Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00001339 ID=TCONS_00001339|Name=TCONS_00001339|organism=Clytia hemisphaerica|type=transcript|length=1768bpRun BLAST on NCBI transcript from alignment at sc0000010:232709..238625+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00001339 ID=TCONS_00001339|Name=TCONS_00001339|organism=Clytia hemisphaerica|type=transcript|length=5917bp|location=Sequence derived from alignment at sc0000010:232709..238625+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00001339 vs. Swiss-Prot (Human)
Match: REPS2 (RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens GN=REPS2 PE=1 SV=2) HSP 1 Score: 112.849 bits (281), Expect = 6.143e-26 Identity = 53/92 (57.61%), Postives = 64/92 (69.57%), Query Frame = 3 Query: 351 NEEMRITQEQREYYTNQFKSLQPNEDDVIKGPQARDFFLKSNLAMETLSKIWHLSDLDKDGALNLEEFQIAMHLVVLIKHGYELPMVLPPSL 626 +E RIT+EQREYY NQF+SLQP+ I G A++FF KS L++ LS IW LSD D DGAL L EF A HL+V K+GY LP LPP+L Sbjct: 273 DEPWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTL 364 The following BLAST results are available for this feature:
BLAST of TCONS_00001339 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|