Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001384 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001384
Unique NameTCONS_00001384
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2116

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001384 ID=TCONS_00001384|Name=TCONS_00001384|organism=Clytia hemisphaerica|type=transcript|length=2116bp
caggtaaaaaaaaataaataaaaaaattgaaaacatgtCTGATTACAGCA
GTTTCGGTTCATCCTCATTGGATTCGCTTTCTTCTTCATCGGGTTTTGAA
TCATCACCAAGGTATGGATCAAGTGGTGGTCAACCCTCTTCCTCACAAAT
GATGGAAGCAGTCAAACAACAAATAGCTGTTGCTAATGCTCAAGAACTTC
TATCTaaaatgtctGACAAGTGTTTCAAAAAGTGCATCACAAAACCTGGA
GCCAACTTGGATAATTCAGAACAGAAATGTCTTGCGATGTGTATGGACCG
CTACATGGAAGCATGGAACCTGGTATCACAGACATACACCAATAGACTGA
ATAAAGAACACAGCATGCAAGTGTAAGAGAAGTAAAATGGCTAATAAAAG
AAAACAGAAGACATCAGCTGAGATGAAATCTATTGCAAGCAAAATTATTA
AAATCGAcgagagaaaagaaaaattagtgCCATTTGATTTTGATGACAAT
GATTACGATGTGATAATTATAACAAGGGAAAATGAGGTTTATCTGCCATC
TGGTTTTGTTAAGATGTTATCTAATGGTAAAGATATCCAATTAAGGGATG
GTAGAATGAATATTGACGCTTCTACTGAATGTTTGGTTCGTTGCTTATCG
TTTTATGACTTGCGATTTTGGGATGAGACGCAATTGAAAACCTGAGAGAT
GTTCTATCGGTcactaaaatgttaaaaatgaaGGGCCTGCGTGATCATAT
TGAAAATGAAGAGTTTCTGCCACTCATCCGTGCACCATCGGTCTCAATAC
ATCTTACTGACTCTTTGCTTGCACATTTGGGAATCGCTCATGAATTTGGA
TTGCATtgttttgtccaaaaaattatGGTCCGAAATGTACCCCTTCGCAA
TTTCAATCTTATCAAGTCACCCAGCTTTAACAGATTGCATCGAGATTTGA
GATTCgagattttgaaaaacactaTAAATGATCAATTCTCCGATTCTTCT
CATTTCAACCATGAACTGTTGGAAATACAAATCatctttaacttttttga
ttttatagttTTTGAGAATCGATCTTTGAATGTAGCACCCCAGAAAAGTT
ACGTTGTCTCTCCAGCTATAAACACATCGTGGAATTCTTTTGAAGAGACT
GTTGCGAGAAGATTTATCCCTTATGACAAGGACTTGACAGATTCCGTCAC
TTTGATCGTGGAGAACAAAGAAATCTACGTCAATTCGTACCTCTTAACAA
CAAATTCGCCCGTTTTTAAAGCAATGTTGAACTCTGTGTCTTTCAAAGAG
GGCCAAAGTAAAAGAGTTGAGCTTCCTGGAAAGAAACATTCTGAAATCTT
ATTCTTCCTGCATCATTTACAGACACCTCAAGATATTGGAAATATTATAG
aTTTTCCTGATATTACCATTCTGGCACCCTTATGTCGTGAATACCAAGTC
GATTGGCTGACCAAGAAAATCAAGGATTTTATAAGAGTCAGAGCAGCACG
ACTGAACAAAAAGGGAAGCAAAATTGTTGCTCTTAATTATCTTTCATTCT
CTGAAGAAATAGGTTTCGATGAAAGTAATGATACGCTGTTGGTTAATTCC
TTGTCTTGTGGTTTCCATAGCCTCCAAACATGCTTAGAGTTTTCAGTGTT
GAGTCGCCATAAACAAGTATTGATCGCTAGAAAAAGATTATGGCTTTTAT
TACGACACTTTTTTGACAAGTATCGAGATCTGATCCTTAATGAAGAAGGC
TTTGGATTTCTTTCGCTTTTTGAGGAACAAAcggtttttgattttcagta
cAATAAAACTGAATGTGCTTACATTAAAGAGTTTCAAGAAAAACATGGCA
AAGgcgagtgaaatatttttcgtcCATGAAATATCAGAATTCTTCTTACA
GCTTATTCACAATCCTGCAtcatatcttttcaaaattattacttttttca
aatCGAAAAGACGAGAGAATAGTATAAACTGTACTACTAGTTGGAAAAAC
AAAATTGTCaggaaaatattgacactttaCAAAGCCCGTCACTCCACCTG
ATCTGTTATTTTTGTTACCACTGTGAAAATGTACTTTGCCTacacgtctt
tttataagaacatcca
Run BLAST on NCBI

transcript from alignment at sc0000010:792508..799122+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001384 ID=TCONS_00001384|Name=TCONS_00001384|organism=Clytia hemisphaerica|type=transcript|length=6615bp|location=Sequence derived from alignment at sc0000010:792508..799122+ (Clytia hemisphaerica)
caggtaaaaaaaaataaataaaaaaattgaaaacatgtCTGATTACAGCA GTTTCGGTTCATCCTCATTGGATTCGCTTTCTTCTTCATCGGGTTTTGAA TCATCACCAAGGTATGGATCAAGTGGTGGTCAACCCTCTTCCTCACAAAT GATGGAAGCAGTCAAACAACAAATAGCTGTTGCTAATGCTCAAGAACTTC TATCTGTAAGTATTGCACCCAgttaaatgttttattttcaaaaagagttG AGATATGATTTGGATATATGTTACTTTGCTCTTACGGATATTCTCTTGGC TTGAATCCAGGGGAGTCATTCCTAGAATTACCTCCCTTCTgtcctctttt ttctttcatttttgcaACTCTTTTCAGTGTGGTATTTATTACGAGTCTCC TCAAAAGCTGACCAGGTCACTAAGGCTTGATAGGTGTATTTTTTTACACG CTTTTTAATAAGAatgattttataagaacacgaggctgaaaattgactaa acctaagaacaaataaAGAACAATCTGAgactcagatttcagaaattact aaaaCAGTACTGAACTTAACAGATTTCAAACctattttaagtttttaggT AAAGAAGCTGAGCGTATTAAAAACATTaggagaacatttttaagccaaaa aaattaaaaacagccCAGTCTGATTAAAAATTAGCTGGTTCGTTTCACAA TGatcaaaattttctcacaatgttttcattttacaaactatcttcttatt atttattgttatcattttatttttagaaaatgtctGACAAGTGTTTCAAA AAGTGCATCACAAAACCTGGAGCCAACTTGGATAATTCAGAACAGGTAAA GTGAATTTAACATCATTTTCATTGATCACTGTAACgtgcactgggctcaa cttcagtatagGTGTGAAAGtggaaggcccaattgtaaacacttttttat aaacAGGGACACTTGAGAATAGAGAAGGCTCAATTGTTAATCCAGGATGA TGGGTACTCAGAATAAAGAGAGGGCCTTTGATTGTAAAGTTAGAATTATG AGTCATAGGGTACTCCGGATTAAGGAAAGCTCAATTATAAAGCCCACGTG ATAGGAGCTTGGGATAAAGGAAGGCTCGGTTGTGAATAAGCAtacaatgt tcttagtcaaattactcaatttttttaagagatagatgtttgttttgctc atgagggcttacttttgaagaatatgtatgcttagacatgaaattttggt tgcttggcgtgtttttatagaaaaactagccaaatttgatatttttttat aagcacattatcaattacttaggtattagcttttctcgagattggctctt tcattctttatgactttttttttgcacaaagatgcataactataaaccct cgaatgtgacggagctcgatttttggagaaaacaaaattttgggtaaatt ttagctaaaaaacggctaagaaaagggttttttggacttcgttaaatatt ggatcgttgtttttttcatgaaagtaggtaaaagatggctcaagcagatt gttgtaaaaaaaggattttcagctcaaaaaacgcatgtttatctataaga atcactattaataagcatacatcaatgttcttagcgccaaatttctcaat tttttgatgagatagatgtttattttgctcaggaagtcttgaatatgaaa gaatatttcaagagcatgaaattttggtttctaaacgtttttttagaaga aacaaacgactaattttaatacatcgtcactatttgtcttctgaatgatt gttctaacggtcatgctcacgtagatatcaattatatatgtgttaaatgc ataaccagctAGGTCCATAAAAGTTTCACTTGTTTAGTAAATTTcggcaa aatctttgaaaaaacgagtccctagggtccatttttcgaacctcagtggA GCACCCCGTCGGtaggcaagggtagtacccccccccccggagttACTCTA ATTGCTTCACTTTGCGATCAGTACTGTTTGCGATTGTTCTTTAAAGAAAT CTAATATCTAACCTAGTAACATATTCTTTGAACAAATAAGCAATATTTAC TTTGCTGGACGGGTAACGTCATGCTTTCCATCTTGTGACTGCAAATTTAT TCATCGTTTTAAatactttgatttttttcctttgTTGAAACTTTGTTgta acaaaataacaaatttcACTTTCAGTGTGTTTTGATAGATATTTATgaca acaaatatttttatagaaaatatatataaatcataaatcatttTTATAGA AATGTCTTGCGATGTGTATGGACCGCTACATGGAAGCATGGAACCTGGTA TCACAGACATACACCAATAGACTGAATAAAGAACACAGCATGCAAGGTGG TAGTGGTAGTGGTGTACCTAGTGCCCtcatgtaaacaaaaaaaattactg aACTCTTAAATAAAGACTGGAATAGCAGACATCTCATATGctgttaaaaa tgaaagttaatcTTTGTCTCAAGTAGTAGCCAAATACATGGCACAGAATG TACCTTGTCTCAGAATAATAGCCAAGAACTATTAAAATGCATTCTTTGCA CAAAACTATGAAGATAGATATTAATAATACATCCATTCTAATTCTAGTCC TTCTTTTCGAGCTAGGTAGCAATATGACTTTTTTTAGAAATAGAGATTAG AAtttattttcctatttttgaGCAATAACATGACTTGAAAATAAAGACCT AAACTAGACTACGGTTTGCTGAGATAAACtagacttttcttttttgtaca TTCCTTATATGAAAACTTGATTTTTAAGTACGCATCCCTTTTTGGATTAT GTTTGCCTTACCAAGAAATAATTACGTTTCcaaaaaaattccaattttca ttttctatagtTTGTTTGTATAATCTCCTAAGTCTTATAAGATTTCTTTA TCTTATCATAAGAAGGCTTTGTAAATTTTAGTAGttaaactttcataaaa aatactatataatttttgctaaaattaaGCCGCCAccagttttctttttt cattagGAATTATAAAATTAAGCGAATACCATATAGAATGATTCTTTTGT TGCTTTTTACACCTGATCTAAGATCGGAGGTCTCTACAATTGGTGGGGAA GTTtagaaaccacaatcgatttgtaagtgctctaaagtaggtttgaaggg tagagttttaacgctagacttaagactatctgaggatccaaaagttaaaa aatggtccagtagggcttgaaatatagcctagaaaccaataaatccctcc cagatcgaaataatcgatgaaatcaagttgaaggcccgaaattgagattc tcgctcgaacttcaattttcgaaaaatggtaaattagccaaaagtgccaa tatgttatggcactggtTGTAGTTACACTGGTagaattttaattcaaatt aattatttttaaactcTCACGCTCCGTGATTACAGTATCTTCACACGTCA ATCTTTAGTTTATTCATTTGAAATCTTCCCGAGGTTGCGAGAGTTTAGTT ACTTTGGAGTAAGCGTCTTGAAACCGAGAGTGTTAAGAAACTAAGAAGCT AGTTTTCAAGACTATATTTTCCAATTATAATATGCGACCaaattttttct ctgttttCAGTGTAAGAGAAGTAAAATGGCTAATAAAAGAAAACAGAAGA CATCAGCTGAGATGAAATCTATTGCAAGCAAAATTATTAAAATCGAcgag agaaaagaaaaattagtgCCATTTGATTTTGATGACAATGATTACGATGT GATAATTATAACAAGGGAAAATGAGGTTTATCTGCCATCTGGTTTTGTTA AGATGTTATCTAATGGTAAAGATATCCAATTAAGGGATGGTAGAATGAAT ATTGACGCTTCTACTGAATGTTTGGTTCGTTGCTTATCGTTTTATGACTT GCGATTTTGGGATGAGACGCAAGTATGTAAGTCTTACATTTTTCGAATAT GTTTGCAACATTTTTATGAATCGAATGTGTGCAGTCACACTCTGTCTGGA TGATGGATTAGCGCATCAAGTAGTCTTGATTTCCCAGATAATATAAAATG TTAATATTCATGAGAATGTACATTGAAGAGGAGGCTGAGCTCTTGCAACC CCCGGTACCCATCATTCCACCACTGCGCTCTCGTACGatcatggaaattg caaaaatttatttatcacGTTGAAATAGCCGAAAATATCCCAAATCAAGC ATCACGCCAAATAACACAAGAATGTCAATATGAACAATTATCAATGTCTT CAATAATTGATCCAATATCATTTACTCGATACATTTGAAACCCCACTGGC TATGACGTAATAGACGATATCAGAtaaacgtgaaaactcagatttgacct ccgagaattccccacaatgctttgtgcggaaaaatttcaccttgaacttt tttccgcgcaaagcattgtggacaattctcggaggtcaaatctgagNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttatttg gcacctaagagtaagccgatatcgtctattgtttatcattttgttttatt cttACAGTTACAGTTCTATTATACTTTCTTTTTTAGTTGAAAACCTGAGA GATGTTCTATCGGTcactaaaatgttaaaaatgaaGGGCCTGCGTGATCA TATTGAAAATGAAGAGTTTCTGCCACTCATCCGTGCACCATCGGTCTCAA TACATCTTACTGACTCTTTGCTTGCACATTTGGGAATCGCTCATGAATTT GGATTGCATtgttttgtccaaaaaattatGGTCCGAAATGTACCCCTTCG CAATTTCAATCTTATCAAGTCACCCAGCTTTAACAGATTGCATCGAGATT TGAGATTCgagattttgaaaaacactaTAAATGATCAATTCTCCGATTCT TCTCATTTCAACCATGAACTGTTGGAAATACAAATCatctttaacttttt tgattttatagttTTTGAGAATCGATCTTTGAATGTAGCACCCCAGAAAA GTTACGTTGTCTCTCCAGCTATAAACACATCGTGGAATTCTTTTGAAGAG ACTGTTGCGAGAAGATTTATCCCTTATGACAAGGACTTGACAGATTCCGT CACTTTGATCGTGGAGAACAAAGAAATCTACGTCAATTCGTACCTCTTAA CAACAAATTCGCCCGTTTTTAAAGCAATGTTGAACTCTGTGTCTTTCAAA GAGGGCCAAAGTAAAAGAGTTGAGCTTCCTGGAAAGAAACATTCTGAAAT CTTATTCTTCCTGCATCATTTACAGACACCTCAAGATATTGGAAATATTA TAGGTAAGAATATGCTATTACCTTCAgaatgactttttttaaatagcaCC TTGCTTTTTCATAGTATAAACCTTTATCCTGCCTATCTCTATAGTCCTTT GGTGCTAGAAACCTCATTTTGGGATAATATTGTGATTGGNACCTATCTCT ATAGCCCTTTGGTGCTAGAAACCTCATTTTGGGATAATATTGTGATTGGA GATTGTTGACCATTCTTAGCCCCCAGCCCCTTGTAGCCCCCCTCTTGTAA CCTAGTTTATGAAAACTGTCCCTAGACTAcctcatttttcatctttcaga TTTTCCTGATATTACCATTCTGGCACCCTTATGTCGTGAATACCAAGTCG ATTGGCTGACCAAGAAAATCAAGGATTTTATAAGAGTCAGAGCAGCACGA CTGAACAAAAAGGGAAGCAAAATTGTTGCTCTTAATTATCTTTCATTCTC TGAAGAAATAGGTTTCGATGAAAGTAATGATACGCTGTTGGTTAATTCCT TGTCTTGTGGTTTCCATAGCCTCCAAACATGCTTAGAGTTTTCAGTGTTG AGTCGCCATAAACAAGTATTGATCGCTAGAAAAAGATTATGGCTTTTATT ACGACACTTTTTTGACAAGTATCGAGATCTGATCCTTAATGAAGAAGGCT TTGGATTTCTTTCGCTTTTTGAGGAACAAAcggtttttgattttcagtac AATAAAACTGAATGTGCTTACATTAAAGAGTTTCAAGAAAAACATGGCAA AGgcgagtgaaatatttttcgtcCATGAAATATCAGAATTCTTCTTACAG CTTATTCACAATCCTGCAtcatatcttttcaaaattattacttttttcaa atCGAAAAGACGAGAGAATAGTATAAACTGTACTACTAGTTGGAAAAACA AAATTGTCaggaaaatattgacactttaCAAAGCCCGTCACTCCACCTGA TCTGTTATTTTTGTTACCACTGTGAAAATGTACTTTGCCTacacgtcttt ttataagaacatcca
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000736XLOC_000736Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001384-exon-sc0000010-1491911889:792508..792712TCONS_00001384-exon-sc0000010-1491911889:792508..792712Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1510915933:792508..792712TCONS_00001384-exon-sc0000010-1510915933:792508..792712Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1575043694:792508..792712TCONS_00001384-exon-sc0000010-1575043694:792508..792712Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1491911889:793284..793352TCONS_00001384-exon-sc0000010-1491911889:793284..793352Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1510915933:793284..793352TCONS_00001384-exon-sc0000010-1510915933:793284..793352Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1575043694:793284..793352TCONS_00001384-exon-sc0000010-1575043694:793284..793352Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1491911889:794807..794903TCONS_00001384-exon-sc0000010-1491911889:794807..794903Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1510915933:794807..794903TCONS_00001384-exon-sc0000010-1510915933:794807..794903Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1575043694:794807..794903TCONS_00001384-exon-sc0000010-1575043694:794807..794903Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1491911889:796168..796479TCONS_00001384-exon-sc0000010-1491911889:796168..796479Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1510915933:796168..796479TCONS_00001384-exon-sc0000010-1510915933:796168..796479Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1575043694:796168..796479TCONS_00001384-exon-sc0000010-1575043694:796168..796479Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1491911889:797394..798110TCONS_00001384-exon-sc0000010-1491911889:797394..798110Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1510915933:797394..798110TCONS_00001384-exon-sc0000010-1510915933:797394..798110Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1575043694:797394..798110TCONS_00001384-exon-sc0000010-1575043694:797394..798110Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1491911889:798407..799122TCONS_00001384-exon-sc0000010-1491911889:798407..799122Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1510915933:798407..799122TCONS_00001384-exon-sc0000010-1510915933:798407..799122Clytia hemisphaericaexon
TCONS_00001384-exon-sc0000010-1575043694:798407..799122TCONS_00001384-exon-sc0000010-1575043694:798407..799122Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:792508..799122 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.952097 0.69996 0 3.41119e-08 5.95797e-08 0.166542 0 0 0.27953 0 0 0 2.34241e-08 0 0.388652 0 0.000808266 0.548101 1.02578e-08 0 0.689879 0 0 1.85676 0 5.05884e-05 0 0 0 0.865406
Blast
BLAST of TCONS_00001384 vs. Swiss-Prot (Human)
Match: TIM13 (Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens GN=TIMM13 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.539e-30
Identity = 51/72 (70.83%), Postives = 62/72 (86.11%), Query Frame = 2
Query:  149 MMEAVKQQIAVANAQELLSKMSDKCFKKCITKPGANLDNSEQKCLAMCMDRYMEAWNLVSQTYTNRLNKEHS 364
            +ME VK QIAVANAQELL +M+DKCF+KCI KPG +LDNSEQKC+AMCMDRYM+AWN VS+ Y +RL +E +
Sbjct:   22 IMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERA 93          
The following BLAST results are available for this feature:
BLAST of TCONS_00001384 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TIM133.539e-3070.83Mitochondrial import inner membrane translocase su... [more]
back to top