Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001342 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001342
Unique NameTCONS_00001342
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1385

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001342 ID=TCONS_00001342|Name=TCONS_00001342|organism=Clytia hemisphaerica|type=transcript|length=1385bp
caagcaacaaatcataaacaacaaaaaatctGACAAAGAGGAAAAAAGGA
TTCTATTCTCGGAGAATCATGTTTAGAACTGTATTCTTAGGTATTCTGTG
CATTTACTGGTGTGAatgttcaaaacaaatttgGAACCATGCTGCTATTG
GTAAGGCGTACGCCTGGCAGCCTTTTTACGAAGTATCTCTTATGGATGAG
CGACAATGTTTTGGTCAATGCGTTTACAATGAAAAATGTCTCTCATTCGA
GGTTTATCAAACAGTTCCTCGAAAAGTCGAATGtcgattgtttgattttg
tGTACGAGTATTATACCAAATTCAAAGAGTTGGATATGAAAGTGGGGTCA
AAGATCTATTCGAAACCGTTAGAAAAAGTTTGTACGACATGTAAAAGTTG
TCTTGATTATTCAAAAAAAGGACACTTGAAAAATGGCGTTTACGAAGTAG
ATTTGTTAGGAACACGACGTGATGTTTATTGCTTCATGGAAGGCGAGGGC
GGAGGGTGGATGGCGTTTCAAAGGCGTTATGATGGTTCAGTTTCATTTGA
AGATAAAGAATGGGCAGAGTACAAAGATGGATTTGGAGATGGGTCAGGAG
AATATTGGTTAGGTCTTGAAACACTTCATCAGTTGACATCAACGCAATCA
TATGACTTATACGCGAGGGCGATGGATTTTTCCGGTGTTTGGGAGAGCAA
AAGATTCGCCGGTTTTACCATCGGCTCTGAGTTAATGGAGAGATACAAAT
TCGACTTCCAGTCTATCTACAGTGGAACTCAATACAGCAATCATAGTTTA
TTTGAAAGAGCGAAGGGCATGAAATTCAGCACTCCGACCCGTGACAACGA
TTTGTACACACCAATTCCAACTTGTGCTATTAGGTTTCCAGGAGGTTGGT
GGTTTAGCGATTGTCACTACGATTTCATGAACGGAGCCTACTCGCAACAA
GAAGCTTGTGATAGAGCAACTGGTATTCATTGGTACAAACGTTTCGGAAA
CAATCACAATAAATGTTTGAAAGAAACTCTCTTAATGATTAGAGAAAATT
AATCAATATTCTATATTCTATAATAGAAAAATGTACGTCAAAGATTGTAA
AATAGGGGTGTTTTGACACACCCGGTACTTGAGATGCTCTAAAGATGTTA
GTCAAAATCAAATGGTCTTTCCAACGGCAGCTAGGGAATTTCTTTGTCCC
GGATTAGAAAAGTTAGTCAAAGGTGTGCTCCAAGATAACATTATTCTGTA
CAAACTCGAACGCCCACGGGCGTATTTTGCCTTTTAGAAGAATCTTACCG
TGGGTCGGTCTGTTACGGTTAGAAATTCTGTGTCTCGTTagtaccactga
cctttatatatccctggacaaagttactcaatgcc
Run BLAST on NCBI

protein sequence of TCONS_00001342-protein

>TCONS_00001342-protein ID=TCONS_00001342-protein|Name=TCONS_00001342-protein|organism=Clytia hemisphaerica|type=polypeptide|length=327bp
MFRTVFLGILCIYWCECSKQIWNHAAIGKAYAWQPFYEVSLMDERQCFGQ
CVYNEKCLSFEVYQTVPRKVECRLFDFVYEYYTKFKELDMKVGSKIYSKP
LEKVCTTCKSCLDYSKKGHLKNGVYEVDLLGTRRDVYCFMEGEGGGWMAF
QRRYDGSVSFEDKEWAEYKDGFGDGSGEYWLGLETLHQLTSTQSYDLYAR
AMDFSGVWESKRFAGFTIGSELMERYKFDFQSIYSGTQYSNHSLFERAKG
MKFSTPTRDNDLYTPIPTCAIRFPGGWWFSDCHYDFMNGAYSQQEACDRA
TGIHWYKRFGNNHNKCLKETLLMIREN
Run BLAST on NCBI

transcript from alignment at sc0000010:311634..314105+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001342 ID=TCONS_00001342|Name=TCONS_00001342|organism=Clytia hemisphaerica|type=transcript|length=2472bp|location=Sequence derived from alignment at sc0000010:311634..314105+ (Clytia hemisphaerica)
caagcaacaaatcataaacaacaaaaaatctGACAAAGAGGAAAAAAGGA TTCTATTCTCGGAGAATCATGTTTAGAACTGTATTCTTAGGTATTCTGTG CATTTACTGGTGTGAatgttcaaaacaaatttgGAACCATGCTGCTATTG GTAAGGCGTACGCCTGGCAGCCTTTTTACGAAGTATCTCTTATGGATGAG CGACAATGTTTTGGTCAATGCGTTTACAATGAAAAATGTCTCTCATTCGA GGTTTATCAAACAGTTCCTCGAAAAGTCGAATGtcgattgtttgattttg tGTACGAGTATTATACCAAATTCAAAGAGTTGGATATGAAAGTGGGGTCA AAGATCTATTCGAAACCGTTAGAAAAAGTTTGTACGACATGTAAAAGTTG TCTTGATTATTCAAAAAAAGGACACTTGAAAAATGGCGTTTACGAAGTAG ATTTGTTAGGAACACGACGTGATGTTTATTGCTTCATGGAAGGCGAGGGC GGAGGGTGGATGGCGTTTCAAAGGCGTTATGATGGTTCAGTTTCATTTGA AGATAAAGAATGGGCAGAGTACAAAGATGGATTTGGAGATGGGTCAGGTA AGATATTTCTGAACAagcttttgtaatgaataacaGAAAATCAAACTAAA AGAAAATCAAGACCAAACTTGATGTTCATTTTACATTCGCAGCATTTAAA GAAGTactcgtttttttataagaacatccacaaattttgaagccttcgga tgttctttactttttgagtttcaagcctaaaaatgttcttaatatgttct taaatTCCCCATTTTGTGAGTGTGAGTGccaattttcttaagaaatcggg tgttgtccacaaagccttaacatattttcaacttgttcttaacattttag ccatcgaagccttatgttcttgtatagtttgtttttattttgaaaacgtG TAGGATAAAGGAAACCTAAATACTCATAGTGCAGAGTTAAAGTTTTCTTC TTATTTCATCAAATTCACAGGAGAATATTGGTTAGGTCTTGAAACACTTC ATCAGTTGACATCAACGCAATCATATGACTTATACGCGAGGGCGATGGAT TTTTCCGGTGTTTGGGAGAGCAAAAGATTCGCCGGTTTTACCATCGGCTC TGAGTTAATGGAGAGATACAAATTCGACTTCCAGTCTATCTACAGTGGAA CTCAATACAGCAATCATAGTTTATTTGAAAGAGCGAAGGGCATGAAATTC AGCACTCCGACCCGTGACAACGATTTGTACACACCAATTCCAACTTGTGC TATTAGGTTTCCAGGAGGCAAGCATTATACTCTAAGGTCCCAAATAGTAG GAGGGGAGGGAGTCCGGATAAAAGGGAAGGGTCCCGAAATTTCTTTTGAA CCGCGAACCTAATTGGCGGGGCCAGTCCTGATAAGAAGAAGGGGAGAATT TCATATATTAATAAagttttaataaacgggggaagGGGTGCGTTCTTTTC GAGACCTTAGGGTAGgtgaatattttgaatttgtgtCGAAAAAAGATATT TGCCGTAATTTGGATTACAAACGGCCGTCTTTTAGGCTACGTCATGTTTT CCTTCCTACTAGCGCTGTTTATTACGAAGACTGGTACCTTATCGGctctt tttacaccggcccttattggcgttatttttgggcttgtggcgtaataagg gccggcgttaaaagggccaagattttgcaattttaacctaaaagcggagt taattttttatcattatttctcaattcaaaggattttaggtatgattgga agacaaaaattattatccattgttttactccaaaATCAGGCTGTGatgta ataagggccggcgtttaatgggccggcgttaaattagggccggcgtaaaa agggccgataaggtagtctTTTTGATCGACTATTCGAGCTGTGTGAATCC TGACGTGCAATTTCTACTTATTGTTTTAAAGGTTGGTGGTTTAGCGATTG TCACTACGATTTCATGAACGGAGCCTACTCGCAACAAGAAGCTTGTGATA GAGCAACTGGTATTCATTGGTACAAACGTTTCGGAAACAATCACAATAAA TGTTTGAAAGAAACTCTCTTAATGATTAGAGAAAATTAATCAATATTCTA TATTCTATAATAGAAAAATGTACGTCAAAGATTGTAAAATAGGGGTGTTT TGACACACCCGGTACTTGAGATGCTCTAAAGATGTTAGTCAAAATCAAAT GGTCTTTCCAACGGCAGCTAGGGAATTTCTTTGTCCCGGATTAGAAAAGT TAGTCAAAGGTGTGCTCCAAGATAACATTATTCTGTACAAACTCGAACGC CCACGGGCGTATTTTGCCTTTTAGAAGAATCTTACCGTGGGTCGGTCTGT TACGGTTAGAAATTCTGTGTCTCGTTagtaccactgacctttatatatcc ctggacaaagttactcaatgcc

Coding sequence (CDS) from alignment at sc0000010:311634..314105+

>TCONS_00001342 ID=TCONS_00001342|Name=TCONS_00001342|organism=Clytia hemisphaerica|type=CDS|length=2952bp|location=Sequence derived from alignment at sc0000010:311634..314105+ (Clytia hemisphaerica)
ATGTTTAGAACTGTATTCTTAGGTATTCTGTGCATTTACTGGTGTGAatg
ttcaaaacaaatttgGAACCATGCTGCTATTGGTAAGGCGTACGCCTGGC
AGCCTTTTTACGAAGTATCTCTTATGGATGAGCGACAATGTTTTGGTCAA
TGCGTTTACAATGAAAAATGTCTCTCATTCGAGGTTTATCAAACAGTTCC
TCGAAAAGTCGAATGtcgattgtttgattttgtGTACGAGTATTATACCA
AATTCAAAGAGTTGGATATGAAAGTGGGGTCAAAGATCTATTCGAAACCG
TTAGAAAAAGTTTGTACGACATGTAAAAGTTGTCTTGATTATTCAAAAAA
AGGACACTTGAAAAATGGCGTTTACGAAGTAGATTTGTTAGGAACACGAC
GTGATGTTTATTGCTTCATGGAAGGCGAGGGCGGAGGGTGGATGGCGTTT
CAAAGGCGTTATGATGGTTCAGTTTCATTTGAAGATAAAGAATGGGCAGA
GTACAAAGATGGATTTGGAGATGGGTCAGGAGAATATTGGTTAGGTCTTG
AAACACTTCATCAGTTGACATCAACGCAATCATATGACTTATACGCGAGG
GCGATGGATTTTTCCGGTGTTTGGGAGAGCAAAAGATTCGCCGGTTTTAC
CATCGGCTCTGAGTTAATGGAGAGATACAAATTCGACTTCCAGTCTATCT
ACAGTGGAACTCAATACAGCAATCATAGTTTATTTGAAAGAGCGAAGGGC
ATGAAATTCAGCACTCCGACCCGTGACAACGATTTGTACACACCAATTCC
AACTTGTGCTATTAGGTTTCCAGGAGGTTGGTGGTTTAGCGATTGTCACT
ACGATTTCATGAACGGAGCCTACTCGCAACAAGAAGCTTGTGATAGAGCA
ACTGGTATTCATTGGTACAAACGTTTCGGAAACAATCACAATAAATGTTT
GAAAGAAACTCTCTTAATGATTAGAGAAAATTAAATGTTTAGAACTGTAT
TCTTAGGTATTCTGTGCATTTACTGGTGTGAatgttcaaaacaaatttgG
AACCATGCTGCTATTGGTAAGGCGTACGCCTGGCAGCCTTTTTACGAAGT
ATCTCTTATGGATGAGCGACAATGTTTTGGTCAATGCGTTTACAATGAAA
AATGTCTCTCATTCGAGGTTTATCAAACAGTTCCTCGAAAAGTCGAATGt
cgattgtttgattttgtGTACGAGTATTATACCAAATTCAAAGAGTTGGA
TATGAAAGTGGGGTCAAAGATCTATTCGAAACCGTTAGAAAAAGTTTGTA
CGACATGTAAAAGTTGTCTTGATTATTCAAAAAAAGGACACTTGAAAAAT
GGCGTTTACGAAGTAGATTTGTTAGGAACACGACGTGATGTTTATTGCTT
CATGGAAGGCGAGGGCGGAGGGTGGATGGCGTTTCAAAGGCGTTATGATG
GTTCAGTTTCATTTGAAGATAAAGAATGGGCAGAGTACAAAGATGGATTT
GGAGATGGGTCAGGAGAATATTGGTTAGGTCTTGAAACACTTCATCAGTT
GACATCAACGCAATCATATGACTTATACGCGAGGGCGATGGATTTTTCCG
GTGTTTGGGAGAGCAAAAGATTCGCCGGTTTTACCATCGGCTCTGAGTTA
ATGGAGAGATACAAATTCGACTTCCAGTCTATCTACAGTGGAACTCAATA
CAGCAATCATAGTTTATTTGAAAGAGCGAAGGGCATGAAATTCAGCACTC
CGACCCGTGACAACGATTTGTACACACCAATTCCAACTTGTGCTATTAGG
TTTCCAGGAGGTTGGTGGTTTAGCGATTGTCACTACGATTTCATGAACGG
AGCCTACTCGCAACAAGAAGCTTGTGATAGAGCAACTGGTATTCATTGGT
ACAAACGTTTCGGAAACAATCACAATAAATGTTTGAAAGAAACTCTCTTA
ATGATTAGAGAAAATTAAATGTTTAGAACTGTATTCTTAGGTATTCTGTG
CATTTACTGGTGTGAatgttcaaaacaaatttgGAACCATGCTGCTATTG
GTAAGGCGTACGCCTGGCAGCCTTTTTACGAAGTATCTCTTATGGATGAG
CGACAATGTTTTGGTCAATGCGTTTACAATGAAAAATGTCTCTCATTCGA
GGTTTATCAAACAGTTCCTCGAAAAGTCGAATGtcgattgtttgattttg
tGTACGAGTATTATACCAAATTCAAAGAGTTGGATATGAAAGTGGGGTCA
AAGATCTATTCGAAACCGTTAGAAAAAGTTTGTACGACATGTAAAAGTTG
TCTTGATTATTCAAAAAAAGGACACTTGAAAAATGGCGTTTACGAAGTAG
ATTTGTTAGGAACACGACGTGATGTTTATTGCTTCATGGAAGGCGAGGGC
GGAGGGTGGATGGCGTTTCAAAGGCGTTATGATGGTTCAGTTTCATTTGA
AGATAAAGAATGGGCAGAGTACAAAGATGGATTTGGAGATGGGTCAGGAG
AATATTGGTTAGGTCTTGAAACACTTCATCAGTTGACATCAACGCAATCA
TATGACTTATACGCGAGGGCGATGGATTTTTCCGGTGTTTGGGAGAGCAA
AAGATTCGCCGGTTTTACCATCGGCTCTGAGTTAATGGAGAGATACAAAT
TCGACTTCCAGTCTATCTACAGTGGAACTCAATACAGCAATCATAGTTTA
TTTGAAAGAGCGAAGGGCATGAAATTCAGCACTCCGACCCGTGACAACGA
TTTGTACACACCAATTCCAACTTGTGCTATTAGGTTTCCAGGAGGTTGGT
GGTTTAGCGATTGTCACTACGATTTCATGAACGGAGCCTACTCGCAACAA
GAAGCTTGTGATAGAGCAACTGGTATTCATTGGTACAAACGTTTCGGAAA
CAATCACAATAAATGTTTGAAAGAAACTCTCTTAATGATTAGAGAAAATT
AA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000723XLOC_000723Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001342-proteinTCONS_00001342-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001342-exon-sc0000010-1491911889:311634..312230TCONS_00001342-exon-sc0000010-1491911889:311634..312230Clytia hemisphaericaexon
TCONS_00001342-exon-sc0000010-1510915933:311634..312230TCONS_00001342-exon-sc0000010-1510915933:311634..312230Clytia hemisphaericaexon
TCONS_00001342-exon-sc0000010-1575043694:311634..312230TCONS_00001342-exon-sc0000010-1575043694:311634..312230Clytia hemisphaericaexon
TCONS_00001342-exon-sc0000010-1491911889:312654..312950TCONS_00001342-exon-sc0000010-1491911889:312654..312950Clytia hemisphaericaexon
TCONS_00001342-exon-sc0000010-1510915933:312654..312950TCONS_00001342-exon-sc0000010-1510915933:312654..312950Clytia hemisphaericaexon
TCONS_00001342-exon-sc0000010-1575043694:312654..312950TCONS_00001342-exon-sc0000010-1575043694:312654..312950Clytia hemisphaericaexon
TCONS_00001342-exon-sc0000010-1491911889:313615..314105TCONS_00001342-exon-sc0000010-1491911889:313615..314105Clytia hemisphaericaexon
TCONS_00001342-exon-sc0000010-1510915933:313615..314105TCONS_00001342-exon-sc0000010-1510915933:313615..314105Clytia hemisphaericaexon
TCONS_00001342-exon-sc0000010-1575043694:313615..314105TCONS_00001342-exon-sc0000010-1575043694:313615..314105Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:311634..314105 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0.106755 0 0 0.0321486 0.200667 0.0758189 0.578693 0.249118 0.03895 0.381767 7.94755 7.58648 0.236423 0.552681 0.237941 0.565345 11.9328 11.3005 0.835218 0.872415 0.552208 1.13107 1.58922 2.25292 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002181Fibrinogen_a/b/g_C_dom
IPR014716Fibrinogen_a/b/g_C_1
IPR014715Fibrinogen_a/b/g_C_2
Blast
BLAST of TCONS_00001342 vs. Swiss-Prot (Human)
Match: ANGP2 (Angiopoietin-2 OS=Homo sapiens GN=ANGPT2 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.098e-31
Identity = 83/220 (37.73%), Postives = 114/220 (51.82%), Query Frame = 3
Query:  393 KSCLDYSKKGHLKNGVYEVDLLGTRRDV--YCFMEGEGGGWMAFQRRYDGSVSFEDKEWAEYKDGFGDGSGEYWLGLETLHQLTSTQSYDLYARAMDFSGVWESKRFAGFTIGSELMERYKFDFQSIYSGTQYSNHSLFERAKGMKFSTPTRDNDLYTPIPTCAIRFPGGWWFSDCHYDFMNGA-YSQQEACDRATGIHWYKRFGNNHNKCLKETLLMIR 1043
            + C +  K GH  NG+Y +    +  ++  YC ME  GGGW   QRR DGSV F+ + W EYK GFG+ SGEYWLG E + QLT+ Q Y L     D+ G      +  F + SE +  Y+   + + +GT     S+ +   G  FST   DND    I  C+    GGWWF  C    +NG  Y Q++  ++  GI WY   G+ +   LK T +MIR
Sbjct:  282 RDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQ-RTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEEL-NYRIHLKGL-TGTAGKISSISQ--PGNDFSTKDGDND--KCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGY--SLKATTMMIR 492          
The following BLAST results are available for this feature:
BLAST of TCONS_00001342 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ANGP23.098e-3137.73Angiopoietin-2 OS=Homo sapiens GN=ANGPT2 PE=1 SV=1[more]
back to top