Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001401 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001401
Unique NameTCONS_00001401
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3609

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001401 ID=TCONS_00001401|Name=TCONS_00001401|organism=Clytia hemisphaerica|type=transcript|length=3609bp
ttatttctaatttcAGTTGAGCAATAATCTAAGAATGTTTGTCTGTATGT
CCGTAAACTTTGAGGCAACCTAGAAAGACAGAATAATTCTACGGAGCTAA
AATTTGGCATGCATTCTATTAAGtttttttctctcaaaaataaACAGAGG
TATGGCGATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTC
ATCTTGCagGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGT
GCTTGTACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACG
AATATGTAAAAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTC
GCAGCTGCTCAAAATGGAAAGCAGACGGTTCTGCCCCTTTTACATTATCA
AAATGTAAACATGAAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTAT
ACAGAACAAAGGTGTTATCTACATAAACGATTTAACAGATTCTGGAGTTA
TGGAATCATTCTCCGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATG
ACAGGTTGTATGTATGGGAAATTTAAATGCTGGGCTCATACACAACCTCT
TCTTCCTCGTTACGAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGG
TAAAGGACATTTGTAGAAaacCGCTCGATGGGGACTGGTCACAATGGGGC
CCTTGGGATGTTTGTCGCAGACcatgtttccatggtgatcAATTTAGGAG
AAGGACATGTACTAATCCAGCACCTCAGAAGGGTGGACGTGGTTGCCCAG
AGTCTAGTGGTCATCATCGGATGTGCAATCCAAACAGTTGTAAAGATTTA
GATTTACATTCATCATGCAAAAGAGAACAAGGGGAGTGTCTTGATGAAAG
CGGCCGTGGACGCATTCAGACAATGGGTAAGAAGCTAAATCATGGAAAAG
AGAAAGATTGTCTCGAAAAATGTATGGACCAGCTCTACTACGGTTCAGGT
TGTACTTTCATCAAAAGTACTGGTTATTGCTATACTCATACAAAAAGAGT
GGCAGGAGGAAATGGAGATGATGGAGCTTTTTGTTgggtatttaaaaaat
gtaaaaTTAATGGCAAATGGTCAAAATGGGGCGCATGGGGAGAGTGCAGT
GTATCATGTGGCCCTGGTGGTAAGCAAACTAGAAGAAGAACATGCAACAA
TCCCATACCTAATGCGGGTGGATTGGATTGTCCAAAATCTGATAATGACA
GTCAAACTCGGAATTGCAAAACACGCNACAATCCCATACCTAATGCTGGT
GGATTGGATTGTCCAAAATCTGACAATGACAGTCAAACTCGGAATTGCAA
AACACGCATTTGTCCAACTCATGGCAAATGGTCGGCATGGGGCTCATGGG
GAAAGTGCAGTGCATCATGTGGTGGTGGTAAGAAAACTAGAACAAGAACA
TGTACCAACCCTGCACCTCGGCATGGCGGAAGGGAGTGTGGAGACTCTAA
TACTCATACTTTGAATTGCAATTTAAAGTCCTGTCCAATTGTAGTCCATG
GCAAATGGTCGGAATGGGGCTCGTGGGGAAAGTGCAGTGCATCATGTGGT
AGTGGTCAGAAAACTAGAACAAGAACATGTACCAACCCTGCACCTCAGAA
TGGCGGAAGGGATTGTACAGACAttaaaaatgatattgaaaatcAGAAAT
GCAATACGAACACATGTCCAAACAACAACGAACTTGCtgaaaaaatttgt
aaaaagcGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATG
TGCGGGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTG
CTCacAAAGATAACGACAAAGTTGCtgaaaaagtttgtaaaaagCGATGT
GTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTGGAAATACCAA
ATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCGACTCTTTGTG
AACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACGGTCCTATACATTA
CATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAATATGAATGGTACAA
AAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGCGATTCTCAATACT
CAATTACATACTCCGACCGTGATCCAACAAAAAGCAGTTTGACTATTCTT
TCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTTTCAGAGAAGCTAA
TCTAAAATACATCGATTGCTATGATTATAAAGTGAAAGGAGTTCTTCAAG
TTGAATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGAGAAT
ATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCTGGTC
TGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCACATT
ATAACTTGCCATCTACTGATGATTTTGGCCCTACTACACAAATGTTGGAG
ATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAAGCTTAAATGGTC
AACTGATTTTGATCAATGCCCGATTGCCGATATTTTATTCAACGTTACTG
TGAGAGAACGGAATATAACAGCATCCACTATGGACAATACGAACAACGGT
GTAAATACAACAACCTCACCTAACCAGGAACTCAATGCTGGTCAACGAAT
TGGTACAGAGGAAGAGAGTGATGATTCTGTAGGCTATATTCCATTGATTT
TCGGTTCATTCTTACTTGGTATAGCGAAAGGATCTATTGTACTTTGGTTT
CTTTATAAAAGAGGATTAGCTCGCAAGAATCAGAgGAGCTCATCTAATTC
ATTGCTGCTAAAAGCAAATGATGATAAACCCGACTCAGGGCGAATTGATC
AGAATAGCTTAGATGGTGACACTATTCCTGAACCGCAGTACAACGCTCAG
CCTGTGGAACAGAATAGCTTCGATGGAGACACTAGTCCTGTATGGCAGAA
CAACGCTCAGCCTGTGGAACAGAATAGCTTCGATTGTGACACTATTCCTG
AACCACAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGAC
AGTAGTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTT
TGATGGAGACACTAGTCCTGTATGGCAGAACAACGCTTACCCTGAGGCAC
AGAATAGCTTAGATGGTGAAAATAGTTTTGCACCCCAGAGCCAGAACAAC
AATCAACCTGAAGCACAGAATAGCTTAGATGCTGAAAATCACCCTTTTGG
TCCTGTAATACAATTTAAGAAACAACCTATAACAACAGAGAGTATGTTAG
ATGAGAACACTGATGAGACCAATGACCCTTTTGGTCCTGTTCTGCAAAAT
ACGAAACAACCTATAACAACACGGAATAGCTTAGATCAGGATAATGAAAA
AACACTCGAGACTATCTCCATCTTCAACAAATTGGCTTCTACTTCTTCCC
GTAAATTTAAAAGGATGTAAAGCATATTTGGACGTGCTcagttgttttat
ttttttcaattttatataGTACTTTTAATGACTTGAAAGATTATTTggat
aataaaaat
Run BLAST on NCBI

transcript from alignment at sc0000010:1069472..1103646+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001401 ID=TCONS_00001401|Name=TCONS_00001401|organism=Clytia hemisphaerica|type=transcript|length=34175bp|location=Sequence derived from alignment at sc0000010:1069472..1103646+ (Clytia hemisphaerica)
ttatttctaatttcAGTTGAGCAATAATCTAAGAATGTTTGTCTGTATGT CCGTAAACTTTGAGGCAACCTAGAAAGACAGAATAATTCTACGGAGCTAA AATTTGGCATGCATTCTATTAAGGTGAAAGcccttttattttttgaattt ccattCTTTTCGTGAGCTATGTGTCCATCTTTCGAGCAATAACACCATCT AAactaaaataattgacgtcaaatagcTTTTTTAGCGACGTGAATTAGTT TCTCTCGGGAACGAGCGCAAGTTTACAGTTGAGCCTTCAAATACAAAGTA ACCAACACCCTGAATTTGAAATAAAGTCCTCTTTAAATCTAACGCCCAGG TTTTACAAAACTGAGATTTCTCTAATCTTAAAAACACATCATCCCAGCTT TACAATTGTGTTTTCCAAATGGCAAGCAACTACTATCACCCTGTTTTGGT ACACAAATTAACCTTTTCaagattaaaaacatttttatcttGGCTTGGCG TTGTGTCTTCCCTCTTTTTCCCAAATAAACCAATTAAATTCCATCTAGCT ACTGAAGCTGAACCCAGTACACGCTCCTTTTTAAGATAGtggcatggcgt tctaaatctggatttagaacgccatggatAATAGAGTAAATGcttgcgaa aaaaaaatttgacgtcagaTAATATTCTTCTTCATAACACTGttgtaaaa tttttcttattttttagtttttttctctcaaaaataaACAGAGGTATGGC GATGCGCTTCACCATTCTTTACAATGTTCTATTCATTTTGCTTCATCTTG CaggtaaagaaaatttcatctGATGTTGAATTTTAAAGTCTAATTTATGC TGGAATTATAAAGAGTATTTTTTGCGAGGGTTTCCCCTTGACGGGAACTG ATCTTTcttttgaattatagaaaaataaGTTTGAGGGGTTACTTCAATCA ATAATTGTCTTCATTCCTTAACTTATTTTGATATCAAATGCACGTCTACA AACctagtctgtacacagacccgatatctacggctaatttcagaattcat tgccgtagagggtctgttctgatttgaaatttttcaaaccgaccactGCA ATGAAGTGCGGGTGAGCGAGGGAAAGAaagagagaagtgttgctatttat ataATGTACTTCAttgcagaggtctccgtacgggaattttttatcaaaca gacaatgcgcaggAGTGTACTACGaggcgataaacgtgagatacactcgg GTACAGAGTACTACAAACCGAACTAAGAAGAAACTTTTTCACTTGATGTC TTTTATTCTAGCGGAGAAAAAAGGCGGCATATGTTGCGGCGCTCCTAGGT ccaatttctttttattgaacGTTTTTAtttcattcgaaattcattttacg agaaagaaaaagagtctgctaaatcacgCCCCTTACGCGCTCTCATTTTT TAGTGGCCATTGCGTAAAACATGTAGCTCATCCATGGAGTACTCCATTAG TGTAATTTGATTACCGACCAACAATGCAACAGAAAATTTATAAATGCAGC TCTTCAAAGTGTAGCTCAGGCTTTATGTGCCATTGCTCTAAAACCACTTT CTTTGTAATTGCCACCACAGGGAGCCTAAAGtgaccgaggatggcattca tagcttcacgcctAAGGATAATTCACAAATAGCTCACAATTTTGCGAAAT TGTTTGTCACTTTCTTATACCGGTTAAATGATTAACCGTTTAAATGGTTA ACCGGTTAAATGGTAGCCCGGTAttaagtttgtctttttcttatccctag aGAATTAATGAATCTAGGAAATTCTTGtcatattaattaaaatggaaatc tgtactaatttgttcttagattttggccaaatttcagcattgtattttta taaaattgttcttataaaaaagcgtgtaaacgCACGAATGTAACTATAAG TAGACGCTAAAACAAAACGggctttattttgaaaactataactgtaaatc actcccttgacacatttgttagcatttgaagactgaattttgtctcagat cagATGAGAAgtcaaaaattactgtagggctaataNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNaaggaatccccttttctggcatttcaaatcaaac aaaggaaccaaaacaaagagaaaaaatgacatttttgattttttaaagta tttgtacgttttttattcagttctttctatagaaatttgcaagatttgcc atagcctagccctacggcaaaaagtttcagtctaaatgactgcagttttt gagaaattccatgcttttcattgtttgatctgtcaaagatgaacttgagg gaatccccttttcagtaatgactctaaaaagacgattccttaaatgccat gacagaaaatacaatggaaaagctattaaaNACTAGATGGGTTCGTATTA TGCGCCATCCCATCGCTTTTTCATAAagtaaagcaaaaatgaaaaaaact tcacgAAAAATGAAAGCGCGTGAATATATATGAAGGCGCGTGAATATATT AAAACGCGGAGGCGCGTAGGGCGAGTGATTTATAGCAGACTCAAAGAAAA ACTATGAACTtaacaataaataaaaacataaaaagaagAGTCAAATAATA CTTTCACTGTAATTTTCTTTCACAACGGANTCAAAGTAGCGAAACCAATT GTGCAATTagctcgttatcatgtgattacatatacaaattGCAATACGAT TATACTATAAGTTTTACTGGATTTTTGCTTTCATTACCTATTACAATTTC TAAAATTCACTTATCTGGAATGTTAGATTTTCTTTTCCTGTTTCCTGGCT CAAGTTGATGTGTAAGCTTGACTAACAGGTTATATGTTACTTTCACTATT TTCAGGTGCAACTGATGGGAGCTGGACGCAATGGGGCTCATGGAGTGCTT GTACACCACAGTGCTATCAAACTAGAAAAAGAACGTGTACTGCACGAATA TGTAAAAACTATGATACCGACACTCAGTTTTGTAATGCTGCCGGTCGCAG CTGCTCAAAATGGAAAGCAGGTAGGAAAAAATACTTAATCTCATACCTAT TTCAATACCTATCCCAACCGTATTTTCTggcaacttttttttctttatct ttttgaaAACGCAAAAGACTCTGGAGAATACTTGCTTGATGTGAAGTTTA TCATCAGCTATAGGTTAATGTATAAAAGTTTTTTCCGAGCCGTCGTAAAG AGTTCTGTATTGCAATTTTATCACAAAACGAAAAACATTTCATCCATTGA TTACATTTTAGACGGTTCTGCCCCTTTTACATTATCAAAATGTAAACATG AAGAAGGACGCTGTTTAACGGGCCTGCGCAGACGTATACAGAACAAAGGT GTTATCTACATAAACGATTTAACAGATTCTGGAGTTATGGAATCATTCTC CGACTGTTTTGAATTATGTCAAAGAATCCCTGGTATGACAGGTTGTATGT ATGGGAAATTTAAATGCTGGGCTCATACACAACCTCTTCTTCCTCGTTAC GAAGAATCTTTTAAAGACCCATCTCATATTTGTTGGGTAAAGGACATTTG TAGAAGTAAGctgtattttctttttattgaccTTGTTTAGCTTAACGTGT TGTGTTGTCATTGACGGCCCTTATTTCGCTGTCAGTAATGTACATGATTT TAAAACTTGCTCAAAAATCGATAATCATTTACAGGTTGTCTGAAAAAAAG AGTATCGAGCTTGGATATATCATTGTGTCATTGCGTAGAGAAGAGTTACA AGTCTgtctcaatagaccttttcataaattgtgtcacgaacatcacttgc ctcgttttgaaattattgccatggtgattaaaggcttggggacacctCAA CAATTACCATGGCTATTATGCcccttgaaaaaaatgatttttttattcga ATAGAaagtaattttaataaaatctgctgggacCTGGgagttaaggcttg gggacacgagaagtttatttcgcgttggtgcaatgcaacatgctctatcc catcaatctgaaacgctttcttgtgacgttatttatgaaaaggcctatat aatctgcagcggagacaGAAAAGGCTTTAACTTTAGATTGAAAAGTTACT GGCCACAAATTCACAAATTCATCCATCGATGCTCTTTTATTCAAAAAACC ACCCTTTGCAACAAACCATGagcatataaacgactggacatccatctcct ttttatttttgtagaaagcactactagcttcgttgccgccaaGTTAAAAA TATaagatgaaacaataaattttgatgatattgtTGCCGCATTGAGTGCA AGTAGGCCTCCACTCTACGCGGGAGTATATGGTTCTCCTCCGTAACGTAT TTCTCAATGTTTCGTGCGCGTCTATTGTCTTGTTTTATGTATTATATTTA TCTTGTCTTGTCCCTTGTGAATTTgtattgtgacgtcacttaTCTACTTA TATTTTGCAGGtgttttaaaatgttattttttgaatgttgttTTATACTG AACTGTTGTGTGTTGTGAAAGAACTTTagtattttctatgtttgtgATAT GTACAATGCTCAGGTTCTTGGGCTTTCGTCTTCTGTGTGTCTTCCGTGCT TCGTTTTCAGTGTGATTCGTTTCGGTTTTGTTTGGGGGTTTGCGTCTTTT CTGTCTGCCAGCTTTTATCGTATCTTTTGGGTCTAACTTATgatattttc agtttcttgtAACTACCGTaatttggtctaatgtcgacattccTCATCGA ATCCCGACACCCTTTTATCAGCTGACATTGATAGAAAggtcaaaactatt tttctttgcttagtggtcagagaggaataatccttcttcaatcagtgatt caagctttcatattattcctgtctctaaagaagggtgtcggaattagacg aaggatgtcgatattagaccaacctACGGTAGTTTATTGGCAAGTTTTCG AACTTCTAATTTTGTGCATTTGTTTTAGCGTCCCTGAATAGCAGTAAAAT ACTAAAAGTTAAAGTAGCTTGTCATCTAGTACTCACCTTTTTGTTATGTC ATACATTCAGTCAGCAAGAGGCAGCAGCAAAAGGGAAATTAAAATTCCAG CCAGATCTCTTTGGAATACCTtactaacaacgtcaaaacttgaaCAAAAG TTTATATTGttctaccgtcaactgctctaacttactgacaaaacatggga cggcaattcggtaaccatttcaccgaacctccaaagtcatttgatttgag ttaatgaacggcgtattaaaaatacacgatttctttttcgcactgagtag gcttttaaatcgaaatatgaaaacatCCCTTCGAAATTCATCAAGCCAGT GTCGCAATATCTCACATCACCTCTAACCGATATCATCAATAACTAAATCC AATCATCGACCTTCCCAGAAGAATGGAAAATTAGTCGAATTTGCCCAGTG TCCAAAGTCACCGACCCCAATTCTTGATAGACTTTAGACCAATCAGCATA TTGCCAATCTtgtcaaaattctttgaaagaattaTCCTCCAACAATTAAC CGAGCACATCGAAGAAAAATCGATTTACCTCGAGAGTCAATCTGGTTTCA GAAAACCGTATTCAACTATAATCGTTCCTACtactaattcaaattctatc aaaaattattgaggtttgaaaaagcagtaccagctaatttgaaatagact tcaGGCGGAAATTTTGTCCGCTCGGGCGAAAAATAGTCAGAGGGGCGCAA TGTCACAGACTCTATTTTCCGCCGCGCAatatattacgttttataatata caactatgttatatcataatatcataataatatattatacagacgatagc atcgtctaacggcaacgaagctcgcttaaaataccgtgaaaagcacagtc cgaaatcatatatcgacctgtaccgaccaatccagatttagcgtgcaatc aacgcagagaaaagtaaccataacgacaatccaagatcttggatgaagtt caaagttcatatttttattcccgtcgtttaaaacacaactcaaaaatgtc attaatgCTCTTTAAAAagagtgatagagaatcataacataaagtctgtc tattaattcgattcaattaaagtaacatttccataattaatagtttaatA TTTACTGATTATACATTTGGGgttcatgtaaaagatttcttacgaaagaa actcatttcaattacacttggaggtttctggggaattcttaaatagtaaa ctgcatactgatagtctgctagacattaatatggcaatatttgctcttca tctttgattctttcttcagtgattagattgacacatgcgcgataaaattt ctattattgatatacacgtttttttttttataagaacaaactatataaga acataaggcttcgaggcccaaaaatttaagaacattctaagaacattcta aggctttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtaagaaca ttttaagaacatttttaggcttcaaatccaaaaaactaagaacatccgaa ggcttcgaaaatttttgacgttcttataaaaaaaaaacgtgtattctttg aaaactcaacctctgatattCAAGGTACGATTCAAAGACACAATGGAAGA TAGACTTCCAGGCGtttttatatgttcatgttacACCATACGTAGTTTTA GCTAGATTCAATTGCGTGAGatattaaagggacattaaagtagtaaaatg taaacattgcgcgaaccacgtgttatcaaagagaacaattaaaatcacgt gtccaaaacaaacttgtaaaacaattgaacaatcaaaattagccatattt ggtttgattttttattttgacatgtgacatttgttttgattttgtatccg ctgcatacagtttgtttacaaatttcgcaagtactgttatgtccctttaa gcaaGAATATTTAGCAAAGTTTGATAAGATAAGTTTTGCAAAGACTACCC TATAGTAATGAtatccaatttttttcttttcataccaAAATGATCGATTT GTGCATGTAATTAGCTGTCAGGTTAAAATccgtattttgtttttttagaa cCGCTCGATGGGGACTGGTCACAATGGGGCCCTTGGGATGTTTGTCGCAG ACcatgtttccatggtgatcAATTTAGGAGAAGGACATGTACTAATCCAG CACCTCAGAAGGGTGGACGTGGTTGCCCAGAGTCTAGTGGTCATCATCGG ATGTGCAATCCAAACAGTTGTAAAGGTATAAATAATCACTTTATCTTtaa tctcataaccgatcaccattgctacggcatatgatgatctgaaaagtttA TGCAGCGGAATTTTACAAAACCGCGTTCGAGGTCTGGGGAaaaaactaca cgtttttttcattagaacacctaaaatttggctgaggctggatgtgctta ttcttttagcaattttcaggctgaaatgttcttaaatgcgttcttatttt tcagactcctttaaatcgacaatatcatgcaaaataaagagcacttaaaa ttggtaaaatccggacaatatttgactcttgattttagaaaatccatccc taattcagttaaaactgcttgaaaagaggaaaaaattgtagtttttttgt tattttttccaaactgaggctgggcatgttcttacaatgttcttatacac taggttctaataaaaaaaaaacgtgagTGACACGTGACCAGATACCGGTA TCCGATTGGCCCGCAGTTTTCAAGATTTATCTATCATTTtataggaaaat tttttttgtaagaactagtAGCAAAAACCCCTGTATCTTTTGAAATAGTg aatattttccaagaatttgTTCAGATGGTAACAGGCAATTGTACATGGAA CAATCTGAATCTTCACCTGCCAAAAATACTAACCTTTTTGCTGCCGAAAT TTCCTTTGAGCACCTGAAAATATCATGTAAACAGTATCATTTAAATCTTT TTCTCATTTAgaccttttcaagccaaaaataCATTCCAGAACTTAGAGTT GgtatttgtttattttccaaATCTATTAAATTTCACACACGTTAAGTTAT AATTATTCTGAAAAAATGCTTGATTCCAGTCAATCATTAAGGAGATAGTA GGAATGAAGTACACATTACATAAAAGAACACACCTGTAACAATTTGCTTG GTGTTTGAGCCTTCATCttgaacaaaaatgagaaaacatccAAGCTAAAT CTGTGTGAAAAAATGCAACTTTTAAAACAGTCTTTCAAAGCTTTTAAGTC AATAAGTATGAACAGCCACTTCTGTTGGTGTAAGTTAAGTTAAGTGTAGC TCCGCATTTATTGAactttcctttaaaagtctcaaaatccataaacaaat caaaacattgagtaACAGTTAAAACGTGAATTTTAggcgccatcttgaat tttgttcGGAGCAAGAAAGCCACTGTCGCAGTAGAATCGATTTTCTTTAG CCCACGCATCCTATGACGGCCCAAGCAAATCGATTTAATTTTATGCGAAT GCCCGCGATTAAATCGCGAAAAGTcctctgaaatttcagagtgtcGGCCA TCAAAGAAAACCCGAGAACCTTCGCAGGTCTTCTTGCAAAACCATTGTGG AGCACGAAGAGCTGCTTGGAGGTTCCTTCATCTTAAGATGGAATATCTTA ACACAGACCCGTAAAAGCAAATAAACTCGCAAATTGATAGAAATTGCATT ACCCTCTGATAAGCGCCCCCGCTAAttaatctttcgaaaattttccaccc tgGACATTtctattccaatccccccgtaTTAGGTACCCAAGGGTATGAAT TATACGAAAAAATGACATCACTCGCACGTCGCAGACTacatttaaaatag ttctagccAACGTCGAAACCAAGCcactttgaatttcaaaatacgaaaat taaaGCTAATCTATACTGATAAATAAACAATCATCGTGCGCTGCTTTGTT TCGATGATTCATTTAAatatggaggtaataaaaatatagatggagatacc actcctactattctattAGTTCGAGAGCTGTCGGCCTTTTTATTAGGTCA TAAGCCTCAGAATTTTAACCATCCTCAACGTGTTTGCCGTatcgaaaact gtcaaaaaagaTTGTCAGATCGAACACTAGCGGTCTCTTTGAtctccacg agcccaaaaaGGAGGTCAAAAAAGGGCTTAAATTTAGGTCACGAGCCTCA TGGCTGAAATTTTACAGGTGATTAGTACAACCCTTAAggacaatgaaaat cgaaaatctaaccaaaaaatcCAGTTTCTTGACCTGGTCAGATGCCCAAA AAAGAAGTCAAAAAAGGGCCTAAATTTAGGTCATGAGCCTCATGGCTGAA ATTTTACAGGTGATAAGTACAACCCTTAAGGACAATGAAAANATCATTGT GTCGTAATGTTatcatcagttgctcaaaatagccaaaatctttagttttt cttactttttactcattttaattcaatttttctatATATCAGATGCTCCC CTTNagaaaatcgaaaatctaaccaaaaaatTCGGTTCCTTGACCAGGTC AGATGCCcctgaagttgaaaaatttgagaattttcggGGGGTCGAAAATG ACCCCCCTCTTAGACGAAACTTTCTATAGCGTTTGATCTACTCAATATNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCATTCtccag tgtgtccataacatccaattacactttggggaaaatttatgtcatttttt atgacgtcattgtgttaatatgacgtcatcagttgctCGTCAGTCGCTCA TCAGTTGCTCGTCAGTCGCTCATCAGTTGCTCCTTATGGCCAAAAGGGGa ctcatttttaagtttttcttacttttacctATTTTATTTGGTAgataccc ctttttcattctcctGTTATCTCTTTGGGCTGTTTGAAAGACGAAGTGGT ACTCTGGGTTTCCTCTTATACGCCAGACAAGTTTTGAATCAGTGATCCAG TATTTTGTTTTCTCTTAcctgtttcttttctttgataTTGAAATCTTTCC TTATGCAGAACCTCTActtaagtgaagaaatttttgcagaatttaatttc gtggttttttgacaaatccacGTTATTAAATTCCGCCGAACACTAATATC CTCAAGATTTAAAAATCACCTCTAAATTTGGTCTTTTAACGAGAAAATAG Gccatattgtaaacaaaaattatcttaaccgtgaaattaaattacgcgaa aattccgaattttgagctgtgaaccgcgaaattaaattctgtgaaaattc cTTTCCATGAAAATTTCTCCACTTAAGGTAAATAATGGGAGCATTTTGAA AATGAGACTAGGATTGGTGTAATACATCTCTGGGTTACAGCATTTTTCAA GTCATCGTGGAGTAACTAATGGAGTGACTCTGAATTTACGGATCCAACAA CATTTTACCCAATGCCTAACTATAGTATATAGCTTTTTAATTATAGACGT ACGCCAATCTATGAGTTGATATCATTGCGCTGATTATGGCGTAAATGACT CCcaaatttgtgaaaatcgcaAATAAGGctaaaagaaaatcatcaaaTCG AGGATTTATAGTAAAATTACATTGAAACTGCTGTTTTAGTTAAGTTATAT GGATTTGGAGAGACAAATTGGACAAATTTGGCCAGAGGAACTAATTATTA AGACACTTAAAAATTGACGATCAAACAAAGTTTTACCAGTTATTTGACTT TTGAATATAACCTCATTCGAAAGTCAATGTAAAAATTCgtctccaaaacc atccccaacGGATTTAGCtgagaataataaaatttctatccttGTCGGGC TTTTGATAGAGAACTTTTTATTCcccctttttgaaaatgttccaCCGGGA CTGTTAGACAGGGTTGTTAAACTCCCACAATACACCTTTCTTTTATATCT TAATAATGTAACTAGAAGAACTTGCCGTGGGTGTATGAATTTTACACTGT GATGACAGATCACCATTATATCGCCTTAAGATCTACGCTGTAGTTTGTCG GGATCAACCCAGCGTTTGTCTGAAATCCACGCGGGTCACGCAGGTCACAC ACTTTAGATTTGAAATTTGTGgctttatttttcaacctaagaGATTTCTT ACTCTCCCTTCGGGCCTCCAATTGAAGTAAATTAAAGTAATCTTAATTTA GAGCACTTATTAACGACAGACGTTGGTACAATCGTGAGCGCTATTGGAAT CACAAAAAGGCGAGCTAAGGGAATGGCTTCGAGTCTgatatttcaatttt cgaagtctaatttttaaaacatcataATAAATTGTTTCATTGTACGACTA AGATTTACAGATACCTTAATGATAAGAAGCTCTCACGATCATAGGTCTTA ACCCGTGAAATTCTGAAACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNattttgagcaactgatgatGACATTACGacataatgacgtcatc aaataatgacataaatttccaACAAAGTttaattggatgttatggacaca cttgAAAACGAAAAAGTGGTATCTGTTATGAAAATATGAGTAAAAAGTAA GGTGAACTTAAAAAGACTccccttttggccattttgagcaactgatgagc agtcgatgacgtcattacgacacaatgacgtcatcgaaaatgaCATTAAT TTTCCCcaaagtgtaattggatgttatggacacactggaGAATGAAAAAG GGAGCATCagatatattaaaaaaattgaattaaaatgagtaaaaagtaag aaaaatttcaaattttggccattttgagtaactgatgacgtcattatgac acaatgacgtcatcaaataatgacataaatttcccacaaagtgtaattgg atgttatggacacactgtCCAAATTTCATCGCTAAATATTGAGTAGATCA AACGCTATAGAAAGTTTCGTCTAAGAGGGGGTCATTTTCGACCCCccgaa aattctcaaatttatCAACTTCAGGGGCATCTGACCAGGTCAAGGAACCA gattttttggttagattttcgattttcactgTCCCTAGCGGTTGTACTTA TCACCTGTAAAATTTCAGCCATGAGGCTCATGACCTAAATTTAGGCCAtt ttttgacctcttttttgggcatctgaccaggtcaagaaaccggatttttt ggttagattttcgattttcattgtccTTAAGGGTTGTACTAATCACCTGT AAAATTTTAGCCGTGAGGCTCATGACCTAAATACAAGCccttttttgacc tcttttttgggctcgtggagaTCAAAGAGACCGCTAGTGTTCGATCTGAC AAAATTTATTTGACAGTTTTCGATACGGCGAACACGTTGAGGATGGTTAA AATTCTGAGGCTTATGACCTAATAAAAAGGCCGACAGCTCTCGAACTATA TTGTATTGTTGTATTATTGACTATCAATgattggtaatcaaaggaggccg atttgaaagaaatttctaaagagttttatgaaTTATTTggctattacaga aaagttgttactccatctaacttttattacctctatgatttgaacaaatg ccagttggtctaaacgcagccatatTTTTCATAAGCGATTCCGACCTCCT CTTGAATACCACTATGGAATTATCATAGACACTGAAAAAACAActatttt tgccgatttctcatGTTCAAGTCTTGTCAGAACAGAAGTAATTCTAGCTT TTACTATTATCAAACATTTGCCCagtaaaagaacaaaaagaaaaagatag aGAACAGCTTCCATGaaagttgtcctttgcggacaaagccgattattttt tgaaacaatagaaatacaaTACTTCACTCTTCACCGTTTTATGcaatgtt tatccagagtctctataataaatccatgtaCACCGTTAACTTAGCTTTAA CACAAGATATCTGCATAAACTTTTCAGCATTCAAACCATGCTGTtgtgcg cagaaatgtaatacttgcgcagaaatgtaatacctgcgcagaaatgtaat acttcctgcgcagaaatgtaatacctgcacaaaaatgtaatacttcctgc gcaaatttgtaatactcgagctgcgcagaaatgtaatacttgtctgcgca gaaatgtaatttgGAATTCGTTATCCTTTCAAATATCATATTCTATTCTT CGAAGAAATTAACTTCAacaaaaagacttagaaaattttcgaaaaaaatt tgaatttctttataagaattaaatctataactctcgttttagggcaaatt tacTGTCGGTATatatggttcttacaaagtaaacaagtaacgatgcaaaa gatgggcaaatttgtttttcttataagaattttttttataggaaacgAAT CTATAACTATCGTTTTAGGGTGAATTGGCTGTCGGTttatggttcttaca aagtaaacaagtaacgatgcaaaagatgggcaaattcgtttttcttataa gaattttttttataggaaacaaaTCTATAACTCTCCTTTTAGGGCAAATT TACTGTCGGTATATGGTTCTTACGAAGTAAACAAGTAACGATGCAAAAAA tgggcaaatttatttttctcataagaattttttttataagaaacaaatct atATCTCTCGTTTAAGGGCAAATTTACTGTCGGTatatggttcttacaaa gtaaacaagtaacgatgcaaaaaatgggcaaatttatttttcttataaga atttttttataagaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTACATTTTTGCG Caggtattacatttctgcgcaggaagtattacatttctgcgcaggtatta catttctgcgcaagtattacatttctgcgcacaACACATGCAATATAATG AACCGTCTCTTTTTATAGATTTAGATTTACATTCATCATGCAAAAGAGAA CAAGGGGAGTGTCTTGATGAAAGCGGCCGTGGACGCATTCAGACAATGGG TAAGAAGCTAAATCATGGAAAAGAGAAAGATTGTCTCGAAAAATGTATGG ACCAGCTCTACTACGGTTCAGGTTGTACTTTCATCAAAAGTACTGGTTAT TGCTATACTCATACAAAAAGAGTGGCAGGAGGAAATGGAGATGATGGAGC TTTTTGTTgggtatttaaaaaatgtaaaagtaaGACGTCTTATATTTTTG TCTTTGTTCGTTGACTCCAGATTTCTAACAGTGTTTTGTGTCACATACAT CATAATTATTTGTAAGACTTTCATACAATTGCAAGCATTTagggtgtttt tccactgacGGCTTAAGCTAAATGGATTACTGTAatgtaactttttataa aacgatGAATAGCCCaaacttttcaaataatttttggatgaaaagagatg gttgcacattaactttttctattcagaaaaatattgtattttCTATAGCA ACACAGGAGAAAAATAGTATTTTGCACGCATTTTCTAATTAAAAGATTCA ACGatttttctaccatttttaaaaaaagtggtaccctaatagTAGCACTA CTCagtagcggtgtaaatgcatccaGAGCGCTAAAAACacttttcctcga atacttttgatgatgtagcgtgACNATAGcagtgtaaatgcatcgagagc gctaaaaacacttttcctggaatacttttgatgatgtagcgacgttagac gttaatttttaacaccgCAAAGACTTTTGTGCTGTTACCACTTGCTGGTA TCACTtccaaaaaaaaactccgattaaAGCAGACAGCAGATATAGCTTTG CCCAGGTTATTATAAAGGTCAGCGAATTCAATCTAGCGGAAACTGTTTAA cagattattattatttaatttatccCTCAGTTAATGGCAAATGGTCAAAA TGGGGCGCATGGGGAGAGTGCAGTGTATCATGTGGCCCTGGTGGTAAGCA AACTAGAAGAAGAACATGCAACAATCCCATACCTAATGCGGGTGGATTGG ATTGTCCAAAATCTGATAATGACAGTCAAACTCGGAATTGCAAAACACGC NACAATCCCATACCTAATGCTGGTGGATTGGATTGTCCAAAATCTGACAA TGACAGTCAAACTCGGAATTGCAAAACACGCATTTGTCCAAGTAAGAAAT GTTTGTCCTATATAAATAAATGTCTCAACCAACAGCAAATTGATATTTAT TGAAAAGTGTTCTATTCGTATTCTAGACTGGCACACCAGTCGGCCTTGAA CGATATCACGCGAGAGAAAGTGAGCGTAAGAGGAAGATTTTTTGCCGAGA GGGACTGAAAGGACACCTCCTATTTCAACAAAAATCCTTTACCCTTTGAT TCCCACCCTCATAATcattgatgatgtcatcattatttaaaaatgctgaa aataggGCCCCCATCCTTCCTTATTTTCAATCTTGAATTCTTCTTTTGAA TTCAGGTCAATTTTTTTGCCACTGcatcgtgtattttacagatcaACCCA AATTTGCCTTGTCTGCCTATTGCCTAAAGTAGTTCTAGATTACTGTAGCT ATctgcaatcatggtcgtaatatttgagaaaaaagggaaaaccactggga agttttgaaaccacaatcgatttgtaagtgctctaaagtaggttggaagg gtagctTTAACTCCGAGCTTTAACAATttgagagatggcccaaaatcaac tttctcgcccaaactccaaatttcgaataAATTTCGACCATGATTATGGA TTGGAAAATATtatggcttgaaattttgataagTGCGATGTATTGACGAA AATCGGACCCGTgtttaaatattaaaatcagtattttgggtaagggagcg gtcattaagtatagCATATACCGGGTGGAAGGGATTTGGGCAGggcaaga aatttttttccctCTTTTGGGTAGTGTATGAAAAAAACTTGAGGGCTTTG AGTAGGGTACGAAAATAATTTTAGCAGAATcttatttcaacaaaaatttc aattttgtcaattttaaaacTCCATTATTCTTGCGAACCCTGAAATCtga gaaattttaaagtgcCATAAAGCTGCCATCTGGTAAGGGGTagggtaaaa aaattttcatccagtTTTTGGAAGggtatgaaatttatttgagaACTTTT GGTAGGGTATGAAAATAAGAAGTCTGCCAAAAAATCCCTTCCACCCCGGT ATATGctatacttaatgaccgctcccTAAAATAGGACCAGTCTGTAACTG ACCAACCACGTTTATGGCCGTCTTCAAGTGTCAATATCTATAACTAATGA AAGTTTTAAGTCAAATTTATCAAGCTTATTGGCCGTATTCTAGTCTGACC TAACCAAAATTTTGCAGATCATCACAGTTTTCTGACATCCTACCAGTGGT CAGAATTCAAGGTCATTAGGTTTTCTCGGTCATGAGATTTCATATAGGGC TAGAGCACCCCCTTACAAAAAAGAGAGGTCTTTCAGTTCAGAACTCCACG ATCTGTGTAATTTCTCAGTTTGTATTTCTTCGATTACAATCTTCCTTAGC AGTAAATCTTTTTAGTTCAGTCAATATGGGTGACCTTAAAATTGCCTACC AAGCAGTATAATATTTTTACTTGATGAATTTTCAGCTCATGGCAAATGGT CGGCATGGGGCTCATGGGGAAAGTGCAGTGCATCATGTGGTGGTGGTAAG AAAACTAGAACAAGAACATGTACCAACCCTGCACCTCGGCATGGTGGAAT GGATTGTGGAGACTCTATACCTCATATTTTGAATTGCAATTTAAAGTCCT GTCCTCCAAGTAAGTAATGCGACTCATTATTTGATCCCTTTTGATCCTCT CATAATTAAAAAATAGGATCATAGCTGCAGTCGAGCACAAACCTATAAGG TTTCAGAACTAATACTTGAGTAAAATACATATAGATCTGTAATGTATTAC TCATGTGCAGGATCGATCAATTTTACACACTATATTTGATGACCAATACA TATCGTCGGTGAAAACTTATGACAAACCCCAGATAGTTCCTGAGTTTTGA AATGGGTGTGTATTTAACAGacgtttttacaaaaaaatcgaTTCAAATTT ATCAAGCTTATTGGCCGTAttctcccagctggcacacaacgttggttcaa cgttcatctaacgttatatggatgttgtgaacattagattaacgttgaaa caacgttgtgtgccagctgggctggTATGACCTAACCAAAATTTTGCGGA TCACCCCTGTTTTCTCACATCATACCAGTGGTCAGAATTCAAGGTCATGG TAGGTTATTCTCGGTCTTGAGATTTCATATAGGGCTAGAGCACCCCCTTA CAAAAAAGAGAGGTCTTTTCAGTTCGGAACTCCACGATCTGTGTAATTTC TCAGTTTGTATTTCTTCGATTATAATCTTTCTTAGCAGTAAATCTTCTTA GTTCAGTCAATGGGTGACCTTAAAATTACCTACTAAGCAGTATAATATTT TTACTTGATCAATTTTCAGCTCATGGCAAATGGTCGGAATGGGGCTCATG GGGAAAGTGCAGTGCATCATGTGGTGCTGGTCAGAAAACTAGAACAAGAA CATGTACCAACCCTGCACCTCGGCATGGCGGAAGGGAGTGTGGAGACTCT AATACTCATACTTTGAATTGCAATTTAAAGTCCTGTCCAAGTAAGTAATG CGACTTATTATTTGATCCCTTTTGATCCTCTCATAATTAAAAAATAGGCT CATAGCTGCAGTCGAGCACAAACCTATAAGGTTTCAGAACTAATATATGG GTGNGATCCTCTCATAATTAAAAAATAGGATCATAGCTGCAGTCGAGCAC AAACCTATAAGGTTTCAGAACTAATACTTGAGTAAAATACATATAGATCT GTAATGTATTACTCATGTGCAGGGTCGATCAATTTTACACACTATATTTG ATGACCAATACATATCGTCGGTGAAAACTTATGACAAACCCCAGATAGCT CCTGAGTTTTGAAGTGGGTGTGTATTTAACAGacgtttttacaaaaaaaa tctaTTCAAATTTATCAAGCTTATTGGCTATATTCTGGTAtgaccatgaa catataaacgactggacatccatctcctttgtcgttttgtagaaaaggct gctagcttcgttgccgcctcgttaaaagcataaaatgaaacaaaagattt tgatgatataccacttgggaataccttgctaacaactcagaacttcgaca aaagtctctctgttgttctactcttctcaagtcgtttatctatatcataa caaagataacagaggcaaaatcatcgtcagcttgtcaaaactccgactaa tatttctaaattttgacttgaaaatgtctaataattttagagagtgtcac attctaatttcgatattcttatgaaacaggctctcaactttgacaagcta ttttttttaagtcataaaaaaaattattggggtgacaaaagggattcaaa agtatacacgcagttgaaattctgcattttagagttgaaaatgtagataa aatatattgcaaacttgtgaaaaaattcgaaaataatttttttgtgcatt aggagtaatgttcaagctctatcattccttttacctaaataattcaaaga aataaaattatgacggaatattgtcggatttttcataccaattttgaaat acaggcggcaacgaagctcgattcaaagagacaataaaagatagacgtcc agtcgtttatatgttcatggtatgACCTAACCAAAATATTGCGGATCACC CCTGTTTTCGCACATCATACCAGTGGTCAGAATTCAAGGTCATGGTATGT TATTCTCGGTCTTGAGATTTCATATAGGGCTAGAGCACCCctttataaaa aagagaagTCTTTTCAGTTCAGAACTCCACGATCTGTGTAATTTCTCAGT TTGTATTTCTTCGATTACAATTTTCTTAGTAGTAAATCTTTTCAGTTCAG TCGGTGACAACTGGGCGACTTCCTTTAACCTAGAATCATAATAACCTAGT TGTAAATATTGTTATTTGATAAAGTTGTAGTCCATGGCAAATGGTCGGAA TGGGGCTCGTGGGGAAAGTGCAGTGCATCATGTGGTAGTGGTCAGAAAAC TAGAACAAGAACATGTACCAACCCTGCACCTCAGAATGGCGGAAGGGATT GTACAGACAttaaaaatgatattgaaaatcAGAAATGCAATACGAACACA TGTCCAAGTAAGCAACCACTACTTTTTTTTGACCCATTGAGTTTGAAATC TTAAAGAGGATTGTAAGACACTAACCAGGCAGattcatcttcatctttat tcatcATTGGTCTAAATTTCAAGTTCATCACAGTGCTCAATCTTAAGATT ATAATAGGGGtggccattttgaaaaaatcgaaGGATGCTCGGAGGATTAT GATTATTAGAAATCCAACCAAAGATAATAACGAGCTAGCTGAAAAAGTTT GTAGAATCAATGTGTTCATTTGAAACCAGACTGCTTAAATGTAGAGatac aaaattaaacaaaaatcaGAAGTGTTTATACTAATTTTAACGGAGAGAAT TTTCTTatatccaagccacgataaacttccaatcccgggggggggggggN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNcccgggggggggggtactagggttgcgagctga cgggggggagccgcccgactttcgaactttggacccttactgggactaaa aaggagaagacagaggaaaattttgggaattttacgacccttagcgggac aaatttgaccaattttgatcaaattttgatctttcagggggtaaaaagtt gaaattttcctatttttccgacccttagtgggactgaaattagattttct gttttttccgacccttagtgggactttggaagtccaaaaaaggtactctt aagggcggcacataccgtaccctccatttgcctaagtacccccccccccg ggctNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNGGAATTGTGGTCAGATGCTTAGATGTGGAGATAT CGAATTAGACGTTTCAAACCTTTGCCCTGAAACCTGTGCTGCCACGACTC GTAAGTTCTCTAAATCTGCATTAtaattacacttttttcttttataagaa catcgaggctgaaaatcaccaaaaattaagaacaatttaaggacAATGCT GAGCCTAAAATTATTTAacttcaagcaatttaggggtcaaagtagtaaaa agaGGGTATAACGCCtataattataattataattGGTTAATTTTTCCCAT TTGGTGCGCCTTCAAATAGaacaattaatcgttaattgcattctgaagag agcaattaatcgttatcACACTCTTTAATGAAGCGCTAATGTTTACAAAA TATAGAGTTTAATGTTCTTCTaatgttttaatttcatttatatTACATTC TGTGAGaaagaaaaactatgaacatcaATTAAAGAAAAACATAGAGAGAC AGcgaaaaagaaatacttttagTGTAATTTTCTTTCACAACAGAAAAAAG TAGCGAAACCCATTGTGTGATTAGcttgtaatcacatgataactcaTGCA GTTCGAAAATCACACTCGCGTTATCACGTGATTACACATACtaatacctc aattacaccctataaATGAGAATAGGATAAGATCAATTTGAGACtcaagt gccaaaaaaataggaacagccgagcctcagcaaaattttactggttgtta taaaaaaaatgtcacatatcATACTAACATATACCAGAAAGTATGCATTA CCTAATccgggaaaacttcgtcgggaaaaattttcgtcggggaaaaatat tcctcacttggccaaaatttcgtcacttNCAATACGAACACATGTCCAAG TAAGCAACCACTACTTTTTTTTGACCCATTGAGTTTGAAATCTTAAAGAG GATTGTAAGACACTAACCAGTCAGAtggatttccaaaaattttgcaattc atcttcatcttccatTATCCATATCTACCATTGGTCTAAATTTCAAGTTC ATCACAGTGCTCAATCTTGAGATTATAAGAGGGGTGGCCATTTTGCTCGG AGGATTATGATTATTAGAAATCCAACCAAAGATAATAACGAGCTAGCTGA AAAAGTTTGTAGAATCAATGTGTTCATTTGAAACCAGACTGCTGAAATGT AGAGatacaaaattaaacaaaaatcaGAAGTGTTTATACTAATGAAGACA AATTTTCACAGAGAGAATTTTCTTatatccaagccacgataaacttccaa tcccggggggggggggactagggNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNgtgtaataaagtctctctaagggta tgacttttttcaaaaatcgaaaaaaaaaaatcaaaaagtctctctaaggg tcggttttcggaggtcccgtccgcacatacccctcattctccaaccctag tacccccccggagtaacttttcaaccaaaaagtatttcttactTATAATG TCGAAGGATTATGTTTTAgctgaaaaatttttcttgattttagtTGGGAC TAAAGACAATAACGAAGTTGCTGAAAAAGTTTGTAAGATGCAATGTGTCC ATTTGAAAGGGAAATGTGGTCAAATGCTTAAATGTGGAGAAGCCCAATTA GATGTTTCAAACCTCTGCCCTAAAACATGTGCTGCAACGAGTCGTAagtt ttctaaatttgaattttagctAATTTTTCGTTAACATGGAAAGTATGAGC AATCTTATTGACTTAAAACGCGTACATAACTGCCGTCGGAATACCAGACC GCGTTCAAAGAAAGGGGCCttatccagggggggggggtacttaggcaaac agagggtacggtatgtgccgcccttaagggtaccttttttggatttcaaa agtcccgctaagggtcagaaaaatcagaaaatcaaatttcggtcccgcta agggtcggaaaaataggaacatttcaactttttacccccggaaagatcAA AATTACGGGTCGTataattcacaaaattttcgtttgttttctccttttta gtcctggTAAAGGTCCAAGGGTCGTAAGTtgggcggcaccccccgtcagt tcgcaatcctagtaccccccgggggtCTTGTAAGCGAGAGCCCgtatttt gtataattttacgAATAGAAAAGTTTTCTTCTCGCTCGCAATACACAGCA ACTTAGAATCAAAAGAATGTTGTTACCTTTTTAATGACCATTCGattctt tttcgaatgtttcgatATTGATTTCATCCAAATGAaagagagaaaaacaa aacaaagaaaagagaCACAAGTAGGCCCCTCAAGTAGAAAGAAAAGTTTG TTGTAAAACAGTATCATACTTttacaatatgggatatatttttctcgtCT AAAGGCTcgaaaaatctgaactcgaaaaatggGTATATCTGATATTGTAC TCGTTACCAATTACCATGCCATAACTATTATATATCAGAtcccaataaaa aataaacccctgttttgtgacatttttactgtcagccAATAAATTTACCA TAACTAGGGAAAATTATGTTACACTTAGAATCGCTTTGATGGTTAAGCTG ATGAAATTAGCTATCCATTGCATAAAGTCCATAAGGGGCGAATTTTTGTA GCTTAGTTAAAGGGGAGTTACAAGCAAATGAAGTGTGGGAAAAATGTGGC TTACTGGTCATGTGGCTTACCCAACCAAGAAATTTTGAAGGCTGAGTTCC CAATAATGGAAACAGTCAGAAATATACTTTCTTTTCAACATTGCCAGCAA AGGGCTAAATTTTTCATTAGCTGCACTGATTTGTGGCTTAAAGTTTGTTA AGTGGGCAAAAATGTGGCTTACACAAGGAAAATATAGGTGAATAGGTGAA TAGGTGAAATATAGgtgaaattttaagtttttagcACTCAATCATTAAAG TATAGCACCAGTAAGTGTACAATTTTGTGGCTTACAAAATCACATTAAAA ACTATCGAAAAGTGAGCCACAAAAAAGTACATTTAACAGCTAGAAAGTAT GaacatttaacattttttttaagattcaaCCTTTCCTCTGTCAAGTAAAG AAAGACTCGCATTCTAAGACCTCTTATCTAATTTGTGTGGCTtacatttc taaaaaagatacaaattttGAGTTGGAGCCACTTTTTTAGCCCAATTAAC gagaaaaagttgtaaaatcTCAAGACTTACCGATTAAGACTTCATCAGCT Atgacaaaaagttgtttttgggcatttttcaaaatgtcacactattttta aTTGGGATCATCAGCCAAAAAAGTGTAATAGATATATACTAAAATTGGCA AAaaggatttcattttttattggaaagaatgtttttgaattttagataCG ACCAAAGATAACAACGAAGTTgctgaaaatttttgtaaaaagcgATGTTT TCATCTAATTGAGAATTGTGGTCAAATGGTTAGGTGTGGAGATACCAAAT TAGACGTTTCAAACCTTTGCCCTAAAACGTGCGCCACCACGACTCGTAAG TTTTCTAAGTTTGTCTTATAACTAACATCTTAaccaaaaatcataaaagt ttgttttcatACCAATAAAGTCGAATTTTAACagcaaagatttttttgaa atctagatgGGACCAAAGACAACAACGAACTTGCtgaaaaaatttgtaaa aagcGATGTGATCAATTGGAACGCAATTGTGGTGAAATAAAAAGATGTGC GGGATATACAATGTTAGACGTTTCAAACGTTTGCCCTGAAACCTGTGCTC GTAAGTGTTCTAAATTTGTATCATATCTAACATATCAACCAAAAAATATA CCagaattaccttaagggaactttttttggcgagaaataattttggcgaa ccaggattttttttaattttggcgagaacttatctTGGCGAATCAacgat ttttttaattgtggcgagaacttattttggcgtaaatctgttctattttg cctcatttgaagcttttttgtgaactcaagaagttatttaggcaaaatac caaaaattttaattttggcgagaactaattttggcgaaccaggaattatt ttaattttggcgagaacttaattTGGTGAATGGCctaaaaagttaatttt ggtgggaactaagtTTGGCGAATTTGGAATTCGCTTGCCaatttcaccaa aattagttctcgccNaaatttttttaattttggcgagaacttaattTGGT GAATGGCctaaaaagttaattttggtgggaactaagtTTGGCGAATTTGG AATTCGCTTGccaatttcgccaaaattagttctcgccaaaattagttccc ttaaggtattaaaaTAATGTCGAAGGATTATATTTTAACCGATagaattt tctttcattttagacAAAGATAACGACAAAGTTGCtgaaaaagtttgtaa aaagCGATGTGTTCATTTTAAAGGGAATTGTGGTCAAATGGTTAAGTGTG GAAATACCAAATTTGACGTTTCAAACCATTGTCCAAAAACTTGTGCCGCG ACTCGTAAGTATTCTAAGGTTCAATTAAAATTAACATCTCAACCGAAAGT TATAACAAATGTTTTTACGAGAATAAGCTCGAAGGATTATGTTTTAACGG AAAGCCGAAATTAGTAGTTAGAGGTAGTTTTTTTATCCCTATGTATTATA attaaataagaacaatttgaggttcaaagtgccaaaaaaaacccaaaaaa tcaGCCTCAGCAAAATTATACTGGTTTTACTGATTTATTTTCATGCTTTC ATTGTAGTTTGTGAACCTAAAAAAGAAGCAATGGTTATGTGTCATGGACG GTCCTATACATTACATGGGAAAGCAAAGAATGGTGCCAGCGCTAAACAAT ATGAATGGTACAAAAAGAGCAAAAAGGATTCGCTATTACGATTGGATAGC GATTCTCAATACTCAATTACATACTCCGACCGTGATCCAACAAAAAGCAG TTTGACTATTCTTTCTTTCAGTATGGTTAAACACGAAGGACTTTACGCTT TCAGAGAAGCTAATCTAAAATACATCGATTGCTATGATTATAAAGTGAAA GGAGTTCGTAAGTTAAATTGCTCCTTAACACCTACACCCCCCCCCCCNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNccccccccccccccccccgatcaCTG CCCGCCCAATTCTTGACAACCACTAATTCTTAAAAGGATCCCATAATTAT CAAtaaataaaatctcaaaaagggATGACCAATCAAGACCAGTCAAATAC CAACGAATAAGGGCGGCTTAACATAAACGTCCAAGTATCTGTTTAGCcct taaaaaatattataaagttTTAATCCGCACCCTAACCATACTCGAAAAgt tattgaaaaaaagtttgcatcTGATCTAATTAATCGTATTTAGTACCTGA GAGGTGCATTgttggatttcaaaaaaataaatgtctTTCGGTGGTCCTGG ggtttttgctgacgtcagcaattacgtcatttttcaaacaacGTTCCGCA AAAACTTCttttggcttcattttcagacacgggttgtaatgtttttctaa acgagaatgaaaaatgctttccaacggtatgtaacatgacatactttgga gaaaaaaaattcattttagcctgggaacctgttttggtctgtaaaataca caaacaggtgccaattttttgtgtctgagatttaaatccatttttgagcC CTAAACTACAATTGTGCAAAGTCTCATGCTTGTACGCCTTTGTGCACAAT GTTAATGACTTTTGGCACATTTAGACTGCACTATAATGACGAATTGACAC TTAAAAATATGTCTGAAAATTCAACTTATTTAGTTAGTTATTGAAGGTAA TAACTTTTTTCTTTGCAATTCATAGTTCAAGTTGAATATATTGATGGTAA AGATATGTTTGATGTTGTGGCTGGCGAGAATATAACACTTGCAGTGAAAG CAAAAGACCCTGCATCTAAAACAAGNGTCTTTTATTTGCAATTCATAGTT CAAGTTGAATATATTGATGGTAAAGATATGTTTGATGTTGTGGCTGGCGA GAATATAACACTTGCAGTGAAAGCAAAAGACCCTGCATCTAAAACAAGCT GGTCTGTTGATGGACAAAGTTTGATAGAACCTTTAATTAAAGCATCTCCA CATTATAACTTGCCATCTACTGATGATTTTGGCCCTACTACACAAAGTAA GTAAAAGCATCAATCATAAAGATATTCCAATtttaggaaaatattttgac agAGTTTTGGGTGGGCAACTTTGACACAGTCTCGTTTTTTGTGTCTTTAA TGTtacagagaggcatcaagttcAAATTTAGTACTAAGTACGTTGGTATG AACCATTGACCCTACACACCGTAGCCGAATGCTCTAACCTCATGTGCGGT CGTTGCATACATCATACCAAATAGTCGTTTAGTAGTTTTTTGAACTACCA TCCTCGGTCCCTATCACGCTTTCTTTAGTGAAAGAAAACCATTTACAGGG AGCCCAATTGGTGTATTTATCACCTTTAAATTATTCTGTATCTATTGTTT CAGTGTTGGAGATTCTTAATCCTCAACGGAGACATGGTGGAATGTACAAG CTTAAATGGTCAACTGATTTTGATCAATGCCCGATTGCCGATATTTTATT CAACGTTACTGTGAGAGGTATGACAatccattttgattttgaactcTCCT GTGTCACCCAACTGCAAAATTACCCGGTAGGAAAATAACctggaatttca gtcccgctGGGGAAtggactttgatttcatcccccatccaaaattcaatg tttaaaaattgcactccaaaaccatcttcactggattttttaaccttgga acgaTAGCTATCGATTCTATCCCCAccgggatttcaataggaatttttat ccccaccgaGGAAAAAATTCCAACGGGGCTGTGGAGCAGGGTGATGTTTT AAAAACGAAGCAAGCCAATCTAAAAGATGCATCTAGTATCTCTTCAAAAC TGAAAGTGAAAAGAAAGAATGACGAGTCATGATAATGCTCGCCATCGCCA TTTTGACAATCCAAAAACATACTAAATTGAAACTAGAAGGGTTAAAAGTT AGGAAAACCGCATAATTCCGCAGTGTTGTAATTTTCTGCGACGTTGCGGT GTTTCGAAACGCTTCCACAGAAGTGCTCTGGGTATACAACGCTTCCAATT TAAGTGTGTGATTTCAAATTCTGAACGCCGATCAGTTTTCGCTTTTTCTG AATAAAGTAGCCTGACTGTGAAGAATGATTGTGAAAAATCTTAAGGTAGG AAAATAAAATCCAAGGTTGAAAAGTTGACTTTTGCGTCGTTCTACACTTG ACAACGCTAAAGTTGCGGAATTTCCCGATTCTACGCAATTTCCCGTATGG TAGTACTTATTTATCTCTGAATACCTAGAACGGAATATAACAGCATCCAC TATGGACAATACGAACAACGGTGTAAATACAACAACCTCACCTAACCAGG AACTCAATGCTGGTCAACGAATTGGTACAGAGGAAGAGAGTGATGATTCT GTAGGCTATATTCCATTGATTTTCGGTTCATTCTTACTTGGTATAGCGAA AGGATCTATTGTACTTTGGTTTCTTTATAAAAGAGGATTAGCTCGCAAGA ATCAGAggtaagttatttttttcaactttgtaCAGCTTGTCCAAGAAATA GTATCGGAACGGCATATATGTGTATCACAAAATATAAATAGCCCCAAAAA CTGGCCCCGGAAaccctagtctgaatcgcatacctctatagatatacttc ctatatagaaatatttttcgctagaggataaACAGAAGCCTACGGAAACC CCTTTGATGAATCCGacctttcatttttatattattGCCATGGCTACAAA ATGGGCTTGGTTATTTTATAGAAttcaaaataaagtatttattaaTTTCA GGAGCTCATCTAATTCATTGCTGCTAAAAGCAAATGATGATAAACCCGAC TCAGGGCGAATTGATCAGAATAGCTTAGATGGTGACACTATTCCTGAACC GCAGTACAACGCTCAGCCTGTGGAACAGAATAGCTTCGATGGAGACACTA GTCCTGTATGGCAGAACAACGCTCAGCCTGTGGAACAGAATAGCTTCGAT TGTGACACTATTCCTGAACCACAGTACAACGCTCAGCCTGTGGAACAGAA TAGCTTCGATGGAGACAGTAGTCCTGTATGGCAGAACAACGCTCAGCCTG TGGAACAGAATAGCTTTGATGGAGACACTAGTCCTGTATGGCAGAACAAC GCTTACCCTGAGGCACAGAATAGCTTAGATGGTGAAAATAGTTTTGCACC CCAGAGCCAGAACAACAATCAACCTGAAGCACAGAATAGCTTAGATGCTG AAAATCACCCTTTTGGTCCTGTAATACAATTTAAGAAACAACCTATAACA ACAGAGAGTATGTTAGATGAGAACACTGATGAGACCAATGACCCTTTTGG TCCTGTTCTGCAAAATACGAAACAACCTATAACAACACGGAATAGCTTAG ATCAGGATAATGAAAAAACACTCGAGACTATCTCCATCTTCAACAAATTG GCTTCTACTTCTTCCCGTAAATTTAAAAGGATGTAAAGCATATTTGGACG TGCTcagttgttttatttttttcaattttatataGTACTTTTAATGACTT GAAAGATTATTTggataataaaaat
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000742XLOC_000742Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001401-exon-sc0000010-1491911889:1069472..1069594TCONS_00001401-exon-sc0000010-1491911889:1069472..1069594Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1069472..1069594TCONS_00001401-exon-sc0000010-1510915933:1069472..1069594Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1069472..1069594TCONS_00001401-exon-sc0000010-1575043694:1069472..1069594Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1070189..1070274TCONS_00001401-exon-sc0000010-1491911889:1070189..1070274Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1070189..1070274TCONS_00001401-exon-sc0000010-1510915933:1070189..1070274Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1070189..1070274TCONS_00001401-exon-sc0000010-1575043694:1070189..1070274Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1072427..1072591TCONS_00001401-exon-sc0000010-1491911889:1072427..1072591Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1072427..1072591TCONS_00001401-exon-sc0000010-1510915933:1072427..1072591Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1072427..1072591TCONS_00001401-exon-sc0000010-1575043694:1072427..1072591Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1072833..1073126TCONS_00001401-exon-sc0000010-1491911889:1072833..1073126Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1072833..1073126TCONS_00001401-exon-sc0000010-1510915933:1072833..1073126Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1072833..1073126TCONS_00001401-exon-sc0000010-1575043694:1072833..1073126Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1076870..1077046TCONS_00001401-exon-sc0000010-1491911889:1076870..1077046Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1076870..1077046TCONS_00001401-exon-sc0000010-1510915933:1076870..1077046Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1076870..1077046TCONS_00001401-exon-sc0000010-1575043694:1076870..1077046Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1085740..1086000TCONS_00001401-exon-sc0000010-1491911889:1085740..1086000Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1085740..1086000TCONS_00001401-exon-sc0000010-1510915933:1085740..1086000Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1085740..1086000TCONS_00001401-exon-sc0000010-1575043694:1085740..1086000Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1086702..1086962TCONS_00001401-exon-sc0000010-1491911889:1086702..1086962Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1086702..1086962TCONS_00001401-exon-sc0000010-1510915933:1086702..1086962Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1086702..1086962TCONS_00001401-exon-sc0000010-1575043694:1086702..1086962Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1088457..1088538TCONS_00001401-exon-sc0000010-1491911889:1088457..1088538Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1088457..1088538TCONS_00001401-exon-sc0000010-1510915933:1088457..1088538Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1088457..1088538TCONS_00001401-exon-sc0000010-1575043694:1088457..1088538Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1089423..1089511TCONS_00001401-exon-sc0000010-1491911889:1089423..1089511Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1089423..1089511TCONS_00001401-exon-sc0000010-1510915933:1089423..1089511Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1089423..1089511TCONS_00001401-exon-sc0000010-1575043694:1089423..1089511Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1090896..1091078TCONS_00001401-exon-sc0000010-1491911889:1090896..1091078Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1090896..1091078TCONS_00001401-exon-sc0000010-1510915933:1090896..1091078Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1090896..1091078TCONS_00001401-exon-sc0000010-1575043694:1090896..1091078Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1098490..1098621TCONS_00001401-exon-sc0000010-1491911889:1098490..1098621Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1098490..1098621TCONS_00001401-exon-sc0000010-1510915933:1098490..1098621Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1098490..1098621TCONS_00001401-exon-sc0000010-1575043694:1098490..1098621Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1099235..1099375TCONS_00001401-exon-sc0000010-1491911889:1099235..1099375Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1099235..1099375TCONS_00001401-exon-sc0000010-1510915933:1099235..1099375Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1099235..1099375TCONS_00001401-exon-sc0000010-1575043694:1099235..1099375Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1099629..1099928TCONS_00001401-exon-sc0000010-1491911889:1099629..1099928Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1099629..1099928TCONS_00001401-exon-sc0000010-1510915933:1099629..1099928Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1099629..1099928TCONS_00001401-exon-sc0000010-1575043694:1099629..1099928Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1100920..1101117TCONS_00001401-exon-sc0000010-1491911889:1100920..1101117Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1100920..1101117TCONS_00001401-exon-sc0000010-1510915933:1100920..1101117Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1100920..1101117TCONS_00001401-exon-sc0000010-1575043694:1100920..1101117Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1101475..1101588TCONS_00001401-exon-sc0000010-1491911889:1101475..1101588Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1101475..1101588TCONS_00001401-exon-sc0000010-1510915933:1101475..1101588Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1101475..1101588TCONS_00001401-exon-sc0000010-1575043694:1101475..1101588Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1102350..1102578TCONS_00001401-exon-sc0000010-1491911889:1102350..1102578Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1102350..1102578TCONS_00001401-exon-sc0000010-1510915933:1102350..1102578Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1102350..1102578TCONS_00001401-exon-sc0000010-1575043694:1102350..1102578Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1491911889:1102873..1103646TCONS_00001401-exon-sc0000010-1491911889:1102873..1103646Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1510915933:1102873..1103646TCONS_00001401-exon-sc0000010-1510915933:1102873..1103646Clytia hemisphaericaexon
TCONS_00001401-exon-sc0000010-1575043694:1102873..1103646TCONS_00001401-exon-sc0000010-1575043694:1102873..1103646Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:1069472..1103646 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0563207 0 0 0 0.0360751 0.191769 0.038128 0.0693899 0.0719722 0.183291 0.604547 0.177724 0.202511 0.0712791 0.0065633 0 0.0345028 0.0699553 0 0 0 0.126026 0.200702 2.46675 1.64724 0.00498879 0 0.0528203 0.147837
Blast
BLAST of TCONS_00001401 vs. Swiss-Prot (Human)
Match: HMCN1 (Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 1.186e-37
Identity = 134/379 (35.36%), Postives = 164/379 (43.27%), Query Frame = 2
Query:  674 LDGDWSQWGPWDVCRRPCFHGDQFRRRTCTNPAPQKGGRGCPESSGHHRMCNPNSCKDLDLHSSCKREQGECLDESGRGRIQTMGKKLNHGKEKDCLEKCMDQLYYGSGCTFIKSTGYCYTHTKRVAGGNGDDGAFCWVFKKCKINGKWSKWGAWGECSVSCGPGGKQTRRRTCNNPIPNAGGLDCPKSDNDSQT---RNC-------------------------KTR--XNPIPNAGGLDCPKSDNDSQTRNCKTRICPTHGKWSAXXXXXXXXXXXXXXXXXXXXXXXNPAPRHGGRECGDSNTHTLNCNLKSCPIVVHGKWSEWGSWGKCSASCGSGQKTRTRTCTNPAPQNGGRDCTDIKNDIENQKCNTNTCP 1720
            + G +SQW  W  C   C  G Q R R C  P P  GG+ C  S    R C    C  +D   S      EC    GRG         N  + + C    +                    H  R   GN  +   C + + C ++G WS W  WG CS SCG  G QTR R CNNP P  GG  C  ++   Q    RNC                         +TR   +P+P  GG  C  SD   Q+  C +  CPTHG WS W  WG CS +C GG+  R RTC NP P +GGR CG  ++    CN   CP  V G W  W SW +CSASCG G+KTR R C +P P  GGR C    +  +  +CN   CP
Sbjct: 4528 VHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCP-VDGSWSEWSLWEECTRSCGRG---------NQTRTRTCNNPSVQ-------------------HGGRPCEGNAVEIIMCNI-RPCPVHGAWSAWQPWGTCSESCG-KGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSD--VQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCP--VDGSWGSWHSWSQCSASCGGGEKTRKRLCDHPVPVKGGRPCPG--DTTQVTRCNVQACP 4869          

HSP 2 Score: 129.413 bits (324), Expect = 8.626e-30
Identity = 96/242 (39.67%), Postives = 121/242 (50.00%), Query Frame = 2
Query: 1100 CKINGKWSKWGAWGECSVSCGPGGKQTRRRTCNNPIPNAGGLDCPKSD---------------------------------NDSQTRNCKTRXNPIPNAGGLDCPKSDNDSQTRNCKTRICPTHGKWSAXXXXXXXXXXXXXXXXXXXXXXXNPAPRHGGRECGDSNTHTLNCNLKSCPIVVHGKWSEWGSWGKCSASCGSGQKTRTRTCTNPAPQNGGRDCTDIKNDIENQKCNTNTCPNN 1726
             +++G +S+W AW  CSV+CG  G Q R R CN P+P  GG  C  SD                                 N ++TR C    NP    GG  C    N  +   C  R CP HG WSAW  WG CS SCG G +TR R C NP P  GG  C  + T    CN ++CPI  HGKW+ W SW  CS SCG G + RTR C++P PQ GGR C    +D+++  CN++ CP +
Sbjct: 4526 VQVHGGFSQWSAWRACSVTCG-KGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCN---NPSVQHGGRPC--EGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPI--HGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEG--SDVQSDFCNSDPCPTH 4757          
The following BLAST results are available for this feature:
BLAST of TCONS_00001401 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
HMCN11.186e-3735.36Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2[more]
back to top