATACCGACACTCAGTTTTGTAATG
CTGCCGGTCGCAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTT
ACATTATCAAAATGTAAACATGAAGAAGGACGCTGTTTAACGGGCCTGCG
CAGACGTATACAGAACAAAGGTGTTATCTACATAAACGATTTAACAGATT
CTGGAGTTATGGAATCATTCTCCGACTGTTTTGAATTATGTCAAAGAATC
CCTGGTATGACAGGTTGTATGTATGGGAAATTTAAATGCTGGGCTCATAC
ACAACCTCTTCTTCCTCGTTACGAAGAATCTTTTAAAGACCCATCTCATA
TTTGTTGGGTAAAGGACATTTGTAGAAaacCGCTCGATGGGGACTGGTCA
CAATGGGGCCCTTGGGATGTTTGTCGCAGACcatgtttccatggtgatcA
ATTTAGGAGAAGGACATGTACTAATCCAGCACCTCAGAAGGGTGGACGTG
GTTGCCCAGAGTCTAGTGGTCATCATCGGATGTGCAATCCAAACAGTTGT
AAAGATTTAGATTTACATTCATCATGCAAAAGAGAACAAGGGGAGTGTCT
TGATGAAAGCGGCCGTGGACGCATTCAGACAATGGGTAAGAAGCTAAATC
ATGGAAAAGAGAAAGATTGTCTCGAAAAATGTATGGACCAGCTCTACTAC
GGTTCAGGTTGTACTTTCATCAAAAGTACTGGTTATTGCTATACTCATAC
AAAAAGAGTGGCAGGAGGAAATGGAGATGATGGAGCTTTTTGTTgggtat
ttaaaaaatgtaaaaTTAATGGCAAATGGTCAAAATGGGGCGCATGGGGA
GAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAAC
ATGCAACAATCCCATACCTAATGCGGGTGGATTGGATTGTCCAAAATCTG
ATAATGACAGTCAAACTCGGAATTGCAAAACACGCNACAATCCCATACCT
AATGCTGGTGGATTGGATTGTCCAAAATCTGACAATGACAGTCAAACTCG
GAATTGCAAAACACGCATTTGTCCAACTCATGGCAAATGGTCGGCATGGG
GCTCATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAAACTAGA
ACAAGAACATGTACCAACCCTGCACCTCGGCATGGTGGAATGGATTGTGG
AGACTCTATACCTCATATTTTGAATTGCAATTTAAAGTCCTGTCCTCCAA
CTCATGGCAAATGGTCGGAATGGGGCTCATGGGGAAAGTGCAGTGCATCA
TGTGGTGCTGGTCAGAAAACTAGAACAAGAACATGTACCAACCCTGCACC
TCAGAATGGCGGAAGGGATTGTACAGACAttaaaaatgatattgaaaatc
AGAAATGCAATACGAACACATGTCCAAACAATAACGAAGTTGCTGAAAAA
GTTTGTAAGATGCAATGTGTCCATTTGAAAGGGAAATGTGGTCAAATGCT
TAAATGTGGAGAAGCCCAATTAGATGTTTCAAACCTCTGCCCTAAAACAT
GTGCTGCAACGAGTCataCGACCAAAGATAACAACGAAGTTgctgaaaat
ttttgtaaaaagcgATGTTTTCATCTAATTGAGAATTGTGGTCAAATGGT
TAGGTGTGGAGATACCAAATTAGACGTTTCAAACCTTTGCCCTAAAACGT
GCGCCACCACGACTCatgGGACCAAAGACAACAACGAACTTGCtgaaaaa
atttgtaaaaagcGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAA
AAGATGTGCGGGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAA
CCTGTGCTCacAAAGATAACGACAAAGTTGCtgaaaaagtttgtaaaaag
CGATGTGTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAA
TACCAAATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCGACTC
TTTGTGAACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACGGTCCTAT
ACATTACATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAATATGAATG
GTACAAAAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGCGATTCTC
AATACTCAATTACATACTCCGACCGTGATCCAACAAAAAGCAGTTTGACT
ATTCTTTCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTTTCAGAGA
AGCTAATCTAAAATACATCGATTGCTATGATTATAAAGTGAAAGGAGTTC
TTCAAGTTGAATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGC
GAGAATATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAG
CTGGTCTGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTC
CACATTATAACTTGCCATCTACTGATGATTTTGGCCCTACTACACAAATG
TTGGAGATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAAGCTTAA
ATGGTCAACTGATTTTGATCAATGCCCGATTGCCGATATTTTATTCAACG
TTACTGTGAGAGAACGGAATATAACAGCATCCACTATGGACAATACGAAC
AACGGTGTAAATACAACAACCTCACCTAACCAGGAACTCAATGCTGGTCA
ACGAATTGGTACAGAGGAAGAGAGTGATGATTCTGTAGGCTATATTCCAT
TGATTTTCGGTTCATTCTTACTTGGTATAGCGAAAGGATCTATTGTACTT
TGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCATC
TAATTCATTGCTGCTAAAAGCAAATGATGATAAACCCGACTCAGGGCGAA
TTGATCAGAATAGCTTAGATGGTGACACTATTCCTGAACCGCAGTACAAC
GCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACACTAGTCCTGTATG
GCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATTGTGACACTA
TTCCTGAACCACAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGAT
GGAGACAGTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAA
TAGCTTTGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTTACCCTG
AGGCACAGAATAGCTTAGATGGTGAAAATAGTTTTGCACCCCAGAGCCAG
AACAACAATCAACCTGAAGCACAGAATAGCTTAGATGCTGAAAATCACCC
TTTTGGTCCTGTAATACAATTTAAGAAACAACCTATAACAACAGAGAGTA
TGTTAGATGAGAACACTGATGAGACCAATGACCCTTTTGGTCCTGTTCTG
CAAAATACGAAACAACCTATAACAACACGGAATAGCTTAGATCAGGATAA
TGAAAAAACACTCGAGACTATCTCCATCTTCAACAAATTGGCTTCTACTT
CTTCCCGTAAATTTAAAAGGATGTAAATGGCGATGCGCTTCACCATTCTT
TACAATGTTCTATTCATTTTGCTTCATCTTGCagGTGCAACTGATGGGAG
CTGGACGCAATGGGGCTCATGGAGTGCTTGTACACCACAGTGCTATCAAA
CTAGAAAAAGAACGTGTACTGCACGAATATGTAAAAACTATGATACCGAC
ACTCAGTTTTGTAATGCTGCCGGTCGCAGCTGCTCAAAATGGAAAGCAGA
CGGTTCTGCCCCTTTTACATTATCAAAATGTAAACATGAAGAAGGACGCT
GTTTAACGGGCCTGCGCAGACGTATACAGAACAAAGGTGTTATCTACATA
AACGATTTAACAGATTCTGGAGTTATGGAATCATTCTCCGACTGTTTTGA
ATTATGTCAAAGAATCCCTGGTATGACAGGTTGTATGTATGGGAAATTTA
AATGCTGGGCTCATACACAACCTCTTCTTCCTCGTTACGAAGAATCTTTT
AAAGACCCATCTCATATTTGTTGGGTAAAGGACATTTGTAGAAaacCGCT
CGATGGGGACTGGTCACAATGGGGCCCTTGGGATGTTTGTCGCAGACcat
gtttccatggtgatcAATTTAGGAGAAGGACATGTACTAATCCAGCACCT
CAGAAGGGTGGACGTGGTTGCCCAGAGTCTAGTGGTCATCATCGGATGTG
CAATCCAAACAGTTGTAAAGATTTAGATTTACATTCATCATGCAAAAGAG
AACAAGGGGAGTGTCTTGATGAAAGCGGCCGTGGACGCATTCAGACAATG
GGTAAGAAGCTAAATCATGGAAAAGAGAAAGATTGTCTCGAAAAATGTAT
GGACCAGCTCTACTACGGTTCAGGTTGTACTTTCATCAAAAGTACTGGTT
ATTGCTATACTCATACAAAAAGAGTGGCAGGAGGAAATGGAGATGATGGA
GCTTTTTGTTgggtatttaaaaaatgtaaaaTTAATGGCAAATGGTCAAA
ATGGGGCGCATGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGC
AAACTAGAAGAAGAACATGCAACAATCCCATACCTAATGCGGGTGGATTG
GATTGTCCAAAATCTGATAATGACAGTCAAACTCGGAATTGCAAAACACG
CNACAATCCCATACCTAATGCTGGTGGATTGGATTGTCCAAAATCTGACA
ATGACAGTCAAACTCGGAATTGCAAAACACGCATTTGTCCAACTCATGGC
AAATGGTCGGCATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGG
TGGTAAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCGGCATG
GTGGAATGGATTGTGGAGACTCTATACCTCATATTTTGAATTGCAATTTA
AAGTCCTGTCCTCCAACTCATGGCAAATGGTCGGAATGGGGCTCATGGGG
AAAGTGCAGTGCATCATGTGGTGCTGGTCAGAAAACTAGAACAAGAACAT
GTACCAACCCTGCACCTCAGAATGGCGGAAGGGATTGTACAGACAttaaa
aatgatattgaaaatcAGAAATGCAATACGAACACATGTCCAAACAATAA
CGAAGTTGCTGAAAAAGTTTGTAAGATGCAATGTGTCCATTTGAAAGGGA
AATGTGGTCAAATGCTTAAATGTGGAGAAGCCCAATTAGATGTTTCAAAC
CTCTGCCCTAAAACATGTGCTGCAACGAGTCataCGACCAAAGATAACAA
CGAAGTTgctgaaaatttttgtaaaaagcgATGTTTTCATCTAATTGAGA
ATTGTGGTCAAATGGTTAGGTGTGGAGATACCAAATTAGACGTTTCAAAC
CTTTGCCCTAAAACGTGCGCCACCACGACTCatgGGACCAAAGACAACAA
CGAACTTGCtgaaaaaatttgtaaaaagcGATGTGATCAATTGGAACGCA
ATTGTGGTGAAATAAAAAGATGTGCGGGATATACAATGTTAGACGTTTCA
AACGTTTGCCCTGAAACCTGTGCTCacAAAGATAACGACAAAGTTGCtga
aaaagtttgtaaaaagCGATGTGTTCATTTTAAAGGGAATTGTGGTCAAA
TGGTTAAGTGTGGAAATACCAAATTTGACGTTTCAAACCATTGTCCAAAA
ACTTGTGCCGCGACTCTTTGTGAACCTAAAAAAGAAGCAATGGTTATGTG
TCATGGACGGTCCTATACATTACATGGGAAAGCAAAGAATGGTGCCAGCG
CTAAACAATATGAATGGTACAAAAAGAGCAAAAAGGATTCGCTATTACGA
TTGGATAGCGATTCTCAATACTCAATTACATACTCCGACCGTGATCCAAC
AAAAAGCAGTTTGACTATTCTTTCTTTCAGTATGGTTAAACACGAAGGAC
TTTACGCTTTCAGAGAAGCTAATCTAAAATACATCGATTGCTATGATTAT
AAAGTGAAAGGAGTTCTTCAAGTTGAATATATTGATGGTAAAGATATGTT
TGATGTTGTGGCTGGCGAGAATATAACACTTGCAGTGAAAGCAAAAGACC
CTGCATCTAAAACAAGCTGGTCTGTTGATGGACAAAGTTTGATAGAACCT
TTAATTAAAGCATCTCCACATTATAACTTGCCATCTACTGATGATTTTGG
CCCTACTACACAAATGTTGGAGATTCTTAATCCTCAACGGAGACATGGTG
GAATGTACAAGCTTAAATGGTCAACTGATTTTGATCAATGCCCGATTGCC
GATATTTTATTCAACGTTACTGTGAGAGAACGGAATATAACAGCATCCAC
TATGGACAATACGAACAACGGTGTAAATACAACAACCTCACCTAACCAGG
AACTCAATGCTGGTCAACGAATTGGTACAGAGGAAGAGAGTGATGATTCT
GTAGGCTATATTCCATTGATTTTCGGTTCATTCTTACTTGGTATAGCGAA
AGGATCTATTGTACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGA
ATCAGAgGAGCTCATCTAATTCATTGCTGCTAAAAGCAAATGATGATAAA
CCCGACTCAGGGCGAATTGATCAGAATAGCTTAGATGGTGACACTATTCC
TGAACCGCAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAG
ACACTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGC
TTCGATTGTGACACTATTCCTGAACCACAGTACAACGCTCAGCCTGTGGA
ACAGAATAGCTTCGATGGAGACAGTAGTCCTGTATGGCAGAACAACGCTC
AGCCTGTGGAACAGAATAGCTTTGATGGAGACACTAGTCCTGTATGGCAG
AACAACGCTTACCCTGAGGCACAGAATAGCTTAGATGGTGAAAATAGTTT
TGCACCCCAGAGCCAGAACAACAATCAACCTGAAGCACAGAATAGCTTAG
ATGCTGAAAATCACCCTTTTGGTCCTGTAATACAATTTAAGAAACAACCT
ATAACAACAGAGAGTATGTTAGATGAGAACACTGATGAGACCAATGACCC
TTTTGGTCCTGTTCTGCAAAATACGAAACAACCTATAACAACACGGAATA
GCTTAGATCAGGATAATGAAAAAACACTCGAGACTATCTCCATCTTCAAC
AAATTGGCTTCTACTTCTTCCCGTAAATTTAAAAGGATGTAAATGGCGAT
GCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTCATCTTGCag
GTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGTGCTTGTACA
CCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACGAATATGTAA
AAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTCGCAGCTGCT
CAAAATGGAAAGCAGACGGTTCTGCCCCTTTTACATTATCAAAATGTAAA
CATGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTATACAGAACAA
AGGTGTTATCTACATAAACGATTTAACAGATTCTGGAGTTATGGAATCAT
TCTCCGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATGACAGGTTGT
ATGTATGGGAAATTTAAATGCTGGGCTCATACACAACCTCTTCTTCCTCG
TTACGAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGGTAAAGGACA
TTTGTAGAAaacCGCTCGATGGGGACTGGTCACAATGGGGCCCTTGGGAT
GTTTGTCGCAGACcatgtttccatggtgatcAATTTAGGAGAAGGACATG
TACTAATCCAGCACCTCAGAAGGGTGGACGTGGTTGCCCAGAGTCTAGTG
GTCATCATCGGATGTGCAATCCAAACAGTTGTAAAGATTTAGATTTACAT
TCATCATGCAAAAGAGAACAAGGGGAGTGTCTTGATGAAAGCGGCCGTGG
ACGCATTCAGACAATGGGTAAGAAGCTAAATCATGGAAAAGAGAAAGATT
GTCTCGAAAAATGTATGGACCAGCTCTACTACGGTTCAGGTTGTACTTTC
ATCAAAAGTACTGGTTATTGCTATACTCATACAAAAAGAGTGGCAGGAGG
AAATGGAGATGATGGAGCTTTTTGTTgggtatttaaaaaatgtaaaaTTA
ATGGCAAATGGTCAAAATGGGGCGCATGGGGAGAGTGCAGTGTATCATGT
GGCCCTGGTGGTAAGCAAACTAGAAGAAGAACATGCAACAATCCCATACC
TAATGCGGGTGGATTGGATTGTCCAAAATCTGATAATGACAGTCAAACTC
GGAATTGCAAAACACGCNACAATCCCATACCTAATGCTGGTGGATTGGAT
TGTCCAAAATCTGACAATGACAGTCAAACTCGGAATTGCAAAACACGCAT
TTGTCCAACTCATGGCAAATGGTCGGCATGGGGCTCATGGGGAAAGTGCA
GTGCATCATGTGGTGGTGGTAAGAAAACTAGAACAAGAACATGTACCAAC
CCTGCACCTCGGCATGGTGGAATGGATTGTGGAGACTCTATACCTCATAT
TTTGAATTGCAATTTAAAGTCCTGTCCTCCAACTCATGGCAAATGGTCGG
AATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGCTGGTCAGAAA
ACTAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGGCGGAAGGGA
TTGTACAGACAttaaaaatgatattgaaaatcAGAAATGCAATACGAACA
CATGTCCAAACAATAACGAAGTTGCTGAAAAAGTTTGTAAGATGCAATGT
GTCCATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGGAGAAGCCCA
ATTAGATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAACGAGTCata
CGACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaaaagcgATGT
TTTCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGGAGATACCAA
ATTAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCACGACTCatg
GGACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaaaagcGATGT
GATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGCGGGATATAC
AATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTCacAAAGATA
ACGACAAAGTTGCtgaaaaagtttgtaaaaagCGATGTGTTCATTTTAAA
GGGAATTGTGGTCAAATGGTTAAGTGTGGAAATACCAAATTTGACGTTTC
AAACCATTGTCCAAAAACTTGTGCCGCGACTCTTTGTGAACCTAAAAAAG
AAGCAATGGTTATGTGTCATGGACGGTCCTATACATTACATGGGAAAGCA
AAGAATGGTGCCAGCGCTAAACAATATGAATGGTACAAAAAGAGCAAAAA
GGATTCGCTATTACGATTGGATAGCGATTCTCAATACTCAATTACATACT
CCGACCGTGATCCAACAAAAAGCAGTTTGACTATTCTTTCTTTCAGTATG
GTTAAACACGAAGGACTTTACGCTTTCAGAGAAGCTAATCTAAAATACAT
CGATTGCTATGATTATAAAGTGAAAGGAGTTCTTCAAGTTGAATATATTG
ATGGTAAAGATATGTTTGATGTTGTGGCTGGCGAGAATATAACACTTGCA
GTGAAAGCAAAAGACCCTGCATCTAAAACAAGCTGGTCTGTTGATGGACA
AAGTTTGATAGAACCTTTAATTAAAGCATCTCCACATTATAACTTGCCAT
CTACTGATGATTTTGGCCCTACTACACAAATGTTGGAGATTCTTAATCCT
CAACGGAGACATGGTGGAATGTACAAGCTTAAATGGTCAACTGATTTTGA
TCAATGCCCGATTGCCGATATTTTATTCAACGTTACTGTGAGAGAACGGA
ATATAACAGCATCCACTATGGACAATACGAACAACGGTGTAAATACAACA
ACCTCACCTAACCAGGAACTCAATGCTGGTCAACGAATTGGTACAGAGGA
AGAGAGTGATGATTCTGTAGGCTATATTCCATTGATTTTCGGTTCATTCT
TACTTGGTATAGCGAAAGGATCTATTGTACTTTGGTTTCTTTATAAAAGA
GGATTAGCTCGCAAGAATCAGAgGAGCTCATCTAATTCATTGCTGCTAAA
AGCAAATGATGATAAACCCGACTCAGGGCGAATTGATCAGAATAGCTTAG
ATGGTGACACTATTCCTGAACCGCAGTACAACGCTCAGCCTGTGGAACAG
AATAGCTTCGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTCAGCC
TGTGGAACAGAATAGCTTCGATTGTGACACTATTCCTGAACCACAGTACA
ACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACAGTAGTCCTGTA
TGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTTGATGGAGACAC
TAGTCCTGTATGGCAGAACAACGCTTACCCTGAGGCACAGAATAGCTTAG
ATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAACAACAATCAACCTGAA
GCACAGAATAGCTTAGATGCTGAAAATCACCCTTTTGGTCCTGTAATACA
ATTTAAGAAACAACCTATAACAACAGAGAGTATGTTAGATGAGAACACTG
ATGAGACCAATGACCCTTTTGGTCCTGTTCTGCAAAATACGAAACAACCT
ATAACAACACGGAATAGCTTAGATCAGGATAATGAAAAAACACTCGAGAC
TATCTCCATCTTCAACAAATTGGCTTCTACTTCTTCCCGTAAATTTAAAA
GGATGTAAATGGCGATGCGCTTCACCATTCTTTACAATGTTCTATTCATT
TTGCTTCATCTTGCagGTGCAACTGATGGGAGCTGGACGCAATGGGGCTC
ATGGAGTGCTTGTACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTA
CTGCACGAATATGTAAAAACTATGATACCGACACTCAGTTTTGTAATGCT
GCCGGTCGCAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTTAC
ATTATCAAAATGTAAACATGAAGAAGGACGCTGTTTAACGGGCCTGCGCA
GACGTATACAGAACAAAGGTGTTATCTACATAAACGATTTAACAGATTCT
GGAGTTATGGAATCATTCTCCGACTGTTTTGAATTATGTCAAAGAATCCC
TGGTATGACAGGTTGTATGTATGGGAAATTTAAATGCTGGGCTCATACAC
AACCTCTTCTTCCTCGTTACGAAGAATCTTTTAAAGACCCATCTCATATT
TGTTGGGTAAAGGACATTTGTAGAAaacCGCTCGATGGGGACTGGTCACA
ATGGGGCCCTTGGGATGTTTGTCGCAGACcatgtttccatggtgatcAAT
TTAGGAGAAGGACATGTACTAATCCAGCACCTCAGAAGGGTGGACGTGGT
TGCCCAGAGTCTAGTGGTCATCATCGGATGTGCAATCCAAACAGTTGTAA
AGATTTAGATTTACATTCATCATGCAAAAGAGAACAAGGGGAGTGTCTTG
ATGAAAGCGGCCGTGGACGCATTCAGACAATGGGTAAGAAGCTAAATCAT
GGAAAAGAGAAAGATTGTCTCGAAAAATGTATGGACCAGCTCTACTACGG
TTCAGGTTGTACTTTCATCAAAAGTACTGGTTATTGCTATACTCATACAA
AAAGAGTGGCAGGAGGAAATGGAGATGATGGAGCTTTTTGTTgggtattt
aaaaaatgtaaaaTTAATGGCAAATGGTCAAAATGGGGCGCATGGGGAGA
GTGCAGTGTATCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAACAT
GCAACAATCCCATACCTAATGCGGGTGGATTGGATTGTCCAAAATCTGAT
AATGACAGTCAAACTCGGAATTGCAAAACACGCNACAATCCCATACCTAA
TGCTGGTGGATTGGATTGTCCAAAATCTGACAATGACAGTCAAACTCGGA
ATTGCAAAACACGCATTTGTCCAACTCATGGCAAATGGTCGGCATGGGGC
TCATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAAACTAGAAC
AAGAACATGTACCAACCCTGCACCTCGGCATGGTGGAATGGATTGTGGAG
ACTCTATACCTCATATTTTGAATTGCAATTTAAAGTCCTGTCCTCCAACT
CATGGCAAATGGTCGGAATGGGGCTCATGGGGAAAGTGCAGTGCATCATG
TGGTGCTGGTCAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTC
AGAATGGCGGAAGGGATTGTACAGACAttaaaaatgatattgaaaatcAG
AAATGCAATACGAACACATGTCCAAACAATAACGAAGTTGCTGAAAAAGT
TTGTAAGATGCAATGTGTCCATTTGAAAGGGAAATGTGGTCAAATGCTTA
AATGTGGAGAAGCCCAATTAGATGTTTCAAACCTCTGCCCTAAAACATGT
GCTGCAACGAGTCataCGACCAAAGATAACAACGAAGTTgctgaaaattt
ttgtaaaaagcgATGTTTTCATCTAATTGAGAATTGTGGTCAAATGGTTA
GGTGTGGAGATACCAAATTAGACGTTTCAAACCTTTGCCCTAAAACGTGC
GCCACCACGACTCatgGGACCAAAGACAACAACGAACTTGCtgaaaaaat
ttgtaaaaagcGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAA
GATGTGCGGGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACC
TGTGCTCacAAAGATAACGACAAAGTTGCtgaaaaagtttgtaaaaagCG
ATGTGTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAATA
CCAAATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCGACTCTT
TGTGAACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACGGTCCTATAC
ATTACATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAATATGAATGGT
ACAAAAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGCGATTCTCAA
TACTCAATTACATACTCCGACCGTGATCCAACAAAAAGCAGTTTGACTAT
TCTTTCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTTTCAGAGAAG
CTAATCTAAAATACATCGATTGCTATGATTATAAAGTGAAAGGAGTTCTT
CAAGTTGAATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGA
GAATATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCT
GGTCTGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCA
CATTATAACTTGCCATCTACTGATGATTTTGGCCCTACTACACAAATGTT
GGAGATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAAGCTTAAAT
GGTCAACTGATTTTGATCAATGCCCGATTGCCGATATTTTATTCAACGTT
ACTGTGAGAGAACGGAATATAACAGCATCCACTATGGACAATACGAACAA
CGGTGTAAATACAACAACCTCACCTAACCAGGAACTCAATGCTGGTCAAC
GAATTGGTACAGAGGAAGAGAGTGATGATTCTGTAGGCTATATTCCATTG
ATTTTCGGTTCATTCTTACTTGGTATAGCGAAAGGATCTATTGTACTTTG
GTTTCTTTATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCATCTA
ATTCATTGCTGCTAAAAGCAAATGATGATAAACCCGACTCAGGGCGAATT
GATCAGAATAGCTTAGATGGTGACACTATTCCTGAACCGCAGTACAACGC
TCAGCCTGTGGAACAGAATAGCTTCGATGGAGACACTAGTCCTGTATGGC
AGAACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATTGTGACACTATT
CCTGAACCACAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGG
AGACAGTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATA
GCTTTGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTTACCCTGAG
GCACAGAATAGCTTAGATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAA
CAACAATCAACCTGAAGCACAGAATAGCTTAGATGCTGAAAATCACCCTT
TTGGTCCTGTAATACAATTTAAGAAACAACCTATAACAACAGAGAGTATG
TTAGATGAGAACACTGATGAGACCAATGACCCTTTTGGTCCTGTTCTGCA
AAATACGAAACAACCTATAACAACACGGAATAGCTTAGATCAGGATAATG
AAAAAACACTCGAGACTATCTCCATCTTCAACAAATTGGCTTCTACTTCT
TCCCGTAAATTTAAAAGGATGTAAATGGCGATGCGCTTCACCATTCTTTA
CAATGTTCTATTCATTTTGCTTCATCTTGCagGTGCAACTGATGGGAGCT
GGACGCAATGGGGCTCATGGAGTGCTTGTACACCACAGTGCTATCAAACT
AGAAAAAGAACGTGTACTGCACGAATATGTAAAAACTATGATACCGACAC
TCAGTTTTGTAATGCTGCCGGTCGCAGCTGCTCAAAATGGAAAGCAGACG
GTTCTGCCCCTTTTACATTATCAAAATGTAAACATGAAGAAGGACGCTGT
TTAACGGGCCTGCGCAGACGTATACAGAACAAAGGTGTTATCTACATAAA
CGATTTAACAGATTCTGGAGTTATGGAATCATTCTCCGACTGTTTTGAAT
TATGTCAAAGAATCCCTGGTATGACAGGTTGTATGTATGGGAAATTTAAA
TGCTGGGCTCATACACAACCTCTTCTTCCTCGTTACGAAGAATCTTTTAA
AGACCCATCTCATATTTGTTGGGTAAAGGACATTTGTAGAAaacCGCTCG
ATGGGGACTGGTCACAATGGGGCCCTTGGGATGTTTGTCGCAGACcatgt
ttccatggtgatcAATTTAGGAGAAGGACATGTACTAATCCAGCACCTCA
GAAGGGTGGACGTGGTTGCCCAGAGTCTAGTGGTCATCATCGGATGTGCA
ATCCAAACAGTTGTAAAGATTTAGATTTACATTCATCATGCAAAAGAGAA
CAAGGGGAGTGTCTTGATGAAAGCGGCCGTGGACGCATTCAGACAATGGG
TAAGAAGCTAAATCATGGAAAAGAGAAAGATTGTCTCGAAAAATGTATGG
ACCAGCTCTACTACGGTTCAGGTTGTACTTTCATCAAAAGTACTGGTTAT
TGCTATACTCATACAAAAAGAGTGGCAGGAGGAAATGGAGATGATGGAGC
TTTTTGTTgggtatttaaaaaatgtaaaaTTAATGGCAAATGGTCAAAAT
GGGGCGCATGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGCAA
ACTAGAAGAAGAACATGCAACAATCCCATACCTAATGCGGGTGGATTGGA
TTGTCCAAAATCTGATAATGACAGTCAAACTCGGAATTGCAAAACACGCN
ACAATCCCATACCTAATGCTGGTGGATTGGATTGTCCAAAATCTGACAAT
GACAGTCAAACTCGGAATTGCAAAACACGCATTTGTCCAACTCATGGCAA
ATGGTCGGCATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGGTG
GTAAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCGGCATGGT
GGAATGGATTGTGGAGACTCTATACCTCATATTTTGAATTGCAATTTAAA
GTCCTGTCCTCCAACTCATGGCAAATGGTCGGAATGGGGCTCATGGGGAA
AGTGCAGTGCATCATGTGGTGCTGGTCAGAAAACTAGAACAAGAACATGT
ACCAACCCTGCACCTCAGAATGGCGGAAGGGATTGTACAGACAttaaaaa
tgatattgaaaatcAGAAATGCAATACGAACACATGTCCAAACAATAACG
AAGTTGCTGAAAAAGTTTGTAAGATGCAATGTGTCCATTTGAAAGGGAAA
TGTGGTCAAATGCTTAAATGTGGAGAAGCCCAATTAGATGTTTCAAACCT
CTGCCCTAAAACATGTGCTGCAACGAGTCataCGACCAAAGATAACAACG
AAGTTgctgaaaatttttgtaaaaagcgATGTTTTCATCTAATTGAGAAT
TGTGGTCAAATGGTTAGGTGTGGAGATACCAAATTAGACGTTTCAAACCT
TTGCCCTAAAACGTGCGCCACCACGACTCatgGGACCAAAGACAACAACG
AACTTGCtgaaaaaatttgtaaaaagcGATGTGATCAATTGGAACGCAAT
TGTGGTGAAATAAAAAGATGTGCGGGATATACAATGTTAGACGTTTCAAA
CGTTTGCCCTGAAACCTGTGCTCacAAAGATAACGACAAAGTTGCtgaaa
aagtttgtaaaaagCGATGTGTTCATTTTAAAGGGAATTGTGGTCAAATG
GTTAAGTGTGGAAATACCAAATTTGACGTTTCAAACCATTGTCCAAAAAC
TTGTGCCGCGACTCTTTGTGAACCTAAAAAAGAAGCAATGGTTATGTGTC
ATGGACGGTCCTATACATTACATGGGAAAGCAAAGAATGGTGCCAGCGCT
AAACAATATGAATGGTACAAAAAGAGCAAAAAGGATTCGCTATTACGATT
GGATAGCGATTCTCAATACTCAATTACATACTCCGACCGTGATCCAACAA
AAAGCAGTTTGACTATTCTTTCTTTCAGTATGGTTAAACACGAAGGACTT
TACGCTTTCAGAGAAGCTAATCTAAAATACATCGATTGCTATGATTATAA
AGTGAAAGGAGTTCTTCAAGTTGAATATATTGATGGTAAAGATATGTTTG
ATGTTGTGGCTGGCGAGAATATAACACTTGCAGTGAAAGCAAAAGACCCT
GCATCTAAAACAAGCTGGTCTGTTGATGGACAAAGTTTGATAGAACCTTT
AATTAAAGCATCTCCACATTATAACTTGCCATCTACTGATGATTTTGGCC
CTACTACACAAATGTTGGAGATTCTTAATCCTCAACGGAGACATGGTGGA
ATGTACAAGCTTAAATGGTCAACTGATTTTGATCAATGCCCGATTGCCGA
TATTTTATTCAACGTTACTGTGAGAGAACGGAATATAACAGCATCCACTA
TGGACAATACGAACAACGGTGTAAATACAACAACCTCACCTAACCAGGAA
CTCAATGCTGGTCAACGAATTGGTACAGAGGAAGAGAGTGATGATTCTGT
AGGCTATATTCCATTGATTTTCGGTTCATTCTTACTTGGTATAGCGAAAG
GATCTATTGTACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGAAT
CAGAgGAGCTCATCTAATTCATTGCTGCTAAAAGCAAATGATGATAAACC
CGACTCAGGGCGAATTGATCAGAATAGCTTAGATGGTGACACTATTCCTG
AACCGCAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGAC
ACTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTT
CGATTGTGACACTATTCCTGAACCACAGTACAACGCTCAGCCTGTGGAAC
AGAATAGCTTCGATGGAGACAGTAGTCCTGTATGGCAGAACAACGCTCAG
CCTGTGGAACAGAATAGCTTTGATGGAGACACTAGTCCTGTATGGCAGAA
CAACGCTTACCCTGAGGCACAGAATAGCTTAGATGGTGAAAATAGTTTTG
CACCCCAGAGCCAGAACAACAATCAACCTGAAGCACAGAATAGCTTAGAT
GCTGAAAATCACCCTTTTGGTCCTGTAATACAATTTAAGAAACAACCTAT
AACAACAGAGAGTATGTTAGATGAGAACACTGATGAGACCAATGACCCTT
TTGGTCCTGTTCTGCAAAATACGAAACAACCTATAACAACACGGAATAGC
TTAGATCAGGATAATGAAAAAACACTCGAGACTATCTCCATCTTCAACAA
ATTGGCTTCTACTTCTTCCCGTAAATTTAAAAGGATGTAAATGGCGATGC
GCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTCATCTTGCagGT
GCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGTGCTTGTACACC
ACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACGAATATGTAAAA
ACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTCGCAGCTGCTCA
AAATGGAAAGCAGACGGTTCTGCCCCTTTTACATTATCAAAATGTAAACA
TGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTATACAGAACAAAG
GTGTTATCTACATAAACGATTTAACAGATTCTGGAGTTATGGAATCATTC
TCCGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATGACAGGTTGTAT
GTATGGGAAATTTAAATGCTGGGCTCATACACAACCTCTTCTTCCTCGTT
ACGAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGGTAAAGGACATT
TGTAGAAaacCGCTCGATGGGGACTGGTCACAATGGGGCCCTTGGGATGT
TTGTCGCAGACcatgtttccatggtgatcAATTTAGGAGAAGGACATGTA
CTAATCCAGCACCTCAGAAGGGTGGACGTGGTTGCCCAGAGTCTAGTGGT
CATCATCGGATGTGCAATCCAAACAGTTGTAAAGATTTAGATTTACATTC
ATCATGCAAAAGAGAACAAGGGGAGTGTCTTGATGAAAGCGGCCGTGGAC
GCATTCAGACAATGGGTAAGAAGCTAAATCATGGAAAAGAGAAAGATTGT
CTCGAAAAATGTATGGACCAGCTCTACTACGGTTCAGGTTGTACTTTCAT
CAAAAGTACTGGTTATTGCTATACTCATACAAAAAGAGTGGCAGGAGGAA
ATGGAGATGATGGAGCTTTTTGTTgggtatttaaaaaatgtaaaaTTAAT
GGCAAATGGTCAAAATGGGGCGCATGGGGAGAGTGCAGTGTATCATGTGG
CCCTGGTGGTAAGCAAACTAGAAGAAGAACATGCAACAATCCCATACCTA
ATGCGGGTGGATTGGATTGTCCAAAATCTGATAATGACAGTCAAACTCGG
AATTGCAAAACACGCNACAATCCCATACCTAATGCTGGTGGATTGGATTG
TCCAAAATCTGACAATGACAGTCAAACTCGGAATTGCAAAACACGCATTT
GTCCAACTCATGGCAAATGGTCGGCATGGGGCTCATGGGGAAAGTGCAGT
GCATCATGTGGTGGTGGTAAGAAAACTAGAACAAGAACATGTACCAACCC
TGCACCTCGGCATGGTGGAATGGATTGTGGAGACTCTATACCTCATATTT
TGAATTGCAATTTAAAGTCCTGTCCTCCAACTCATGGCAAATGGTCGGAA
TGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGCTGGTCAGAAAAC
TAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGGCGGAAGGGATT
GTACAGACAttaaaaatgatattgaaaatcAGAAATGCAATACGAACACA
TGTCCAAACAATAACGAAGTTGCTGAAAAAGTTTGTAAGATGCAATGTGT
CCATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGGAGAAGCCCAAT
TAGATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAACGAGTCataCG
ACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaaaagcgATGTTT
TCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGGAGATACCAAAT
TAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCACGACTCatgGG
ACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaaaagcGATGTGA
TCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGCGGGATATACAA
TGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTCacAAAGATAAC
GACAAAGTTGCtgaaaaagtttgtaaaaagCGATGTGTTCATTTTAAAGG
GAATTGTGGTCAAATGGTTAAGTGTGGAAATACCAAATTTGACGTTTCAA
ACCATTGTCCAAAAACTTGTGCCGCGACTCTTTGTGAACCTAAAAAAGAA
GCAATGGTTATGTGTCATGGACGGTCCTATACATTACATGGGAAAGCAAA
GAATGGTGCCAGCGCTAAACAATATGAATGGTACAAAAAGAGCAAAAAGG
ATTCGCTATTACGATTGGATAGCGATTCTCAATACTCAATTACATACTCC
GACCGTGATCCAACAAAAAGCAGTTTGACTATTCTTTCTTTCAGTATGGT
TAAACACGAAGGACTTTACGCTTTCAGAGAAGCTAATCTAAAATACATCG
ATTGCTATGATTATAAAGTGAAAGGAGTTCTTCAAGTTGAATATATTGAT
GGTAAAGATATGTTTGATGTTGTGGCTGGCGAGAATATAACACTTGCAGT
GAAAGCAAAAGACCCTGCATCTAAAACAAGCTGGTCTGTTGATGGACAAA
GTTTGATAGAACCTTTAATTAAAGCATCTCCACATTATAACTTGCCATCT
ACTGATGATTTTGGCCCTACTACACAAATGTTGGAGATTCTTAATCCTCA
ACGGAGACATGGTGGAATGTACAAGCTTAAATGGTCAACTGATTTTGATC
AATGCCCGATTGCCGATATTTTATTCAACGTTACTGTGAGAGAACGGAAT
ATAACAGCATCCACTATGGACAATACGAACAACGGTGTAAATACAACAAC
CTCACCTAACCAGGAACTCAATGCTGGTCAACGAATTGGTACAGAGGAAG
AGAGTGATGATTCTGTAGGCTATATTCCATTGATTTTCGGTTCATTCTTA
CTTGGTATAGCGAAAGGATCTATTGTACTTTGGTTTCTTTATAAAAGAGG
ATTAGCTCGCAAGAATCAGAgGAGCTCATCTAATTCATTGCTGCTAAAAG
CAAATGATGATAAACCCGACTCAGGGCGAATTGATCAGAATAGCTTAGAT
GGTGACACTATTCCTGAACCGCAGTACAACGCTCAGCCTGTGGAACAGAA
TAGCTTCGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTCAGCCTG
TGGAACAGAATAGCTTCGATTGTGACACTATTCCTGAACCACAGTACAAC
GCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACAGTAGTCCTGTATG
GCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTTGATGGAGACACTA
GTCCTGTATGGCAGAACAACGCTTACCCTGAGGCACAGAATAGCTTAGAT
GGTGAAAATAGTTTTGCACCCCAGAGCCAGAACAACAATCAACCTGAAGC
ACAGAATAGCTTAGATGCTGAAAATCACCCTTTTGGTCCTGTAATACAAT
TTAAGAAACAACCTATAACAACAGAGAGTATGTTAGATGAGAACACTGAT
GAGACCAATGACCCTTTTGGTCCTGTTCTGCAAAATACGAAACAACCTAT
AACAACACGGAATAGCTTAGATCAGGATAATGAAAAAACACTCGAGACTA
TCTCCATCTTCAACAAATTGGCTTCTACTTCTTCCCGTAAATTTAAAAGG
ATGTAAATGGCGATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTT
GCTTCATCTTGCagGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCAT
GGAGTGCTTGTACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACT
GCACGAATATGTAAAAACTATGATACCGACACTCAGTTTTGTAATGCTGC
CGGTCGCAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTTACAT
TATCAAAATGTAAACATGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGA
CGTATACAGAACAAAGGTGTTATCTACATAAACGATTTAACAGATTCTGG
AGTTATGGAATCATTCTCCGACTGTTTTGAATTATGTCAAAGAATCCCTG
GTATGACAGGTTGTATGTATGGGAAATTTAAATGCTGGGCTCATACACAA
CCTCTTCTTCCTCGTTACGAAGAATCTTTTAAAGACCCATCTCATATTTG
TTGGGTAAAGGACATTTGTAGAAaacCGCTCGATGGGGACTGGTCACAAT
GGGGCCCTTGGGATGTTTGTCGCAGACcatgtttccatggtgatcAATTT
AGGAGAAGGACATGTACTAATCCAGCACCTCAGAAGGGTGGACGTGGTTG
CCCAGAGTCTAGTGGTCATCATCGGATGTGCAATCCAAACAGTTGTAAAG
ATTTAGATTTACATTCATCATGCAAAAGAGAACAAGGGGAGTGTCTTGAT
GAAAGCGGCCGTGGACGCATTCAGACAATGGGTAAGAAGCTAAATCATGG
AAAAGAGAAAGATTGTCTCGAAAAATGTATGGACCAGCTCTACTACGGTT
CAGGTTGTACTTTCATCAAAAGTACTGGTTATTGCTATACTCATACAAAA
AGAGTGGCAGGAGGAAATGGAGATGATGGAGCTTTTTGTTgggtatttaa
aaaatgtaaaaTTAATGGCAAATGGTCAAAATGGGGCGCATGGGGAGAGT
GCAGTGTATCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAACATGC
AACAATCCCATACCTAATGCGGGTGGATTGGATTGTCCAAAATCTGATAA
TGACAGTCAAACTCGGAATTGCAAAACACGCNACAATCCCATACCTAATG
CTGGTGGATTGGATTGTCCAAAATCTGACAATGACAGTCAAACTCGGAAT
TGCAAAACACGCATTTGTCCAACTCATGGCAAATGGTCGGCATGGGGCTC
ATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAAACTAGAACAA
GAACATGTACCAACCCTGCACCTCGGCATGGTGGAATGGATTGTGGAGAC
TCTATACCTCATATTTTGAATTGCAATTTAAAGTCCTGTCCTCCAACTCA
TGGCAAATGGTCGGAATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTG
GTGCTGGTCAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCAG
AATGGCGGAAGGGATTGTACAGACAttaaaaatgatattgaaaatcAGAA
ATGCAATACGAACACATGTCCAAACAATAACGAAGTTGCTGAAAAAGTTT
GTAAGATGCAATGTGTCCATTTGAAAGGGAAATGTGGTCAAATGCTTAAA
TGTGGAGAAGCCCAATTAGATGTTTCAAACCTCTGCCCTAAAACATGTGC
TGCAACGAGTCataCGACCAAAGATAACAACGAAGTTgctgaaaattttt
gtaaaaagcgATGTTTTCATCTAATTGAGAATTGTGGTCAAATGGTTAGG
TGTGGAGATACCAAATTAGACGTTTCAAACCTTTGCCCTAAAACGTGCGC
CACCACGACTCatgGGACCAAAGACAACAACGAACTTGCtgaaaaaattt
gtaaaaagcGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGA
TGTGCGGGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTG
TGCTCacAAAGATAACGACAAAGTTGCtgaaaaagtttgtaaaaagCGAT
GTGTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAATACC
AAATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCGACTCTTTG
TGAACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACGGTCCTATACAT
TACATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAATATGAATGGTAC
AAAAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGCGATTCTCAATA
CTCAATTACATACTCCGACCGTGATCCAACAAAAAGCAGTTTGACTATTC
TTTCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTTTCAGAGAAGCT
AATCTAAAATACATCGATTGCTATGATTATAAAGTGAAAGGAGTTCTTCA
AGTTGAATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGAGA
ATATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCTGG
TCTGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCACA
TTATAACTTGCCATCTACTGATGATTTTGGCCCTACTACACAAATGTTGG
AGATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAAGCTTAAATGG
TCAACTGATTTTGATCAATGCCCGATTGCCGATATTTTATTCAACGTTAC
TGTGAGAGAACGGAATATAACAGCATCCACTATGGACAATACGAACAACG
GTGTAAATACAACAACCTCACCTAACCAGGAACTCAATGCTGGTCAACGA
ATTGGTACAGAGGAAGAGAGTGATGATTCTGTAGGCTATATTCCATTGAT
TTTCGGTTCATTCTTACTTGGTATAGCGAAAGGATCTATTGTACTTTGGT
TTCTTTATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCATCTAAT
TCATTGCTGCTAAAAGCAAATGATGATAAACCCGACTCAGGGCGAATTGA
TCAGAATAGCTTAGATGGTGACACTATTCCTGAACCGCAGTACAACGCTC
AGCCTGTGGAACAGAATAGCTTCGATGGAGACACTAGTCCTGTATGGCAG
AACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATTGTGACACTATTCC
TGAACCACAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAG
ACAGTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGC
TTTGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTTACCCTGAGGC
ACAGAATAGCTTAGATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAACA
ACAATCAACCTGAAGCACAGAATAGCTTAGATGCTGAAAATCACCCTTTT
GGTCCTGTAATACAATTTAAGAAACAACCTATAACAACAGAGAGTATGTT
AGATGAGAACACTGATGAGACCAATGACCCTTTTGGTCCTGTTCTGCAAA
ATACGAAACAACCTATAACAACACGGAATAGCTTAGATCAGGATAATGAA
AAAACACTCGAGACTATCTCCATCTTCAACAAATTGGCTTCTACTTCTTC
CCGTAAATTTAAAAGGATGTAAATGGCGATGCGCTTCACCATTCTTTACA
ATGTTCTATTCATTTTGCTTCATCTTGCagGTGCAACTGATGGGAGCTGG
ACGCAATGGGGCTCATGGAGTGCTTGTACACCACAGTGCTATCAAACTAG
AAAAAGAACGTGTACTGCACGAATATGTAAAAACTATGATACCGACACTC
AGTTTTGTAATGCTGCCGGTCGCAGCTGCTCAAAATGGAAAGCAGACGGT
TCTGCCCCTTTTACATTATCAAAATGTAAACATGAAGAAGGACGCTGTTT
AACGGGCCTGCGCAGACGTATACAGAACAAAGGTGTTATCTACATAAACG
ATTTAACAGATTCTGGAGTTATGGAATCATTCTCCGACTGTTTTGAATTA
TGTCAAAGAATCCCTGGTATGACAGGTTGTATGTATGGGAAATTTAAATG
CTGGGCTCATACACAACCTCTTCTTCCTCGTTACGAAGAATCTTTTAAAG
ACCCATCTCATATTTGTTGGGTAAAGGACATTTGTAGAAaacCGCTCGAT
GGGGACTGGTCACAATGGGGCCCTTGGGATGTTTGTCGCAGACcatgttt
ccatggtgatcAATTTAGGAGAAGGACATGTACTAATCCAGCACCTCAGA
AGGGTGGACGTGGTTGCCCAGAGTCTAGTGGTCATCATCGGATGTGCAAT
CCAAACAGTTGTAAAGATTTAGATTTACATTCATCATGCAAAAGAGAACA
AGGGGAGTGTCTTGATGAAAGCGGCCGTGGACGCATTCAGACAATGGGTA
AGAAGCTAAATCATGGAAAAGAGAAAGATTGTCTCGAAAAATGTATGGAC
CAGCTCTACTACGGTTCAGGTTGTACTTTCATCAAAAGTACTGGTTATTG
CTATACTCATACAAAAAGAGTGGCAGGAGGAAATGGAGATGATGGAGCTT
TTTGTTgggtatttaaaaaatgtaaaaTTAATGGCAAATGGTCAAAATGG
GGCGCATGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGCAAAC
TAGAAGAAGAACATGCAACAATCCCATACCTAATGCGGGTGGATTGGATT
GTCCAAAATCTGATAATGACAGTCAAACTCGGAATTGCAAAACACGCNAC
AATCCCATACCTAATGCTGGTGGATTGGATTGTCCAAAATCTGACAATGA
CAGTCAAACTCGGAATTGCAAAACACGCATTTGTCCAACTCATGGCAAAT
GGTCGGCATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGT
AAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCGGCATGGTGG
AATGGATTGTGGAGACTCTATACCTCATATTTTGAATTGCAATTTAAAGT
CCTGTCCTCCAACTCATGGCAAATGGTCGGAATGGGGCTCATGGGGAAAG
TGCAGTGCATCATGTGGTGCTGGTCAGAAAACTAGAACAAGAACATGTAC
CAACCCTGCACCTCAGAATGGCGGAAGGGATTGTACAGACAttaaaaatg
atattgaaaatcAGAAATGCAATACGAACACATGTCCAAACAATAACGAA
GTTGCTGAAAAAGTTTGTAAGATGCAATGTGTCCATTTGAAAGGGAAATG
TGGTCAAATGCTTAAATGTGGAGAAGCCCAATTAGATGTTTCAAACCTCT
GCCCTAAAACATGTGCTGCAACGAGTCataCGACCAAAGATAACAACGAA
GTTgctgaaaatttttgtaaaaagcgATGTTTTCATCTAATTGAGAATTG
TGGTCAAATGGTTAGGTGTGGAGATACCAAATTAGACGTTTCAAACCTTT
GCCCTAAAACGTGCGCCACCACGACTCatgGGACCAAAGACAACAACGAA
CTTGCtgaaaaaatttgtaaaaagcGATGTGATCAATTGGAACGCAATTG
TGGTGAAATAAAAAGATGTGCGGGATATACAATGTTAGACGTTTCAAACG
TTTGCCCTGAAACCTGTGCTCacAAAGATAACGACAAAGTTGCtgaaaaa
gtttgtaaaaagCGATGTGTTCATTTTAAAGGGAATTGTGGTCAAATGGT
TAAGTGTGGAAATACCAAATTTGACGTTTCAAACCATTGTCCAAAAACTT
GTGCCGCGACTCTTTGTGAACCTAAAAAAGAAGCAATGGTTATGTGTCAT
GGACGGTCCTATACATTACATGGGAAAGCAAAGAATGGTGCCAGCGCTAA
ACAATATGAATGGTACAAAAAGAGCAAAAAGGATTCGCTATTACGATTGG
ATAGCGATTCTCAATACTCAATTACATACTCCGACCGTGATCCAACAAAA
AGCAGTTTGACTATTCTTTCTTTCAGTATGGTTAAACACGAAGGACTTTA
CGCTTTCAGAGAAGCTAATCTAAAATACATCGATTGCTATGATTATAAAG
TGAAAGGAGTTCTTCAAGTTGAATATATTGATGGTAAAGATATGTTTGAT
GTTGTGGCTGGCGAGAATATAACACTTGCAGTGAAAGCAAAAGACCCTGC
ATCTAAAACAAGCTGGTCTGTTGATGGACAAAGTTTGATAGAACCTTTAA
TTAAAGCATCTCCACATTATAACTTGCCATCTACTGATGATTTTGGCCCT
ACTACACAAATGTTGGAGATTCTTAATCCTCAACGGAGACATGGTGGAAT
GTACAAGCTTAAATGGTCAACTGATTTTGATCAATGCCCGATTGCCGATA
TTTTATTCAACGTTACTGTGAGAGAACGGAATATAACAGCATCCACTATG
GACAATACGAACAACGGTGTAAATACAACAACCTCACCTAACCAGGAACT
CAATGCTGGTCAACGAATTGGTACAGAGGAAGAGAGTGATGATTCTGTAG
GCTATATTCCATTGATTTTCGGTTCATTCTTACTTGGTATAGCGAAAGGA
TCTATTGTACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGAATCA
GAgGAGCTCATCTAATTCATTGCTGCTAAAAGCAAATGATGATAAACCCG
ACTCAGGGCGAATTGATCAGAATAGCTTAGATGGTGACACTATTCCTGAA
CCGCAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACAC
TAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTCG
ATTGTGACACTATTCCTGAACCACAGTACAACGCTCAGCCTGTGGAACAG
AATAGCTTCGATGGAGACAGTAGTCCTGTATGGCAGAACAACGCTCAGCC
TGTGGAACAGAATAGCTTTGATGGAGACACTAGTCCTGTATGGCAGAACA
ACGCTTACCCTGAGGCACAGAATAGCTTAGATGGTGAAAATAGTTTTGCA
CCCCAGAGCCAGAACAACAATCAACCTGAAGCACAGAATAGCTTAGATGC
TGAAAATCACCCTTTTGGTCCTGTAATACAATTTAAGAAACAACCTATAA
CAACAGAGAGTATGTTAGATGAGAACACTGATGAGACCAATGACCCTTTT
GGTCCTGTTCTGCAAAATACGAAACAACCTATAACAACACGGAATAGCTT
AGATCAGGATAATGAAAAAACACTCGAGACTATCTCCATCTTCAACAAAT
TGGCTTCTACTTCTTCCCGTAAATTTAAAAGGATGTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000742XLOC_000742Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001402-proteinTCONS_00001402-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001402-exon-sc0000010-1491911889:1069472..1069594TCONS_00001402-exon-sc0000010-1491911889:1069472..1069594Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1069472..1069594TCONS_00001402-exon-sc0000010-1510915933:1069472..1069594Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1069472..1069594TCONS_00001402-exon-sc0000010-1575043694:1069472..1069594Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1070189..1070274TCONS_00001402-exon-sc0000010-1491911889:1070189..1070274Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1070189..1070274TCONS_00001402-exon-sc0000010-1510915933:1070189..1070274Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1070189..1070274TCONS_00001402-exon-sc0000010-1575043694:1070189..1070274Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1072427..1072591TCONS_00001402-exon-sc0000010-1491911889:1072427..1072591Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1072427..1072591TCONS_00001402-exon-sc0000010-1510915933:1072427..1072591Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1072427..1072591TCONS_00001402-exon-sc0000010-1575043694:1072427..1072591Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1072833..1073126TCONS_00001402-exon-sc0000010-1491911889:1072833..1073126Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1072833..1073126TCONS_00001402-exon-sc0000010-1510915933:1072833..1073126Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1072833..1073126TCONS_00001402-exon-sc0000010-1575043694:1072833..1073126Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1076870..1077046TCONS_00001402-exon-sc0000010-1491911889:1076870..1077046Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1076870..1077046TCONS_00001402-exon-sc0000010-1510915933:1076870..1077046Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1076870..1077046TCONS_00001402-exon-sc0000010-1575043694:1076870..1077046Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1085740..1086000TCONS_00001402-exon-sc0000010-1491911889:1085740..1086000Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1085740..1086000TCONS_00001402-exon-sc0000010-1510915933:1085740..1086000Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1085740..1086000TCONS_00001402-exon-sc0000010-1575043694:1085740..1086000Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1086702..1086962TCONS_00001402-exon-sc0000010-1491911889:1086702..1086962Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1086702..1086962TCONS_00001402-exon-sc0000010-1510915933:1086702..1086962Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1086702..1086962TCONS_00001402-exon-sc0000010-1575043694:1086702..1086962Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1088457..1088630TCONS_00001402-exon-sc0000010-1491911889:1088457..1088630Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1088457..1088630TCONS_00001402-exon-sc0000010-1510915933:1088457..1088630Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1088457..1088630TCONS_00001402-exon-sc0000010-1575043694:1088457..1088630Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1089341..1089422TCONS_00001402-exon-sc0000010-1491911889:1089341..1089422Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1089341..1089422TCONS_00001402-exon-sc0000010-1510915933:1089341..1089422Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1089341..1089422TCONS_00001402-exon-sc0000010-1575043694:1089341..1089422Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1090984..1091078TCONS_00001402-exon-sc0000010-1491911889:1090984..1091078Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1090984..1091078TCONS_00001402-exon-sc0000010-1510915933:1090984..1091078Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1090984..1091078TCONS_00001402-exon-sc0000010-1575043694:1090984..1091078Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1096377..1096514TCONS_00001402-exon-sc0000010-1491911889:1096377..1096514Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1096377..1096514TCONS_00001402-exon-sc0000010-1510915933:1096377..1096514Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1096377..1096514TCONS_00001402-exon-sc0000010-1575043694:1096377..1096514Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1098217..1098366TCONS_00001402-exon-sc0000010-1491911889:1098217..1098366Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1098217..1098366TCONS_00001402-exon-sc0000010-1510915933:1098217..1098366Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1098217..1098366TCONS_00001402-exon-sc0000010-1575043694:1098217..1098366Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1098478..1098621TCONS_00001402-exon-sc0000010-1491911889:1098478..1098621Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1098478..1098621TCONS_00001402-exon-sc0000010-1510915933:1098478..1098621Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1098478..1098621TCONS_00001402-exon-sc0000010-1575043694:1098478..1098621Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1099235..1099375TCONS_00001402-exon-sc0000010-1491911889:1099235..1099375Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1099235..1099375TCONS_00001402-exon-sc0000010-1510915933:1099235..1099375Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1099235..1099375TCONS_00001402-exon-sc0000010-1575043694:1099235..1099375Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1099629..1099928TCONS_00001402-exon-sc0000010-1491911889:1099629..1099928Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1099629..1099928TCONS_00001402-exon-sc0000010-1510915933:1099629..1099928Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1099629..1099928TCONS_00001402-exon-sc0000010-1575043694:1099629..1099928Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1100920..1101117TCONS_00001402-exon-sc0000010-1491911889:1100920..1101117Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1100920..1101117TCONS_00001402-exon-sc0000010-1510915933:1100920..1101117Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1100920..1101117TCONS_00001402-exon-sc0000010-1575043694:1100920..1101117Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1101475..1101588TCONS_00001402-exon-sc0000010-1491911889:1101475..1101588Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1101475..1101588TCONS_00001402-exon-sc0000010-1510915933:1101475..1101588Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1101475..1101588TCONS_00001402-exon-sc0000010-1575043694:1101475..1101588Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1102350..1102578TCONS_00001402-exon-sc0000010-1491911889:1102350..1102578Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1102350..1102578TCONS_00001402-exon-sc0000010-1510915933:1102350..1102578Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1102350..1102578TCONS_00001402-exon-sc0000010-1575043694:1102350..1102578Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1491911889:1102873..1103646TCONS_00001402-exon-sc0000010-1491911889:1102873..1103646Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1510915933:1102873..1103646TCONS_00001402-exon-sc0000010-1510915933:1102873..1103646Clytia hemisphaericaexon
TCONS_00001402-exon-sc0000010-1575043694:1102873..1103646TCONS_00001402-exon-sc0000010-1575043694:1102873..1103646Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:1069472..1103646 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.135861 0.127141 0.0880427 0.0457431 0.0607898 0 0.135408 0.0433637 0.305668 0.392368 0.282838 0.364206 0.333885 0.409154 0.147822 0.290717 0 0.0207135 0.126982 0.136743 0 0.0528619 0.410676 0.385656 3.28574 1.72032 0.0228987 0.0386003 0.229811 0.215629
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000884TSP1_rpt
IPR013783Ig-like_fold
IPR003582ShKT_dom
IPR007110Ig-like_dom
Blast
BLAST of TCONS_00001402 vs. Swiss-Prot (Human)
Match: HMCN1 (Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 1.201e-34
Identity = 133/378 (35.19%), Postives = 161/378 (42.59%), Query Frame = 2
Query:  674 LDGDWSQWGPWDVCRRPCFHGDQFRRRTCTNPAPQKGGRGCPESSGHHRMCNPNSCKDLDLHSSCKREQGECLDESGRGRIQTMGKKLNHGKEKDCLEKCMDQLYYGSGCTFIKSTGYCYTHTKRVAGGNGDDGAFCWVFKKCKINGKWSKWGAWGECSVSCGPGGKQTRRRTCNNPIPNAGGLDCPKSDNDSQT---RNC-------------------------KTR--XNPIPNAGGLDCPKSDNDSQTRNCKTRICPTHGKWSAXXXXXXXXXXXXXXXXXXXXXXXNPAPRHGGMDCGDSIPHILNCNLKSCPPTHGKWSEWGSWGKCSASCGAGQKTRTRTCTNPAPQNGGRDCTDIKNDIENQKCNTNTCP 1717
            + G +SQW  W  C   C  G Q R R C  P P  GG+ C  S    R C    C  +D   S      EC    GRG         N  + + C    +                    H  R   GN  +   C + + C ++G WS W  WG CS SCG  G QTR R CNNP P  GG  C  ++   Q    RNC                         +TR   +P+P  GG  C  SD   Q+  C +  CPTHG WS W  WG CS +C GG+  R RTC NP P +GG  CG     I  CN   CP   G W  W SW +CSASCG G+KTR R C +P P  GGR C    +  +  +CN   CP
Sbjct: 4528 VHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCP-VDGSWSEWSLWEECTRSCGRG---------NQTRTRTCNNPSVQ-------------------HGGRPCEGNAVEIIMCNI-RPCPVHGAWSAWQPWGTCSESCG-KGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSD--VQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCP-VDGSWGSWHSWSQCSASCGGGEKTRKRLCDHPVPVKGGRPCPG--DTTQVTRCNVQACP 4869          

HSP 2 Score: 122.094 bits (305), Expect = 1.690e-27
Identity = 94/241 (39.00%), Postives = 120/241 (49.79%), Query Frame = 2
Query: 1100 CKINGKWSKWGAWGECSVSCGPGGKQTRRRTCNNPIPNAGGLDCPKSD---------------------------------NDSQTRNCKTRXNPIPNAGGLDCPKSDNDSQTRNCKTRICPTHGKWSAXXXXXXXXXXXXXXXXXXXXXXXNPAPRHGGMDCGDSIPHILNCNLKSCPPTHGKWSEWGSWGKCSASCGAGQKTRTRTCTNPAPQNGGRDCTDIKNDIENQKCNTNTCPNN 1723
             +++G +S+W AW  CSV+CG  G Q R R CN P+P  GG  C  SD                                 N ++TR C    NP    GG  C    N  +   C  R CP HG WSAW  WG CS SCG G +TR R C NP P  GG  C  +   +  CN ++C P HGKW+ W SW  CS SCG G + RTR C++P PQ GGR C    +D+++  CN++ CP +
Sbjct: 4526 VQVHGGFSQWSAWRACSVTCG-KGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCN---NPSVQHGGRPC--EGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNC-PIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEG--SDVQSDFCNSDPCPTH 4757          
The following BLAST results are available for this feature:
BLAST of TCONS_00001402 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
HMCN11.201e-3435.19Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2[more]
back to top