Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001383 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001383
Unique NameTCONS_00001383
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length999

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001383 ID=TCONS_00001383|Name=TCONS_00001383|organism=Clytia hemisphaerica|type=transcript|length=999bp
CTCCATCAATCAGCATTCATCTTGTTTATCAATGATTGTTTCTAATCTGT
TCTAATCcaggtaaaaaaaaataaataaaaaaattgaaaacatgtCTGAT
TACAGCAGTTTCGGTTCATCCTCATTGGATTCGCTTTCTTCTTCATCGGG
TTTTGAATCATCACCAAGGTATGGATCAAGTGGTGGTCAACCCTCTTCCT
CACAAATGATGGAAGCAGTCAAACAACAAATAGCTGTTGCTAATGCTCAA
GAACTTCTATCTaaaatgtctGACAAGTGTTTCAAAAAGTGCATCACAAA
ACCTGGAGCCAACTTGGATAATTCAGAACAGAAATGTCTTGCGATGTGTA
TGGACCGCTACATGGAAGCATGGAACCTGGTATCACAGACATACACCAAT
AGACTGAATAAAGAACACAGCATGCAAGGTGGTAGTGGTAGTGGTGTACC
TAGTGCCCtcatgtaaacaaaaaaaattactgaACTCTTAAATAAAGACT
GGAATAGCAGACATCTCATATGctgttaaaaatgaaagttaatcTTTGTC
TCAAGTAGTAGCCAAATACATGGCACAGAATGTACCTTGTCTCAGAATAA
TAGCCAAGAACTATTAAAATGCATTCTTTGCACAAAACTATGAAGATAGA
TATTAATAATACATCCATTCTAATTCTAGTCCTTCTTTTCGAGCTAGGTA
GCAATATGACTTTTTTTAGAAATAGAGATTAGAAtttattttcctatttt
tgaGCAATAACATGACTTGAAAATAAAGACCTAAACTAGACTACGGTTTG
CTGAGATAAACtagacttttcttttttgtacaTTCCTTATATGAAAACTT
GATTTTTAAGTACGCATCCCTTTTTGGATTATGTTTGCCTTACCAAGAAA
TAATTACGTTTCcaaaaaaattccaattttcattttctatagtTTGTTTG
TATAATCTCCTAAGTCTTATAAGATTTCTTTATCTTATCATAAGAAGGC
Run BLAST on NCBI

transcript from alignment at sc0000010:792451..795474+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001383 ID=TCONS_00001383|Name=TCONS_00001383|organism=Clytia hemisphaerica|type=transcript|length=3024bp|location=Sequence derived from alignment at sc0000010:792451..795474+ (Clytia hemisphaerica)
CTCCATCAATCAGCATTCATCTTGTTTATCAATGATTGTTTCTAATCTGT TCTAATCcaggtaaaaaaaaataaataaaaaaattgaaaacatgtCTGAT TACAGCAGTTTCGGTTCATCCTCATTGGATTCGCTTTCTTCTTCATCGGG TTTTGAATCATCACCAAGGTATGGATCAAGTGGTGGTCAACCCTCTTCCT CACAAATGATGGAAGCAGTCAAACAACAAATAGCTGTTGCTAATGCTCAA GAACTTCTATCTGTAAGTATTGCACCCAgttaaatgttttattttcaaaa agagttGAGATATGATTTGGATATATGTTACTTTGCTCTTACGGATATTC TCTTGGCTTGAATCCAGGGGAGTCATTCCTAGAATTACCTCCCTTCTgtc ctcttttttctttcatttttgcaACTCTTTTCAGTGTGGTATTTATTACG AGTCTCCTCAAAAGCTGACCAGGTCACTAAGGCTTGATAGGTGTATTTTT TTACACGCTTTTTAATAAGAatgattttataagaacacgaggctgaaaat tgactaaacctaagaacaaataaAGAACAATCTGAgactcagatttcaga aattactaaaaCAGTACTGAACTTAACAGATTTCAAACctattttaagtt tttaggTAAAGAAGCTGAGCGTATTAAAAACATTaggagaacatttttaa gccaaaaaaattaaaaacagccCAGTCTGATTAAAAATTAGCTGGTTCGT TTCACAATGatcaaaattttctcacaatgttttcattttacaaactatct tcttattatttattgttatcattttatttttagaaaatgtctGACAAGTG TTTCAAAAAGTGCATCACAAAACCTGGAGCCAACTTGGATAATTCAGAAC AGGTAAAGTGAATTTAACATCATTTTCATTGATCACTGTAACgtgcactg ggctcaacttcagtatagGTGTGAAAGtggaaggcccaattgtaaacact tttttataaacAGGGACACTTGAGAATAGAGAAGGCTCAATTGTTAATCC AGGATGATGGGTACTCAGAATAAAGAGAGGGCCTTTGATTGTAAAGTTAG AATTATGAGTCATAGGGTACTCCGGATTAAGGAAAGCTCAATTATAAAGC CCACGTGATAGGAGCTTGGGATAAAGGAAGGCTCGGTTGTGAATAAGCAt acaatgttcttagtcaaattactcaatttttttaagagatagatgtttgt tttgctcatgagggcttacttttgaagaatatgtatgcttagacatgaaa ttttggttgcttggcgtgtttttatagaaaaactagccaaatttgatatt tttttataagcacattatcaattacttaggtattagcttttctcgagatt ggctctttcattctttatgactttttttttgcacaaagatgcataactat aaaccctcgaatgtgacggagctcgatttttggagaaaacaaaattttgg gtaaattttagctaaaaaacggctaagaaaagggttttttggacttcgtt aaatattggatcgttgtttttttcatgaaagtaggtaaaagatggctcaa gcagattgttgtaaaaaaaggattttcagctcaaaaaacgcatgtttatc tataagaatcactattaataagcatacatcaatgttcttagcgccaaatt tctcaattttttgatgagatagatgtttattttgctcaggaagtcttgaa tatgaaagaatatttcaagagcatgaaattttggtttctaaacgtttttt tagaagaaacaaacgactaattttaatacatcgtcactatttgtcttctg aatgattgttctaacggtcatgctcacgtagatatcaattatatatgtgt taaatgcataaccagctAGGTCCATAAAAGTTTCACTTGTTTAGTAAATT Tcggcaaaatctttgaaaaaacgagtccctagggtccatttttcgaacct cagtggAGCACCCCGTCGGtaggcaagggtagtacccccccccccggagt tACTCTAATTGCTTCACTTTGCGATCAGTACTGTTTGCGATTGTTCTTTA AAGAAATCTAATATCTAACCTAGTAACATATTCTTTGAACAAATAAGCAA TATTTACTTTGCTGGACGGGTAACGTCATGCTTTCCATCTTGTGACTGCA AATTTATTCATCGTTTTAAatactttgatttttttcctttgTTGAAACTT TGTTgtaacaaaataacaaatttcACTTTCAGTGTGTTTTGATAGATATT TATgacaacaaatatttttatagaaaatatatataaatcataaatcattt TTATAGAAATGTCTTGCGATGTGTATGGACCGCTACATGGAAGCATGGAA CCTGGTATCACAGACATACACCAATAGACTGAATAAAGAACACAGCATGC AAGGTGGTAGTGGTAGTGGTGTACCTAGTGCCCtcatgtaaacaaaaaaa attactgaACTCTTAAATAAAGACTGGAATAGCAGACATCTCATATGctg ttaaaaatgaaagttaatcTTTGTCTCAAGTAGTAGCCAAATACATGGCA CAGAATGTACCTTGTCTCAGAATAATAGCCAAGAACTATTAAAATGCATT CTTTGCACAAAACTATGAAGATAGATATTAATAATACATCCATTCTAATT CTAGTCCTTCTTTTCGAGCTAGGTAGCAATATGACTTTTTTTAGAAATAG AGATTAGAAtttattttcctatttttgaGCAATAACATGACTTGAAAATA AAGACCTAAACTAGACTACGGTTTGCTGAGATAAACtagacttttctttt ttgtacaTTCCTTATATGAAAACTTGATTTTTAAGTACGCATCCCTTTTT GGATTATGTTTGCCTTACCAAGAAATAATTACGTTTCcaaaaaaattcca attttcattttctatagtTTGTTTGTATAATCTCCTAAGTCTTATAAGAT TTCTTTATCTTATCATAAGAAGGC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000736XLOC_000736Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001383-exon-sc0000010-1491911889:792451..792712TCONS_00001383-exon-sc0000010-1491911889:792451..792712Clytia hemisphaericaexon
TCONS_00001383-exon-sc0000010-1510915933:792451..792712TCONS_00001383-exon-sc0000010-1510915933:792451..792712Clytia hemisphaericaexon
TCONS_00001383-exon-sc0000010-1575043694:792451..792712TCONS_00001383-exon-sc0000010-1575043694:792451..792712Clytia hemisphaericaexon
TCONS_00001383-exon-sc0000010-1491911889:793284..793352TCONS_00001383-exon-sc0000010-1491911889:793284..793352Clytia hemisphaericaexon
TCONS_00001383-exon-sc0000010-1510915933:793284..793352TCONS_00001383-exon-sc0000010-1510915933:793284..793352Clytia hemisphaericaexon
TCONS_00001383-exon-sc0000010-1575043694:793284..793352TCONS_00001383-exon-sc0000010-1575043694:793284..793352Clytia hemisphaericaexon
TCONS_00001383-exon-sc0000010-1491911889:794807..795474TCONS_00001383-exon-sc0000010-1491911889:794807..795474Clytia hemisphaericaexon
TCONS_00001383-exon-sc0000010-1510915933:794807..795474TCONS_00001383-exon-sc0000010-1510915933:794807..795474Clytia hemisphaericaexon
TCONS_00001383-exon-sc0000010-1575043694:794807..795474TCONS_00001383-exon-sc0000010-1575043694:794807..795474Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:792451..795474 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
124.215 124.619 67.3919 57.8679 75.9258 62.1902 76.763 83.2614 84.4394 79.9413 57.9986 64.645 40.9074 45.8898 49.5183 59.015 104.533 88.3611 12.7878 20.5843 65.8033 66.8246 80.7119 69.4404 47.0821 54.536 45.1728 29.9773 51.8863 47.4843
Blast
BLAST of TCONS_00001383 vs. Swiss-Prot (Human)
Match: TIM13 (Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens GN=TIMM13 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.391e-31
Identity = 51/72 (70.83%), Postives = 62/72 (86.11%), Query Frame = 2
Query:  206 MMEAVKQQIAVANAQELLSKMSDKCFKKCITKPGANLDNSEQKCLAMCMDRYMEAWNLVSQTYTNRLNKEHS 421
            +ME VK QIAVANAQELL +M+DKCF+KCI KPG +LDNSEQKC+AMCMDRYM+AWN VS+ Y +RL +E +
Sbjct:   22 IMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERA 93          
The following BLAST results are available for this feature:
BLAST of TCONS_00001383 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TIM131.391e-3170.83Mitochondrial import inner membrane translocase su... [more]
back to top