Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001337 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001337
Unique NameTCONS_00001337
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2888

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001337 ID=TCONS_00001337|Name=TCONS_00001337|organism=Clytia hemisphaerica|type=transcript|length=2888bp
AAAGACAATAAGTATACAAAAAGGAAGACAAATAAAGATGATCTAGGAAG
ATCAATATTTGAGTGGAAGATTTTTAATGTACAAAAATTCTAAGaagtga
atcaatcaatcaaacatGGATTTTGATCCGTTGAGTGACAATGAAGATGA
TGTGACATTTATgccagagaaaaagaaaaaagataaagaagAAAAACGAC
GAAAAAGTAAAGGCTCCCATAAATCTGACAAGAGAGATAAGGGAAGCTTC
AGTGATGGGTCAACACCAACAGCCATGAAAAGTAAGAATGTCGTGCATGG
TCTTGTGGGTCCTGCAGAATACATTGCTGAAAACAGTCCTACACATGGAG
AATCGTCGACAGCGTTTGGCAACCAACCTACTTCTCCAACTACAAATATC
TCTGCAGCTCAAGTCTTTTCACAACAGCAAGTGACACCGCAAAAGATTCA
ACAAACATCACAGGTCCTTCAACAACAAACTCCCCAACAGATGCAGCAGC
AATGGACGCCACAAAAACATCAACAAGCAAACAATCAACAGTTTGCCCAA
CAGTCCAATTCAACGCCCAACTTCCAACAGCTTCAATATCAAAACACACC
GACAAGTGGACAACCTTTCACAGCTAATTTCAATGCATCCTCGACGAAAA
TTGAGCGACCACATTCTTCGGCTGCACTACTCCAAGAGCGAACGCCTCAA
CAATCACCACAGCCTTTCAAACAATCAACGACTATGACCCAACAAAAAGG
CACTCTGCTTGCTCAAGCAATGAATACAACCCCTCAGCCTCAGCCTTCAC
CACTACCAAATAAACAAGCTCCTGCAGCCAGTATCCAACCACTTCCACCG
AACCCGTCCCAACTGACCGCAGCCATTAATATGACACATCACCGAAACTC
ATCTTATTCAAGAGCTATGTCATTACCGGTGGAGTCAGCAACTGGGAAAC
AGGATGCAAGCTCGGATCACATGATCAATAGATTCCATACAAAATTTGAC
AGTGAGCTTGAAGTCTCCACAAATGTTGTTGGATCACCAATCCTTGAGAA
TCCAGCCTCACCATTCCAGAGATCAGAATTGTGGAACAATGCACCGCCCT
TACACCACGCCCATCATCATACCCACCACTCTCATGAAGCACCACACACG
CCCAAGCAACATGACGGTGATTGGGCGCATTTTTCACCTCAAACAGAAGA
TGTACCTACATCGAGTCATCCCAATGCTGGTGTAATCTCGTCTTCNACGG
TGATTGGGCGCATTTTTCACCTCAAACAGAAGATGTACCTACATCGAGTC
ATCCCAATACTGGTGTAATCTCGTCTTCGGTTGAGTCGGACAATCAATTG
CCACCGCCATCGAATCATATCGATATACCAAGAAAGAGAAGCCAAACGGA
GAGCATGGCGTCATCCAGCATGGCATCCAGTATCCCAGAAAGCACGAGTA
GTGTTGACAGTAGTTCCGACAATGAAGAAATGAGAATCACGCAAGAACAA
AGAGAATATTACACCAACCAATTCAAAAGTTTACAACCCAATGAAGACGA
TGTTATCAAAGGTCCCCAAGCTCGTGATTTCTTCTTGAAGTCGAATCTAG
CGATGGAAACTCTTTCTAAGATCTGgCATCTATCAGACTTGGATAAAGAT
GGCGCATTGAACTTGGAGGAGTTTCAGATTGCAATGCATCTGGTTGTGTT
AATTAAACATGGTTACGAGTTACCGATGGTTTTACCTCCTTCCCTTCTTG
GTCAAGAGCAAGTCCATCAAATGGCAAGTCAAGATGGTGTGGATATGAGC
GATGAAGATGAGAAATTGATTTCTGATGACGAAAAACAAGAATCTGGTGA
TTGGTCCGCTGAATTTGATGCTACGGATGGGGCACCAATTGATCGTGGTG
AACGTATAGTGCAAACTTACGCGCAACCCTCCCCTACGTCCGTCACCGTG
CCGTCAGAAACTCGCGTACAACCCGTCTCGCACATGATCGAACAACAACA
GATCAACCATGACGACGAAAACGAATTACCTTCCTCGCCTGGTGCCTTGG
CTTCTCCTAACGATGTCGCCGCGGCGGGTGGCAAAATGACAGCTATCGCA
CGACCCCGTGTAACCGCTAATAAAAACGTTAATCTGATGGATGCGTCACC
ATGGCAGCTCCTGCCACCACCGTCCGGGAAAACTGGCAAATTCGGTGGCC
CGAATGGTGGTACAACCGCGAAGAAAGCCTTGAAAATGGATAGTGTTGAT
AGTGAATTAGACTCGGCGGGTGTCATCAGTGATAGCGAAAATAATAAACT
GGTCTCGATTGATAATCACATGTCCCAAACGACGTCGCCGACAAATGGCG
ACAGTAGTCTGGATAACCTCGACGACGACGAACATTTGACGGACGACCAC
GATCACGAACGTTTGAAAGTCAAGAAAAAGGATTCGGCATATTTCAGGAA
TTTGTCAAAAGAGAAATCGCGTTCGATTGATAGCTTACGGTCAGATATTT
CGGAGAGTAGCATGTTTGAATGGAAGAGACAATCCATTAGACGAGAATCG
AGACCAAGGTCATTTACAGGGGAAAGCACACACGACACACCGCAATTCGA
ATCACCGCCCGTCCCACCGCCACGAACGAATAAAGGACACGCCAGGGCGT
CATCACTCGATTTTAATCAAATGTTCCATAATCGTTCACCTAGAGTCAGT
TCTGAACCGAAATTACAAGTAACGACACCAACTGACGGAACAGGCAAGAA
TCCGCCACAAAAACCACCACGCTCAAATCCACCAAGCACTTCTTCAACTA
ATAACTCGTCTGCCGCCCCCACTGCTGCAGCCCGCCCTCGTTCGTCCAAG
GGTGATGAATATCATAGGTCACGATCACTTGATGTAAG
Run BLAST on NCBI

transcript from alignment at sc0000010:226394..238625+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001337 ID=TCONS_00001337|Name=TCONS_00001337|organism=Clytia hemisphaerica|type=transcript|length=12232bp|location=Sequence derived from alignment at sc0000010:226394..238625+ (Clytia hemisphaerica)
AAAGACAATAAGTATACAAAAAGGAAGACAAATAAAGATGATCTAGGAAG ATCAATATTTGAGTGGAAGATTTTTAATGTACAAAAATTCTAAGaagtga atcaatcaatcaaacatGGATTTTGATCCGTTGAGTGACAATGAAGATGA TGTGACATTTATgccagagaaaaagaaaaaagataaagaagGTATCGTTC AAATTCTACTTCctgaacaataaaaaaactattCAGCAGCAACCTTCTCT CTCTCAACTCCCTCTAGCTTGTGTTGTCTGACAACCAATTACGTGGGAAA AAATAGTTTATAGTAAATAACTTGTAGTTAATTAAAAATGCTTGTTTTTC TATTGTGTTTTATCTATTAGCAGCTTTTTAATCCATCTCTACTCATCAAT ATTTTATACTTTCCTTGTCCTTACAAACTCAACACTGTTTTTAACTGGCT TGAATGGTTAACCATCTAGTTTGCTCATTTATTTCTTACAATATCGAAtt aattaacatattttattaGCCTTCCAGATAAGTGCGAttgatatcttttt attgattgTGAGTTGCTATTATATTAGCGCTGCATTTTGGTTTGTAGAAA AACGACGAAAAAGTAAAGGCTCCCATAAATCTGACAAGAGAGATAAGGGA AGCTTCAGTGATGGGTCAACACCAACAGCCATGAAAAGTAAGAATGTCGT GCATGGTCTTGTGGGTCCTGCAGAATACATTGCTGAAAACAGTCCTACAC ATGGAGAATCGTCGACAGCGTTTGGCAACCAACCTACTTCTCCAACTACA AATATCTCTGCAGCTCAAGTCTTTTCACAACAGCAAGTGACACCGCAAAA GATTCAACAAACATCACAGGTCCTTCAACAACAAACTCCCCAACAGATGC AGCAGCAATGGACGCCACAAAAACATCAACAAGCAAACAATCAACAGTTT GCCCAACAGTCCAATTCAACGCCCAACTTCCAACAGCTTCAATATCAAAA CACACCGACAAGTGGACAACCTTTCACAGCTAATTTCAATGCATCCTCGA CGAAAATTGAGCGACCACATTCTTCGGCTGCACTACTCCAAGAGCGAACG CCTCAACAATCACCACAGCCTTTCAAACAATCAACGACTATGACCCAACA AAAAGGCACTCTGCTTGCTCAAGCAATGAATACAACCCCTCAGCCTCAGG TATCATATAAAGTAATTAGTATGAAGCTCTATTCTACCAACGCAGTGTTC GTTCGCTaataaatttttagattttcttaaCCTGTTAATAAGCGTGAAAT GGTTGTATTAATTTTCTAAAAGATCTTAGTAATCTTACAACAATAGAATC TGTGTGTGATACTGCTGGCTTTTCAATTTAAATCATCAAATCtgtaaaat gtgttttttttattcttactATATATaacatttaaaacttttttctcaGC CTTCACCACTACCAAATAAACAAGCTCCTGCAGCCAGTATCCAACCACTT CCACCGAACCCGTCCCAACTGACCGCAGCCATTAATATGACACATCACCG AAACTCATCTTATTCAAGAGCTATGTCATTACCGGTGGAGTCAGCAACTG GGAAACAGGATGCAAGCTCGGATCACATGATCAATAGATTCCATACAAAA TTTGACAGTGAGCTTGAAGTCTCCACAAATGTTGTTGGATCACCAATCCT TGAGAATCCAGCCTCACCATTCCAGAGATCAGGtataaatgtttttaatt ttcgagCAGCAAATTACAAACACTGCACTATTAAttctaaaggttttatt ttcttCCCATTTTTTAATGATAAGTGAAGGTGTCAAAATATTATTTCGaa tctttattttttccttAAGTAACTACTCATCCCCACTTTATTAGCACTCT TTATGTTGCAAATCGTAAATTTAATAATTGCAATAATTAATTACTACACT TCCACTTGCAACTAATAAGAAGTAATTAGTTATTTATTTTACCATTCTCA CATTTTTTAGACTCACTCTCTTCACCTCCACTAACACCCAATAACAAACA CTCAGCTTCACAACAAGGTACGGACATGCACACCATTCATTCACTACCCC TTCTATTATAATATTACTGTTATTAAAAAATCTGTAGACAATCTTTTAGT ATAACTTCTTTTGTTATCTCTAAATATCTCGAATGATATCTTACGCCTTC TTCTTACAGACCCTGTGGGACCATaacaatttttccagttggaGGGGGGA CTGGAAAAATTgcccaaaatattgtccccagtgTAAAATAAAACTCCAAT TTTTGAATCGCTGaatgaaatttcttgaaaacaatTTAATTCAAATCTCC GGCCATAAAAAAACATAGGAATGTCAATCGCCATCGATATTCAGTTCGTT ATTTTTTACTcaactggctgaaaaatcctatcgggtctgtgagaagtagG TTTTATCTGATTTGAAATAGCTTTTAATTAATAAACTATTTAGAGCAACT CAACCCTTGACCGATAATCCCATATGGTAAACCTAGCTTAAACCAAAAGA ATTTTATACCTTTTTTTAAAAGCTGGTTCAGTTGACCCCTTTATCCTCCA GACATTCTGattgaacttttgaaatctctagagagataaaaaacaaattt caagaaACCAAATGCTTTTCATCCTCTGTCAGTACGTATCTCTCTCTAAT CACATCCTTTGAGACGAGTCGGTGATTTTAACTGTGTNTGTCAGTACGTA TCTCTCTCTAATCACATCCTTTGAGATGAGTCGGTGATTTTAACTGTGTC CTTGATAAAACATGACATTTCTATTGACATTGCGAATCTTATTTATTTAC ATTgaccacaaaataaaaaacaaattgaacGTAAAAACTTGATTAATGAA ATGAGTTTATGATTTATGGGAGTAGAAACGTTCATTTGGAGTATCGGACT AACTTTTTGAGGCTTTCATAGTCTCTGTTTCATGCTCGTGAAATGTTGAA ATTTGTTAAACTTCGAAGCAAAGTTTATCATGTGaatctttcaaaaagtt tttcatcaGGGAGCGAAGAaggtctgtttttttttatgttaaaaattctt ttgaggTTTTCAACAGTTTGTTTGTTCCCTCTTATTACACAACTTATAGG GTCCATAATGTAATATAGCCAAAGGGGACCCCCAGGGGACCCCTTTTAAA caataagaaaaataacaaaatgggTATAGTTAATGTCGGATGTTTGTTTA TGTACAAGTGTATGTGGTGtcactttttcacaaaaaaatctgACTATATT TTTATATGTTTGCGTGTGTTTGCAGATGCTGTAATAAAGGGGAACAACAT TGTGTTGAACTATTGGTCACAAGGTTTTTAAAAAGGAAGTGacaattgat tttttaaagttttttggatTCAGTAAAATTGTTACAAAAAAGCTAACAAC TTCCAATTATCCAAAGCTAATCGCTGTTCGCTGTTCGACTAAATACCAAG CAGCTTTTTATTTGAGTCATGGCTTTAAATTGCTTGGTCAATTTTAACGA TTTAGAATTGTGGAACAATGCACCGCCCTTACACCACGCCCATCATCATA CCCACCACTCTCATGAAGCACCACACACGCCCAAGCAACATGACGGTGAT TGGGCGCATTTTTCACCTCAAACAGAAGATGTACCTACATCGAGTCATCC CAATGCTGGTGTAATCTCGTCTTCNACGGTGATTGGGCGCATTTTTCACC TCAAACAGAAGATGTACCTACATCGAGTCATCCCAATACTGGTGTAATCT CGTCTTCGGTTGAGTCGGACAATCAATTGCCACCGCCATCGAATCATATC GATATACCAAGAAAGTAAGaacgtttttctaatatttctaTTCTAATGAC AGCATATTTAGGGTTTGAAAATTGAAGGTTGATAATTACACTTGTAATTA TACATGGATattaccattgagtttaaagccgcTAAAGGGGCTTAATGCTG ATTAAGCTACTTATTCTCCAAAACTAATTTTACCAGTACGAAAATTATAT TGTCGACTTCTAATGGACAGAAAGATTTAATAACGGATAGCCCATGCCAT AGCAAACAAGCTTCGTTAGATGTTCGCACTTGGAAACTCTATTTGAATTA TTGATAGCTTTGTAATTTGATTATCGTTGAGCTGCTGtgcagaaaatgca aaaaaaattatcttatagaaaactttttaaaagtctTAAAAATATAACGA GAAAACATGTTAAATTTATTAGAACTTAGATGTTAAAATCTTTAACATCA AATATTGTTCACGTTTTGTTAGTAAACAGTTCTTTAATAGGGAAGCTAAA AATCTTTGAATGAAGTTGTGGTACGAGTGTGTACGAgtacttgaaaattt taaacttcCTCCACCAGTTAAAAAGGAGATTGTATGAATTTTGAACGTCT GTGACCAAACTTTACGAGTATTTATTATTCCCTTCCTGCTTAATACCCTC TACGCAAggagggggtcaagcagtttgTACACGACTCCCATGAAGCTTAG AACGGTGGTGGTTCACTTTCAAAAGTGACAAAATGAAAATCTGACCTCGA AAGCAGTTAATAGATTGTGTACTTAGTGAAAGGTAGTGGTTGTCCTTTTC AAAATCAGTTAGTAGACAAAGTGTTCCGGAgtaactgcttgaactcctct GTTTACGCCTTCACTTTACCCTAAAGCCAGCAAGTTAGTATTCTCAATTC GGAATTTTTGAAGAACTGTTCGTATGCATAACGTATTTACGTATTTACAT AGTTGACGTATGCTAAACATTCTGAGCTTTGGCAGGTTGATTGCAGGTCA AATTACTAGCCGACCTTAACCAAATCCTGGGGATACACTgagcagtgccg taggaagcattttaatattggggggggggggccccggggggggggggggg aggggggggggggggaggggggggggggggaggggggggggggggagggg ggggggggggaggggggggggggggaggggggggggggggaggggggggg ggggctgaagtttagtgacgccgcgagggccaaccatggtttggcccgag gggggaaattttgaaaacttgagctctagattgcttgaaaatgcactcaa aacatccccttataagacaattatgacaaattaaaaaagaaaaactttgc tttttgcaaaatagccatttttgaaaaaattatttgggggggggggagct gaagtttagtgacgccgcgagggccaaccatggtttggcccgagggggga aattttgaaaacttgagctctagattgcttgaaaatgcactcaaaacatc cccttataagacaattatgacaaattaaaaaagaaaaactttgctttttg caaaatagccatttttgaaaaaatttttggggggcatagccccccttgcc ccccccccagttgctacggcactgcactGAGTGAcctacaccttttttta taaggaaccttaacgaGCTCCGaactctgagcctggagttccttttTTCT CCAGAAAAATTTAGCCTCAAAGCTCCTTATCGAGCTCCTTATTCacttag ctgctaagtttggactGATTTAATACAGACGTTTATTGAATGTTGTTTCa tcaatattttgatgatattttgaactttttatttaGGTTTTTGTGAATGT GTGTAAGTTCAAGTTTAACTCTTACtgttctcagcctgagcagtttctta agttccttataaaacgtgttccttttaaaaaatgtgtatactTATTTGCT AAATACTCATAAAGTTTAAATCTGCAGGGAACGTAGTTGCGGTCTAACCT ACCTTTCTTGCTACTTCGTCAGCAGGTCAGCTTACTTTTTTACTACAGCT CCGTAGTAGTTTTTTGACAGTATTGAGTAATCTACAACTTGAGAAATGAA ACGTCATCACACATTCTCTCATCATTCGTCACTGCCCAAATGAGATGTAC AAGAACCTCTGCAAAGGTCAAACTGTTACAAGTTGTTAATAGAACTGTTG ACAAAAGTTTATAGATGTAATTTTAATGCtgctttttttacttttgtagT GAATTTTTTCTATTCTGTGGTAATAGATTAGTAAGGCATATTGGATGTGA ATTAAAACGTGTGTTGATTTACATAATTGattgacaaaacaaaaaaaagt ttttttgagtcATAAGAGATTTTGCGGCTTGGGTTTTCTTTATCTGAATT TGTGCTACTAAAGAGCTACAGTTAATGTATGTAGTATGAAAGAGACATAG AGttaaaaaaatagagaaaaaacggtttttaaaaaccctttttttaatCT CTATAAATATAAGAGTGGCTTATTACTGTGATATTAGAAAAAAAGAGTGC CCTGGACTTGCGTTTTTGTTGTGATAAGCTATAAAGAGTTAGAGTCAGAG AAAATTTGTCAATGAAGCAGTGACTTGTATGGGCTTAGATTGAATAATTT ATAGAGAATCAAGTGTTTTTTTGGTTTGGTGCCATGGATGTTCGACAATC TCGTTCAAGACCATATTATTCAAGTTATCAGTAAGTTATTGTAGGGTCAG CTATACACGCTCATGCAATGTTTATATTTTGTCCCCAGAAATTGGGGTCT GTCATTCGTCAACATTTGATACGTTTTTTCTCCTTTTCAACTTTTAATTC TGGTGGTTCTGCTACTAGTAAAACAGAGTAAGTTCTTTCGTTTACAGACT ACCTGCCACTGAGTTTAAAGTGCTTTTATCGCATTCAAATTTGCTCTGAA TGCTTTTCAGTCCATCTAAAATAAACGTATAATATTAATCAATACCGAGT TTGACCCCTATAATAAAGccggatgagctggagtttttacaagctggGAT GCGATTTTCTTTGTGTGTATTTTACGGAACAAGCACACCCGATATGttat actttcaaaaaattctctaaCCCCAAGttccgaagtcccgagttgaactg tgccaacactctccaaagtataagcctttgaaattttgaggatGGTGACG CCTATTAGAAGGCGGTtctctgaaaaatctttttctttaagAATTCCTTT GATAAGGGGGCCTGGAATTATTTTGGAGAaactgaaattatgacgtcacc cgcaaaataactcggaaaaaataacttgggaaaaaataactcggaaattC CAGGCCCCTTCGATAAGTTTCACTGCACTACGATATTCTAAGTGGCTGAG TCGGTTTTGCTCCAAAAGGTTCTGGAAATGTAGTACAGTAGAGGAAATTT TCCGTTCAAGGAGCTTAGGCATATTTTGTATCAGTAGCATCAATAAGTTC AACATAGTTCGTTTCAATCGatcaaatcaaattcaaaagagGCTATTAAT CTCAATATTACCTACTATGCTTATATCTCTAAGTAGTGGGTAGCTCAAAG GAAGAGCATTCAGCTACGGTGTGTTCGTGGGCTCAATTTATCGACGGGTC GCAAACTAACTATATCTCTTTTTCCCTCCAGGAGAAGCCAAACGGAGAGC ATGGCGTCATCCAGCATGGCATCCAGTATCCCAGAAAGCACGAGTAGTGT TGACAGTAGTTCCGACAATGAAGAAATGAGAATCACGCAAGAACAAAGAG AATATTACACCAACCAATTCAAAAGTTTACAACCCAATGAAGACGATGTT ATCAAAGGTAACGATTATCgcaggaaaaaatctttaaatcacACTCGTGT GAAAACTGATTTCCAAGGGTGAGATTCGGTTCGTTTTCACACTATTTGTT TACACCTTGTTGAATCAATTATCAAACTAAAAACTCAATCTGGAATCACA ATCTGACTTAATTCTTCTTAAATTTGAGGTGTTTTAATCTAATACTTAAA TCATCATGGTGTAAACACTAAGGGTGCTATTTACGATTTCACACCCGTGT GAAAACGAACCGAATCTCACCCTGTGAAATAAGTTTTCACACGAGTGTGA TTTAacgattttttcctgtgtattaTGATAGTTAATGTTTTTGTCCGAAA AGTTATACGCCCTTATTTTTCGACCTCGTCCTTCCACAGCCTCAAAGCGT TTAAATAATGATGAAGTTTTGTTAATAATGATGATTCTAGCTCATTAAAC TATAACTGATTCTGTTTCAACTACagtgaagtttttttttaactcgctgg aacctctataactcgataGTTTCCTTAAAACGAACAAGTTTGTCTTGGAG ACTTCCAATGTATTTGTTTCATATCAAGTTGTATAActcattgaattttt ttgtctaGGTCCCCAAGCTCGTGATTTCTTCTTGAAGTCGAATCTAGCGA TGGAAACTCTTTCTAAGATCTGGTATGTATGTTTCCCTTGTAGTAATTAT CTGTCAATTATAATATATTACCCCCTCTATACATGTAAGGTCTTCATTCG ATTGATCTTAAACAAGCTCATTACAGCTCGCTTTGGTGCTTTCAATTAGA tttgaactttttcttttcGACGAGATTTGTCAATACAGTGGAAATTTGAT TATTGAAACTTGCATATATTTCTCTTTCTCAACAACCCTTAggaatttat tttattaatcAAAGTTTTATTCAACCTCGTCCCTGTGTAAaacaggcttt atttacgttagtgattgacgccagagaatatcctggtgttggctgatgcg agacTATCATCTCAAAGTGAGAACTTctcaaacaacaaaaaagtgaCGCA TTCGAAAAGCAGACAATGCCAGGGTACTATCTGGGGTTATCAGTAATAAG CATAAATAAcagataatacgcagggaatgAGGTTGTGTTTTATTGACAAA TTGTTCACAAATAATCGAATAACctctttaaattaaaaatttcaggCATC TATCAGACTTGGATAAAGATGGCGCATTGAACTTGGAGGAGTTTCAGATT GCAATGCATCTGGTTGTGTTAATTAAACATGGTTACGAGTTACCGATGGT TTTACCTCCTTCCCTTCTTGGTCAAGAGCAAGGTACGTTGTTAGTCTGCC GTCAAAACATGCCTGGTTATTTTAAAATATCATAATTTGACTTTATCTTT AGATAGTTGATGATTAGCTTAAGGTTTATTTCCATCTCAAACCATTCTAA GGTTGTTGTTTTTTAGTGGTCGCTAACTGGATttctatataatatatatt catgatatgcaccactgcaatgtcttctgacattacgtcatggaaccaat agctcattggttggaagtgacgtaaaagcagtcaatacgtcactctCAAC CAATCAgttattgggtggaacggaagacattgcaatggcgcatatcatga atagaataTTATTTTTATCTCAAATGTCTCCTAATTGGAACAAGTTAACA ATACGTTAtaatatataaaggtcagtggttataccttgactcgaacaaat ttgtgttcgcTGCGaagggttcgagttatggatacTCCtctgtaaaatgt ttttttttaccaccgggaATCTAGTATTGTATCCGAATCCATATAATCCG AAAACAGGTGACTTTTTATGTTTCTGTATGACTTTTAAAACTTGTCCTTT CATTATGTCAGTCCATCAAATGGCAAGTCAAGATGGTGTGGATATGAGCG ATGAAGATGAGAAATTGATTTCTGATGACGAAAAACAAGAATCTGGTGAT GTACGTAACGCTCTTTACGTCTTGCTATTTACATATTATGGAACACGATA GAGTTTCAATAGTATTCCAAGATAATTAAGATAATATTATCCCGAATAGT TACTCCTTCTCGGTTTATAATCCGCTAAAAGTGGTGAATTTTGACAACTC AGAGAAATTGAAAGGTTTTCCTTCACTCCGCTTTTACCATGGGATTAAAA ACTGTAGACGTACAGAGGAGACAAAAACGTTCTGACGATTCGCGGATAGG ATATAGCGCTAGAAGTGTTGTATAGGGTATCTTATAAAACTGTTTCTCCT TTATTTCTAGTGGTCCGCTGAATTTGATGCTACGGATGGGGTGAGTTGAT TTATGGTTTAGGTCTGGCTGTACTTATAGTGCAGTGACCATtatataatt atattttataGATATTTAAATGAGATTTATCATGTGCTATAGCTCGCTGT TTCAAAATACTACAAATTTCGATTTGGTTATTCCTTACCACATTCCTTCT CCACATCATTCCATATGATATGTAGGTGATTTTCTGTACTgctattttca aaagataacCTCAATCTTTCAGTTTATGGGAACCTTTACTTGAACACTCC TACTTTTTCACTGCAGGCACCAATTGATCGTGGTGAACGTATAGTGCAAA CTTACGCGCAACCCTCCCCTACGTCCGTCACCGTGCCGTCAGAAACTCGC GTACAACCCGTCTCGCACATGATCGAACAACAACAGATCAACCATGACGA CGAAAACGAATTACCTTCCTCGCCTGGTGCCTTGGCTTCTCCTAACGATG TCGCCGCGGCGGGTGGCAAAATGACAGCTATCGCACGACCCCGTGTAACC GCTAATAAAAACGTTAATCTGATGGATGCGTCACCATGGCAGCTCCTGCC ACCACCGTCCGGGAAAACTGGCAAATTCGGTGGCCCGAATGGTGGTACAA CCGCGAAGAAAGCCTTGAAAATGGATAGTGTTGATAGTGAATTAGACTCG GCGGGTGTCATCAGTGATAGCGAAAATAATAAACTGGTCTCGATTGATAA TCACATGTCCCAAACGACGTCGCCGACAAATGGCGACAGTAGTCTGGATA ACCTCGACGACGACGAACATTTGACGGACGACCACGATCACGAACGTTTG AAAGTCAAGAAAAAGGATTCGGCATATTTCAGGAATTTGTCAAAAGAGAA ATCGCGTTCGATTGATAGCTTACGGTCAGATATTTCGGAGAGTAGCATGT TTGAATGGAAGAGACAATCCATTAGACGAGAATCGAGACCAAGGTATGAC TCGTTTTCCCAAAGTTGAAACAACTGAATTATAGTGAGATTATTCTCACT GATTCTGATTTCGAtacattttgttattttttatatttattttaagGAAA ACGTCTTCTTTGTATTATTCCAATTGCAAAATCAATCGTTGAAGAACAAG AGTTATTCGGTAGGTAAACTTTCTCGTAATACTTTTTCCTTATTAGGTCA TTTACAGGGGAAAGCACACACGACACACCGCAATTCGAATCACCGCCCGT CCCACCGCCACGAACGAATAAAGGACACGCCAGGGCGTCATCACTCGATT TTAATCAAATGTTCCATAATCGTTCACCTAGAGTCAGTTCTGGTGAGTGC TAATTGCATTTTCGCGGTTCATTtctctgttgttttttttacgAGGAAAG TaagagaaaaattgaaacacTTATCAACCTTTAAAGCATTAGAACACTGG GTTCGAGTCTACTAAGATTAATACAGTTACATTCTCAAAGACAACGAATT CTGACctaatttttcttgtaaatttcTTTACCAGTCCCTTCGAAAACAAC CGTGCTTTTATGGGTTGATTGACGTCAAACATTTGAAATGctaagaaaag tgaaaaagaattgatatttttttagtcACTCGAGCATTAGATATCTGCGA GATAATTGTGCCTGAGTGGTTGTAATCTTTTAGTATTATGACATACATCA ATAATAAGTAACTGACTTTCAAATCGTTTAACGCACGTTGAATTTTCTCT TTTAGAACCGAAATTACAAGTAACGACACCAACTGACGGAACAGGCAAGA ATCCGGTAAGCCCTTTGAATTCTACATTCAATACTACATACACATTATGC TTAATTTTTGCATTATAACTTCACGTAATTTAACGCAGTAACTTcactct attcatgatatttatgacgtaatgttttcgacggaaacaccccggttttt gccagtagtggcaaattggAGCTAtagaaaaattgctcaaaatttgcCAC AACTGGCAAAAATGGAGgtttttccgtagaaaacattacgtcatgaatat caagaattctCACTATATAATATGCATGTGATTAACATCAATTTTCAGCC ACAAAAACCACCACGCTCAAATCCACCAAGCACTTCTTCAACTAATAACT CGTCTGCCGCCCCCACTGCTGCAGCCCGCCCTCGTTCGTCCAAGGGTGAT GAATATCATAGGTCACGATCACTTGATGTAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000722XLOC_000722Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001337-exon-sc0000010-1491911889:226394..226584TCONS_00001337-exon-sc0000010-1491911889:226394..226584Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:226394..226584TCONS_00001337-exon-sc0000010-1510915933:226394..226584Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:226394..226584TCONS_00001337-exon-sc0000010-1575043694:226394..226584Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:226991..227592TCONS_00001337-exon-sc0000010-1491911889:226991..227592Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:226991..227592TCONS_00001337-exon-sc0000010-1510915933:226991..227592Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:226991..227592TCONS_00001337-exon-sc0000010-1575043694:226991..227592Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:227843..228125TCONS_00001337-exon-sc0000010-1491911889:227843..228125Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:227843..228125TCONS_00001337-exon-sc0000010-1510915933:227843..228125Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:227843..228125TCONS_00001337-exon-sc0000010-1575043694:227843..228125Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:229949..230257TCONS_00001337-exon-sc0000010-1491911889:229949..230257Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:229949..230257TCONS_00001337-exon-sc0000010-1510915933:229949..230257Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:229949..230257TCONS_00001337-exon-sc0000010-1575043694:229949..230257Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:233925..234100TCONS_00001337-exon-sc0000010-1491911889:233925..234100Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:233925..234100TCONS_00001337-exon-sc0000010-1510915933:233925..234100Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:233925..234100TCONS_00001337-exon-sc0000010-1575043694:233925..234100Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:234702..234765TCONS_00001337-exon-sc0000010-1491911889:234702..234765Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:234702..234765TCONS_00001337-exon-sc0000010-1510915933:234702..234765Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:234702..234765TCONS_00001337-exon-sc0000010-1575043694:234702..234765Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:235289..235425TCONS_00001337-exon-sc0000010-1491911889:235289..235425Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:235289..235425TCONS_00001337-exon-sc0000010-1510915933:235289..235425Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:235289..235425TCONS_00001337-exon-sc0000010-1575043694:235289..235425Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:236005..236093TCONS_00001337-exon-sc0000010-1491911889:236005..236093Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:236005..236093TCONS_00001337-exon-sc0000010-1510915933:236005..236093Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:236005..236093TCONS_00001337-exon-sc0000010-1575043694:236005..236093Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:236404..236433TCONS_00001337-exon-sc0000010-1491911889:236404..236433Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:236404..236433TCONS_00001337-exon-sc0000010-1510915933:236404..236433Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:236404..236433TCONS_00001337-exon-sc0000010-1575043694:236404..236433Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:236710..237386TCONS_00001337-exon-sc0000010-1491911889:236710..237386Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:236710..237386TCONS_00001337-exon-sc0000010-1510915933:236710..237386Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:236710..237386TCONS_00001337-exon-sc0000010-1575043694:236710..237386Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:237590..237735TCONS_00001337-exon-sc0000010-1491911889:237590..237735Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:237590..237735TCONS_00001337-exon-sc0000010-1510915933:237590..237735Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:237590..237735TCONS_00001337-exon-sc0000010-1575043694:237590..237735Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:238149..238198TCONS_00001337-exon-sc0000010-1491911889:238149..238198Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:238149..238198TCONS_00001337-exon-sc0000010-1510915933:238149..238198Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:238149..238198TCONS_00001337-exon-sc0000010-1575043694:238149..238198Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1491911889:238492..238625TCONS_00001337-exon-sc0000010-1491911889:238492..238625Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1510915933:238492..238625TCONS_00001337-exon-sc0000010-1510915933:238492..238625Clytia hemisphaericaexon
TCONS_00001337-exon-sc0000010-1575043694:238492..238625TCONS_00001337-exon-sc0000010-1575043694:238492..238625Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000010supercontigsc0000010:226394..238625 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.000209687 1.25402e-09 1.78684 0.0283768 0 0 0 0 0.685337 3.22468 2.33826 0.364327 3.18985 1.07683 0.698174 1.66768 1.99033 2.36352 1.24409 3.03339 5.95966 1.91309 0.587192 3.21591 1.29918 2.28495 0.000438719 0 5.47492 3.05847
Blast
BLAST of TCONS_00001337 vs. Swiss-Prot (Human)
Match: REPS2 (RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens GN=REPS2 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 5.384e-25
Identity = 53/92 (57.61%), Postives = 64/92 (69.57%), Query Frame = 1
Query: 1471 NEEMRITQEQREYYTNQFKSLQPNEDDVIKGPQARDFFLKSNLAMETLSKIWHLSDLDKDGALNLEEFQIAMHLVVLIKHGYELPMVLPPSL 1746
            +E  RIT+EQREYY NQF+SLQP+    I G  A++FF KS L++  LS IW LSD D DGAL L EF  A HL+V  K+GY LP  LPP+L
Sbjct:  273 DEPWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTL 364          
The following BLAST results are available for this feature:
BLAST of TCONS_00001337 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
REPS25.384e-2557.61RalBP1-associated Eps domain-containing protein 2 ... [more]
back to top