Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001224 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001224
Unique NameTCONS_00001224
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2362

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001224 ID=TCONS_00001224|Name=TCONS_00001224|organism=Clytia hemisphaerica|type=transcript|length=2362bp
CCAAGCAGCTGATTCTTTTAtcatttgtatttattttatttagacataaa
aaataaaaaacaatatgCAGCTTAAACACTTAAAAACTACACTGGCTCCC
CAGGATGGAGCTGCTAAGATCACAGCAATGGCATGGGCTCCTAACAATAC
CAAAATGGCAATAGTATCAACTGATCGtgtagttgttctttttgatgAAC
ATGGAGAAAAAAGGGACAAATTTGGAACAAAACCTGGTGATGCTAAAACT
GGGAAGAAAGGTTACCAAGTGAAAGGACTAGCATTTTCTCCTGATTCCAC
CAAGATAGCTGTTGGACAAACAGATAACATTGTTTTTGTATACAAGATTG
GTGACGAATGgGGCGAAAGAAAAGTTATATGCAACAAGTTTCTCCAACAG
AGTGCTGTTACATGTTTGGTTTGGCCCCCAGAAAATCAATATATTATTTT
TGGTCTTGCTGATGGAAAGgTCAGGATGGCAAGTctaaaaaccaacaaat
cacaAACTGTCTATGGAACTGGTATCCATTGTATATCTTTGTGTGTCAGT
CCTGATGGGAAAGGTGTTTTGTCAGGGCATGCAGATGGAGCCATTGTCAG
ATATATGTTTGAAGATACTGGGACAGGTTTGACCCAGGGGCAAGTTGTGA
AACATGGCTGTCCACCGTATGCCTTGTGTTGGGGCTCATCAATCATTGCA
GCAGGATGTGATAAAAGAATTGTTGCATATGGAAAAGAAGGGCGGGTATT
ACAAAACTTCGACTATTCAAAAGATGATGAGGAAAAAGAGTTCACAGTTG
CAATAGCAAGTCCAAGTGGTCAGTCAGTGGTGGTTGGAAGTTATGATAGA
TTACGTGTTTTCAATTGGAGTCCCCGAAGAGGAGCCTGGGAAGAATCTAA
ACCAAAAGAGATCAATAATTTATACACCATCAGCTCACTTTCTTGGAAAA
GAGATGGTTCAAGGCTTTGTGCTGGCACACTCTGTGGTGGAGTTGAACTG
TTTGATTGCTGTTTGAGAAGATCTATTTTCAAGAATAAATTTGAAATGAC
TTATGTTGGGTTGAGCCAGGTTATTGTCAAAAATTTGGCATCAGGAGCCA
GAGTTGTTTTAAAATCACATTATGGATACGAGATTGATGAAGTGAAAATA
ATGGGGAAGGACAGATTTCTTGTTGGACACACTTCAGAAACATTGCTTGT
GGGAGATCTAAACGAAAACAAGCTTAGTGAGCTTCCATGGCATAATTCAG
GTGGAAATGAGAAGttcttctttgaaaatgaaacaGTTTGTATGGTATTC
AATGCAGGAGAATTATCTTTGATCGAGTATGGTCAAAATGAAGTGTTAGC
TACAGTCAGAACAGAATTCATGAACCCTCATCTTATAAGCGTACGTTTGA
ATGAAAGAAAGCTGAAAGATCAAGAAGACAATAAAAAATTGGGTTATTTG
ATTGACCTGAAAACTATATGTGTCAtgGACTTGATGTCAGGGATGGTTGT
AGCCAATATTTCACATGATgtcaaaattgactggttagaGATGAATGAGA
CTGGAAAGAAGCTCTTATTCCGAGACAAAAAACTGAGGTTATTATTGGCA
GATATTCAAAGTGAAACAAAAACCACTATTTCTACATATTGCTCTTATGT
GCAATGGGTGCCTTTGAGTGATGTTGTGGTAGCTCAAAGCAGAAGCGATC
TTTGTGTTTGGTACAATATTGAATCACCTGAACGAGTGACTATCGTTCCC
ATCAAAGGTGACATCACAGACCTTGAGAAGATCGAGGGTAAAACAAACGT
GATCGTACAAGAAGGTGTACAATCGATCAATTACACATTAGACGAAGGGC
TAATCGAGTTTGGAACTGCTATGGAAGATGGTGATTATGCTAGGGCTGTT
TCGTTTCTGGAAGGATTGGAGATGTCACCTGAAACAGAAGCTATGTGGAA
GACTCTCAGCAAGGTTGCCATGGAGAATAAAGAGCTTTTCATCGCCGAAA
GGTGTTTTGCTGCACTAGGAGATGTTTCTAAAGCTCGCTATTTACGTGGA
ATCAACGACTTGATCGATGAACTGAACCCAAGTTATGGAGATCCTATGTA
TCATCCGACTATTCGCGCCAAACTGGCCATTTTTGAGAAACAATTCAAAC
TTGCAGAAAGTATTTACTTGGAACAAGGACAAGTTGATGAAGCGATGGAG
ATGTACCAAGAAGTTCACAAGTGGGATGAATCTTTGGCCATCGCCGAAGC
CAAAAGACATCCAGAACTAGAGAACCTTAGAAGCTATTACTTGCAATATT
TGATGAAGTCAGGCCAAGAAGAAAAAGCTGGAGAGGTTAAAACCTTGAAT
TTAGTTAACAGA
Run BLAST on NCBI

transcript from alignment at sc0000007:1136849..1147653-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001224 ID=TCONS_00001224|Name=TCONS_00001224|organism=Clytia hemisphaerica|type=transcript|length=10805bp|location=Sequence derived from alignment at sc0000007:1136849..1147653- (Clytia hemisphaerica)
CCAAGCAGCTGATTCTTTTATCATTTGTATTTATTTTATTTAGACATAAA AAATAAAAAACAATATGCAGCTTAAACACTTAAAAACTACACTGGCTCCC CAGGTATGAAAACTTTCTTTTTTACAGTGTTGTAACTTTTCTCTTCATAT AAAAAACTATTTAGGAATGAAATATTAAAGAACTCAAAATATAACCATTG CTGAACTTTATCTTTTTCATTTCACCCAGAGGCAAGACTGTTTAATCCTT TCTAGTATGATTTATTGTTATACCTTTAAATTGTAATTTTTATGAAGGAT GGAGCTGCTAAGATCACAGCAATGGCATGGGCTCCTAACAATACCAAAAT GGCAATAGTATCAACTGATCGTGTAGTTGTTCTTTTTGATGAACATGGAG AAAAAAGGGACAAATTTGGAACAAAACCTGGTGATGCTAAAGTAAGCTCT ATCTAAGTCAAAAAATCCCTTTGTGATAGAACAAATAAAAGTTATCACAT GATATCGATTACAATATGGGATGTATTATATTAAGTTAAACTTTTTCCTC ATATTTTTGAGCCCGTATGCCAGGAAACTATCAAAAACTTTGAACAAGAA AAATATATCCAATATTGTGCGAGTAAGTTTGATAATTGGTTTAGCATTAA CTTGAAAAATACGACCAAACTTTTCTCTCTCCATTTGTGTCTTTTTCTAT GTTTTTTTTTCTCTTCATGCATTTTGTTCTTCCTCTATTTTGATGAAATT AACACCAAAACATTTATAAAAAATCCAAAGGTCATTAAAATGTTAAAAAC ATTCTTTTGTATAACTCTTCGGATGATTTGCTGCTCTATCAGCCAATCAG ATTGCTCATATTTTTCATGTTGATGAAAAGATTAAATTATTTTAGTAGTC ACATAAGCATAAGCCTTGGATGAAATAATGAATCTTCTTCATTTATTGAT TTCAAATCTTTCTTACTATCCACACCAAAGTTACCTTTCTAAATGATTGT TCTTTTAGACTGGGAAGAAAGGTTACCAAGTGAAAGGACTAGCATTTTCT CCTGATTCCACCAAGATAGCTGTTGGACAAACAGATAACATTGTTTTTGT ATACAAGATTGGTGACGAATGGTAAGACTAAGAACATTGATCTTTCTAAA AACTGAAACATCTACAGTCAGATATTATTTACTTATATTTGAAGATCGAA CATAATATGAAAATGTTATTTATATATATTAATTAATTTTTGATTTTATT TTAGGGGCGAAAGAAAAGTTATATGCAACAAGTTTCTCCAACAGGTAAAG TATCTTTTTAAATTGATTATTATTTCATCACAAGAGAAATTTTTTTAACA TTTGATACCATAGTATTGTATTATCCTATACTGTGTTAAATGAATGATTT TACTTTACACATCTGCTATAATAATATAATTTAATGAGGATCAATTTTTA CATTAGAGTGCTGTTACATGTTTGGTTTGGCCCCCAGAAAATCAATATAT TATTTTTGGTCTTGCTGATGGAAAGGTTTGTGACTTTTGACATTTTGACT TTTATGATGGATGATATCTCTTTTGGGATTCAAATTTTATAAATTGATAA AGTAAAATAGTTGTCTGTTTGACCATACCTCCTAAATCTATAGGGCTGAC AAAATGAATGGCAAAAAAAGTGTTTTTAAAACCAGCCTAATGTCACCCCA TAAGTGACCATTTCTTAGCTGAACAGTTAATTTATTTTTTTGAAAACAAA TAATTAATTTTACTATACTCATGAATTTTAAAAATCAAAAGGTGATCCTA AAAGTCTCAGCTTTCAAAGATGGTTACATTTAAGAGATGGTATTGGTAGG AAAGGGAGATCTACTTTTTAACCTGGAAATATATATTGACGATATAAAGC ATACAAACACCTAAAATTTTAGATCACACTTCAAATGATTGAGTTTGAGA ATGATTATTTTCTTCATCTTTCTGTAATGTTTTAAAATTTCCATTTTTTT TTAGGTCAGGATGGCAAGTCTAAAAACCAACAAATCACAAACTGTCTATG GAACTGGTATCCATTGTATATCTTTGTGTGTCAGGTTGGCATTCTGTTTT AATTACATAAATGATTTTCAAACTATAAAATGAAAGCAATATTACTATTA TGTTAAGTCTTTGAAGCTTGTAAATGAAGACATAATTGAGTACAGCTTTC AAGAAACTACTTTAACAATTCATATTTAAGCATTTTCACAACAGATAATA AACTAAAAATTTTTTTGAAAAAGTTTCATTTAATATAAACATTTTCTTGA CTGGACAAATCCAATAACTGTTTCAGGTTAAATTATCTTTGCCATCTGTT CTCTTTTTAGTCCTGATGGGAAAGGTGTTTTGTCAGGGCATGCAGATGGA GCCATTGTCAGATATATGTTTGAAGATACTGGGACAGGTTTGACCCAGGT ATTTTACATATTAAATGTTAAAACATTTAAAGTAGACAAACTAAACTAAT ATTAGGTATATTTCTTTTTGAGAAGTCCGACTGTTACTAGAAGAGTCAAT TGCACTTCAGACAAACAATCATTCCAAAGAATAATTTGCAAATTTCTTTT TTTTTGAAGTGCATTACACAAAGAATAATACAAAGAATTATATGCTATCC TAATATTCAAATCTCAAGATTGGTTCGATTTTTTCCATAGGGGCAAGTTG TGAAACATGGCTGTCCACCGTATGCCTTGTGTTGGGGCNTACAAGAGAAA ATTTTTTAACATTTGATACCACAGTATTGTATTATCCTATACTGTGTTAA ATGAATGATTTTACTTTACACATCTGCTATAATAATATAATTTAATGAGA ATCAATTTTTACATTAGAGTGCTGTTACATGTTTGGTTTGGCCCCCAGAA AATCAATATATTATTTTTGGTCTTGCTGATGGAAAGGTTTGTGACTTATG ACATTTTGACTTTTATTATATCATGATATAATGATGGATGATATCTCTTT TAGGATTCAAATTTTATAAATTGATGAAGTAAAATAGTTGTCTGTTTGAC CATACCTCCTAAATCTATAGGGCTGACAAAATGAATTGCAAAAAAAGTGT TTTTAAAACCAGCCTAATGTCACCCCATAAGTGGCCATTTCTTAGCTGAA CAGTTAATTTATTTTTTTGAAAACATATAATTAATTTTACTATACTCGTG AATTTTAAATATCAAAAGGTGGTCCTAAAAGTCTCAGCTTTCAAGATGGT TACATTTAAGAGATGGTATTGTTAGGAAAGGGAGATCTACTTTTTAACCT GGAAATATATATTGACGATATAAAGCATACAAACACCTAAAATTTTAGAT CACACTTCAAATGATTGAGTTTGAGAATGATTATTTTCTTCATCTTTCTG TAATGTTTTAAAATTTCCATTTTTTTTTAGGTCAGGATGGCAAGTCTAAA AACCAACAAATCACAAACTGTCTATGGAACTGGTATCCATTGTATATCTT TGTGTGTCAGGTTGGCATTCTGTTTTAATTACATAAATGATTTTCAAACT ATAAAATGAAAGCAATATTACTATTATGTTAAGTCTTTGAAGCTTGTAAA TGAAGACATAATTGAGTACAGCTTTCAAGAAACTACTTTAACAATTCATA TTTAAGCATTTTCACAACAGATAATAAACTAAAAATTTTTTTGAAAAAGT TTCATTTAATATAAACATTTTCTTGACTGGACAAATCCAATAACTGTTTC AGGTTAAATTATCTTTGCCATCTGTTCTCTTTTTAGTCCTGATGGGAAAG GTGTTTTGTCAGGGCATGCAGATGGAGCCATTGTCAGATATATGTTTGAA GATACTGGGACAGGTTTGACCCAGGTATTTTACATATTAAATGTTAAAAC ATTTAAAGTAGACAAACTAAACTAATATTAGGTATATTTCTTTTTGAGAA GTCCGACTGTTACTAGAAGAGTCAATTGCACTTCAGACAAACAATCATTC CAAAGAATAATTTGCAAATTTCTTTTTTTTTGAAGTGCATTACACAAAGA ATAATACAAAGAATTATATGCTATCCTAATATTCAAATCTCAAGATTGGT TCGATTTTTTCCATAGGGGCAAGTTGTGAAACATGGCTGTCCACCGTATG CCTTGTGTTGGGGCTCATCAATCATTGCAGCAGGATGTGATAAAAGAATT GTTGCATATGGAAAAGAAGGTATTGTTTTTTGAGCTTATGTTTCACGAGA AAATCATTTTTATTTAACAAATGATTAATCCTAATATTTCATTTCCCTAA ACTCTCTTTAGGGCGGGTATTACAAAACTTCGACTATTCAAAAGATGATG AGGAAAAAGAGTTCACAGTTGCAATAGCAAGTCCAAGTGGTCAGTCAGTG GTGGTTGGAAGTTATGATAGATTACGTGTTTTCAATTGGAGTCCCCGAAG AGGAGCCTGGGAAGAATCTAAACCAAAAGAGATCAATAATTTATACACCA TCAGCTCACTTTCTTGGAAAAGAGATGGTTCAAGGCTTTGTGCTGTAAGT TAGATAATTCCCTCTTATTTTTTGTCCTGCTGGAATATAGGTTTTAATAC ATAAAGACAGTTTGACTTACATATGGATGAAAAGTTTCAATTAGTATTCT ACATGCAAATATAAAGAATTTTTTTAAATGGTATTTACAAATATATCATA ATACAGTAGCTAAATCTTACTGAATAATATTATTTCTGACTTCAGGGCAC ACTCTGTGGTGGAGTTGAACTGTTTGATTGCTGTTTGAGAAGATCTATTT TCAAGAATAAATTTGAAATGACTTATGTTGGGTTGAGCCAGGTAAAATGA AGGATTTTTTGTTATACTTTTGAAGATATTAACCCTTCAACCCTTTCAGA CCCGGTACACACGATTTAAATCTGCCAAAATACCAAGTCCTGACCACTTG ATTTAAAAGGGCATACACCGGATGCTGTTAGAAAGAGTACAAAAATATCT TTTCAATGGTACAAAAACCATTGCCTAAGTCTCAAGTTAAAACCTTTTAT GCCAATTTGAAAATTTGGAAAAAATGTTGCGCGCTGGAAAGGTTAAGAAA AAATTAAATAAGAATCTGTATTTTGTAAAAAATATCTAAAAAATTGTCCA GAGGAAAACCAATTTTCTCTGTCTGTGCGAGAGTGTGGAACATATAACAT AGTTGAAAATAACACATCATCTTTCTTATGAAAATTTCTGCCAACTGGCC TTTTTCAACATAAAAATGAATTTAATGTTCTTCATTCGCCGCTGTGAGGA GACATTCTTAATGTTAGCAAAGGAAAGCTTACGTTCTGCTCTCTAAAGAG CAAATCATCTCGTTTCGGTTCTCTAGCCTTCAGAATTTCTCGACTGACTA GTTGGTCACTATCCTTGTTTTTTTTTAGCCACAGTGCTAGCTGGTTGCAA TTGAGGTCAAAAAAAGAAATGTTCTGAACAGATGCGATTCAAGCGCAGGC CCTGGCCATAAGGAATGGCCTTTTTTGAATGAAATGCACAATTATAAAAA AATATTTAGTTATTTTCACTAACATTACAAATACAAAGAAACTTTGTTAT TATTAATGCTAACTGTTGATTTCTAGGTTATTGTCAAAAATTTGGCATCA GGAGCCAGAGTTGTTTTAAAATCACATTATGGATACGAGGTTTGTATATA AATAATTTTTATAAGTAGAAAATCTATCATCAATATTTCTGCCTAATCAA CTTTTTCTCAAGAATCTGTAATATCATATTTTAAAGTTATATTTCTTGGC CCATTATTATCCCTTGCTGATGTTTTTAGATTGATGAAGTGAAAATAATG GGGAAGGACNTTGTCCACCGTATGCCTTGTGTTGGGGCTCATCAATCATT GCAGCAGGATGTGATAAAAGAATTGTTGCATATGGAAAAGAAGGTTTTGT TTTTTGAGCTTATGTTTCACGAGAAAATCATTTTTATTTAACAAATGATT AATCCTAATATTTCATTTCCCTAAACTCTCTTTAGGGCGGGTATTACAAA ACTTCGACTATTCAAAAGATGATGAGGAAAAAGAGTTCACAGTTGCAATA GCAAGTCCAAGTGGTCAGTCAGTGGTGGTTGGAAGTTATGATAGATTACG TGTTTTCAATTGGAGTCCCCGAAGAGGAGCCTGGGAAGAATCTAAACCAA AAGAGATCAATAATTTATACACCATCAGCTCACTTTCTTGGAAAAGAGAT GGTTCAAGGCTTTGTGCTGTAAGTTAGATAATTCCCTCTTATTTTTTGTC CTGCTGGAATATAGGTTTTAATACATAAAGACAGTTTGACTTACATATGG ATGAAAAGTTTCAATTACTATTCTACATGCAAATATAAAGAATTTTTTTA AATGGTATTTACAAATATATCATAATACAGTAGCTACATCTTACTGAATA ATATTATTTCTGACTTCAGGGCACACTCTGTGGTGGAGTTGAACTGTTTG ATTGCTGTTTGAGAAGATCTATTTTCAAGAATAAATTTGAAATGACTTAT GTTGGGTTGAGCCAGGTAAAATGAAGGATTTTTTGTTATACTTTTGAAGA TATTAACCCTTCAACCCTTTCAGACCCGGTACACACGATTTAAATCTGCC AAAATACCAAGTCCTGACCACTTGATTTAAAAGGGCATACACCGGATGCT GTTAGAAAGAGTACAAAAATATCTTTTCAATGGTACAAAAACCATTGCCT AACTCTCAAGTTAAAACCTTTTATGCCAATTTGAAAATTTGGAAAAAATG TTGCGCGCTGGAAAGGTTAAGAAAAAATTAAATAAGAATCTGTATTTTGT AAAAAATATCTAAAAAATTGTCCAGAGGAAAACCAATTTTCTCTGTCTGT GCGAGAGTGTGGAACATATAACATAGTTGAAAATAACACATCATCTTTCT TATGAAAATTTCTGCCAACTGGCCTTTTTCAACATAAAAATGAATTTAAT GTTCTTCATTCGCCGCTGTGAGGAGACATTCTTAATGTTAGCAAAGGAAA GCTTACGTTCTGCTCTCTAAAGAGCAAATCATCTCGTTTCGGTTCTCTAG CCTTCAGAATTTCTCGACTGACTAGTTGGTCACTATCCTTGTTTTTTTTT AGCCACAGTGCTAGCTGGTTGCAATTGAGGTCAAAAAAAGAAATGTTCTG AACAGATGCGATTCAAGCGCAGGCCCTGGCCATAAGGAATGGCCTTTTTT GAATGAAATGCACAATTATAAAAAAATATTTAGTTATTTTCACTAACATT ACAAATACAAAGAAACTTTGTTATTATTAATGCTAACTGTTGATTTCTAG GTTATTGTCAAAAATTTGGCATCAGGAGCCAGAGTTGTTTTAAAATCACA TTATGGATACGAGGTTTGTATATAAATAATTTTTATAAGTAGAAAATCTA TCATCAATATTTCTGCCTAATCAACTTTTTCTCAAGAATCTGTAATATCA TATTTTAAAGTTATATTTCTTGGCCCATTATTATCCCTTGCTGATGTTTT TAGATTGATGAAGTGAAAATAATGGGGAAGGACAGATTTCTTGTTGGACA CACTTCAGAAACATTGCTTGTGGGAGATCTAAACGAAAACAAGCTTAGTG AGGTAAGTTCCTTCCTCAAGAACTATTTTTGAAATTAATATCATAAGATC TTTCAAGTGACATTATGGAACATAAAAAATAACAGAACTTGATTTTGATA ATTATACTGTTTTGTTTTTATGATTCAGCTTCCATGGCATAATTCAGGTG GAAATGAGAAGTTCTTCTTTGAAAATGAAACAGTAAGTTTGTTTAAAATT CAATACATTTTTCTTTTGGAAAAAGTAAAACAAAGAAAGTAGATTACTTC AAAACAATTTTAAATCTTTCAAAGGTTCCTTAGCTTGCCACTGCTAAAAT CATACCTTGTTAGCATTACGAGTTTCAGGACTTCTATGTGTTACTTTGTT ATTGTTTTAATCAATTAGGTTTGTATGGTATTCAATGCAGGAGAATTATC TTTGATCGAGTATGGTCAAAATGAAGTGTTAGCTACAGTCAGAACAGAAT TCATGAACCCTCATCTTATAAGGTAATGATTTTTCAAATGCAGATATGAA ACGATTGTGAAATGTATTCTAGGGTTATGATATTTAGAATTTGATTTTTG AATAGTCTATTCCATTAAACAAATTTCTTTAGATATTTCAGAATAATTTA CCCTGCTGCCTCACATTCCTGCCTTGGTATTTTTACCGGAAAGAATTGAA ACTCCATTCTTTCTTACCAGCCATCCCTCTGTAAGAACTAGACTGGACGC TAGTCAGTATGATTCTCAATAGCAGTATTTCTTGACTTAACTTTTTCAGC GTACGTTTGAATGAAAGAAAGCTGAAAGATCAAGAAGACAATAAAAAATT GGGTTATTTGATTGACCTGAAAACTATATGTGTCAGTAAGTAAACGTTTT GTAAAAAATCGACTATTTTGGCATTATTAGCAGCATTTCTCATTTCTATC GGGTGAATACAGATTTGAAATATTTGGGCTATTATGCTAAGCTCAGTTGT AAATTAGCCTTAGGATTTTAGTTTTTTTTTACTTTAAATTTCTTTAATTT TCAGTGGACTTGATGTCAGGGATGGTTGTAGCCAATATTTCACATGATGT CAAAATTGACTGGTTAGAGGTACTCCACTCTCATCTCTTATTGTCTCTAA GTTATGAATTTCCAAGATAATATATTTATATTTAGATGCAAATCTCAAGA GTTTGAGTGGTTGACAAATCTTGAATTTTCTCTGTTTATAGATGAATGAG ACTGGAAAGAAGCTCTTATTCCGAGACAAAAAACTGAGGGTAAGTAATTT AGATAATTTCCGATACTCTTCCTCAAATTAGGACAGTTGTTTTAAAGTGT GAAGTGATTTCTGGTTTCAACTTCTAATTATAGTACACTTACCTCTCAAC TTTTAGTTATTATTGGCAGATATTCAAAGTGAAACAAAAACCACTATTTC TACATATTGCTCTTATGTGCAATGGGTGCCTTTGAGTGATGTTGTGGTAG CTCAAAGCAGAAGCGATCTTTGTGTTTGGTACAATATTGAATCACCTGAA CGAGTGACTATCGTTCCCATCAAAGTAAGAGACCATTTTGTTCATTTCCT CTCAAAGGCTTAACGGCGATCAAAAATAAACTATTTAAAAACTATTTTTT ATGTCTTTTGATTCTTTCTAATGACTTGTAATAATGACTTGTAATTTGAG GGGTCGTTTGTTAAATTTGGTCAACTAGGTAAAAAGCTATGGCCTAAATG CTAAAATATTACTTTTCAAAAAAGTAAAAAAAATGGCGAAAAATGAGGGT ATTAAATCATCATAAAGATATCATAAAGAAATCTTTCTTTTATCAATTTA TTAACGATCGAAGTCTCTTCGTCCTCTTCGTGGCCAGTTTCCAAGAAAGG TGGTCAACAATCGAGGAGATGTTGAGTGACCCCTAAGTTCGCCTGAGCTT ACAGTGTGTGATTTCTTTTTGTGGGGTTACACGAAACAAGAAATCTGGGA GCAACTCACAAATTTGCAATTCCAGACCCTTGATCAATGAAAGCTTCAAT CAAATATGAAGACTTGGCAAATCGATTTTATATTATTTTCTCATGATAAA AAATTACATTAATTGACTTTGTGACCCTTGTTTTACACGGTTTAGCCTAC GATCGAGGCACCCTTATTCTGGATTTGTTATTCGAATTTCAAATCAAAGT TGAAAAGACACTGGTTTGGAATGTTAAGTTAAACTTTCCTTGCATGTTTA GGGTGACATCACAGACCTTGAGAAGATCGAGGGTAAAACAAACGTGATCG TACAAGAAGGTGTACAATCGATCAATTACACATTAGACGAAGGGCTAATC GAGTTTGGAACTGCTATGGAAGATGGTGATTATGCTAGGTTTGTCTTATT GGTTATTTTAATTAGATTTTAAGACATTGATCTTCTAATGCTGCAGCAAA TTTTTTAACATAAACAAACTTATTAAGATAAGGGTTATTTTTTATTGAGA TTTTCTTCTCAAAATGCTTCAACTGAGAGATTTTACCTGTCGTCTTTTCT TCGTTGTATTACTTTTTTTTGCTCAGAAATCTGATATAAAATTGTATTTT GTTCAGGGCTGTTTCGTTTCTGGAAGGATTGGAGATGTCACCTGAAACAG AAGCTATGTGGAAGACTCTCAGCAAGGTTGCCATGGAGAATAAAGAGCTT TTCATCGCCGAAAGGTAAGACATAAATATGATCCAACAATCATGATTCAA TGCATAGTCCGAAACATTTTTTCTACAAAGGCTCTTTTAAGAGGATTCTG TAATGGGGTTCTTAAACTTTTCAAAATATATTTTTGCTTTGTAGGTGTTT TGCTGCACTAGGAGATGTTTCTAAAGCTCGCTATTTACGTGGAATCAACG ACTTGATCGATGAACTGAACCCAAGTTATGGAGATCCTATGTATCATCCG ACTATTCGCGCCAAACTGGCCATTTTTGAGAAACAATTCAAACTTGCAGA AAGTATTTACTTGGAACAAGGACAAGTTGATGAAGCGATGGAGATGTACC AAGAAGTTCACAAGTGGGATGAATCTTTGGCCATCGCCGAAGCCAAAAGA CATCCAGAACTAGAGAACCTTAGAAGCTATTACTTGCAATATTTGATGAA GTCAGGCCAAGAAGAAAAAGCTGGAGAGGTTAAAACCTTGAATTTAGTTA ACAGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000661XLOC_000661Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001224-exon-sc0000007-1575043694:1147551..1147653TCONS_00001224-exon-sc0000007-1575043694:1147551..1147653Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1147213..1147356TCONS_00001224-exon-sc0000007-1575043694:1147213..1147356Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1146533..1146645TCONS_00001224-exon-sc0000007-1575043694:1146533..1146645Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1146360..1146399TCONS_00001224-exon-sc0000007-1575043694:1146360..1146399Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1146129..1146197TCONS_00001224-exon-sc0000007-1575043694:1146129..1146197Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1144144..1144223TCONS_00001224-exon-sc0000007-1575043694:1144144..1144223Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1143780..1143867TCONS_00001224-exon-sc0000007-1575043694:1143780..1143867Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1143435..1143537TCONS_00001224-exon-sc0000007-1575043694:1143435..1143537Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1143110..1143342TCONS_00001224-exon-sc0000007-1575043694:1143110..1143342Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1141089..1141184TCONS_00001224-exon-sc0000007-1575043694:1141089..1141184Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1140241..1140303TCONS_00001224-exon-sc0000007-1575043694:1140241..1140303Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1140002..1140100TCONS_00001224-exon-sc0000007-1575043694:1140002..1140100Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1139822..1139875TCONS_00001224-exon-sc0000007-1575043694:1139822..1139875Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1139532..1139635TCONS_00001224-exon-sc0000007-1575043694:1139532..1139635Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1139169..1139254TCONS_00001224-exon-sc0000007-1575043694:1139169..1139254Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1138935..1138999TCONS_00001224-exon-sc0000007-1575043694:1138935..1138999Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1138765..1138812TCONS_00001224-exon-sc0000007-1575043694:1138765..1138812Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1138480..1138647TCONS_00001224-exon-sc0000007-1575043694:1138480..1138647Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1137666..1137802TCONS_00001224-exon-sc0000007-1575043694:1137666..1137802Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1137340..1137447TCONS_00001224-exon-sc0000007-1575043694:1137340..1137447Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1575043694:1136849..1137209TCONS_00001224-exon-sc0000007-1575043694:1136849..1137209Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1147551..1147653TCONS_00001224-exon-sc0000007-1510915933:1147551..1147653Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1147213..1147356TCONS_00001224-exon-sc0000007-1510915933:1147213..1147356Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1146533..1146645TCONS_00001224-exon-sc0000007-1510915933:1146533..1146645Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1146360..1146399TCONS_00001224-exon-sc0000007-1510915933:1146360..1146399Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1146129..1146197TCONS_00001224-exon-sc0000007-1510915933:1146129..1146197Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1144144..1144223TCONS_00001224-exon-sc0000007-1510915933:1144144..1144223Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1143780..1143867TCONS_00001224-exon-sc0000007-1510915933:1143780..1143867Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1143435..1143537TCONS_00001224-exon-sc0000007-1510915933:1143435..1143537Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1143110..1143342TCONS_00001224-exon-sc0000007-1510915933:1143110..1143342Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1141089..1141184TCONS_00001224-exon-sc0000007-1510915933:1141089..1141184Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1140241..1140303TCONS_00001224-exon-sc0000007-1510915933:1140241..1140303Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1140002..1140100TCONS_00001224-exon-sc0000007-1510915933:1140002..1140100Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1139822..1139875TCONS_00001224-exon-sc0000007-1510915933:1139822..1139875Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1139532..1139635TCONS_00001224-exon-sc0000007-1510915933:1139532..1139635Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1139169..1139254TCONS_00001224-exon-sc0000007-1510915933:1139169..1139254Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1138935..1138999TCONS_00001224-exon-sc0000007-1510915933:1138935..1138999Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1138765..1138812TCONS_00001224-exon-sc0000007-1510915933:1138765..1138812Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1138480..1138647TCONS_00001224-exon-sc0000007-1510915933:1138480..1138647Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1137666..1137802TCONS_00001224-exon-sc0000007-1510915933:1137666..1137802Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1137340..1137447TCONS_00001224-exon-sc0000007-1510915933:1137340..1137447Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1510915933:1136849..1137209TCONS_00001224-exon-sc0000007-1510915933:1136849..1137209Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1147551..1147653TCONS_00001224-exon-sc0000007-1491911889:1147551..1147653Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1147213..1147356TCONS_00001224-exon-sc0000007-1491911889:1147213..1147356Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1146533..1146645TCONS_00001224-exon-sc0000007-1491911889:1146533..1146645Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1146360..1146399TCONS_00001224-exon-sc0000007-1491911889:1146360..1146399Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1146129..1146197TCONS_00001224-exon-sc0000007-1491911889:1146129..1146197Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1144144..1144223TCONS_00001224-exon-sc0000007-1491911889:1144144..1144223Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1143780..1143867TCONS_00001224-exon-sc0000007-1491911889:1143780..1143867Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1143435..1143537TCONS_00001224-exon-sc0000007-1491911889:1143435..1143537Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1143110..1143342TCONS_00001224-exon-sc0000007-1491911889:1143110..1143342Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1141089..1141184TCONS_00001224-exon-sc0000007-1491911889:1141089..1141184Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1140241..1140303TCONS_00001224-exon-sc0000007-1491911889:1140241..1140303Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1140002..1140100TCONS_00001224-exon-sc0000007-1491911889:1140002..1140100Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1139822..1139875TCONS_00001224-exon-sc0000007-1491911889:1139822..1139875Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1139532..1139635TCONS_00001224-exon-sc0000007-1491911889:1139532..1139635Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1139169..1139254TCONS_00001224-exon-sc0000007-1491911889:1139169..1139254Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1138935..1138999TCONS_00001224-exon-sc0000007-1491911889:1138935..1138999Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1138765..1138812TCONS_00001224-exon-sc0000007-1491911889:1138765..1138812Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1138480..1138647TCONS_00001224-exon-sc0000007-1491911889:1138480..1138647Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1137666..1137802TCONS_00001224-exon-sc0000007-1491911889:1137666..1137802Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1137340..1137447TCONS_00001224-exon-sc0000007-1491911889:1137340..1137447Clytia hemisphaericaexon
TCONS_00001224-exon-sc0000007-1491911889:1136849..1137209TCONS_00001224-exon-sc0000007-1491911889:1136849..1137209Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1136849..1147653 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.527038 0.0587264 0.707681 5.89152 10.4508 4.77052 13.9734 12.4368 5.99312 0.439337 5.64914 3.16376 0.304808 0.508104 0.321478 0.00360533 3.59151 0.517288 2.6867e-05 5.50508 0.13374 1.47955 0.165605 2.12982 8.06948 14.3883 0.00827292 0.0725102 2.95505 2.18801
Blast
BLAST of TCONS_00001224 vs. Swiss-Prot (Human)
Match: IF172 (Intraflagellar transport protein 172 homolog OS=Homo sapiens GN=IFT172 PE=1 SV=2)

HSP 1 Score: 1090.87 bits (2820), Expect = 0.000e+0
Identity = 510/761 (67.02%), Postives = 636/761 (83.57%), Query Frame = 2
Query:   65 MQLKHLKTTLAPQDGAAKITAMAWAPNNTKMAIVSTDRVVVLFDEHGEKRDKFGTKPGDAKTGKKGYQVKGLAFSPDSTKIAVGQTDNIVFVYKIGDEWGERKVICNKFLQQSAVTCLVWPPENQYIIFGLADGKVRMASLKTNKSQTVYGTGIHCISLCVSPDGKGVLSGHADGAIVRYMFEDTGTGLTQGQVVKHGCPPYALCWGS-SIIAAGCDKRIVAYGKEGRVLQNFDYSKDDEEKEFTVAIASPSGQSVVVGSYDRLRVFNWSPRRGAWEESKPKEINNLYTISSLSWKRDGSRLCAGTLCGGVELFDCCLRRSIFKNKFEMTYVGLSQVIVKNLASGARVVLKSHYGYEIDEVKIMGKDRFLVGHTSETLLVGDLNENKLSELPWHNSGGNEKFFFENETVCMVFNAGELSLIEYGQNEVLATVRTEFMNPHLISVRLNERKLKDQEDNKKLGYLIDLKTICVMDLMSGMVVANISHDVKIDWLEMNETGXXXXXXXXXXXXXXADIQSETKTTISTYCSYVQWVPLSDVVVAQSRSDLCVWYNIESPERVTIVPIKGDITDLEKIEGKTNVIVQEGVQSINYTLDEGLIEFGTAMEDGDYARAVSFLEGLEMSPETEAMWKTLSKVAMENKELFIAERCFAALGDVSKARYLRGINDLIDELNPSY-GDPMYHPTIRAKLAIFEKQFKLAESIYLEQGQVDEAMEMYQEVHKWDESLAIAEAKRHPELENLRSYYLQYLMKSGQEEKAGEVK 2341
            M LKHL+T L+PQDGAAK+T MAW+ NN K A+ + DRVV+L+DEHGE+RDKF TKP D K G+K Y VKG+AFSPDSTKIA+GQTDNI++VYKIG++WG++KVICNKF+Q SAVTCL WP E   I+FGLA+GKVR+A+ KTNKS T+YGT  + +SL  +  GKG+LSGHADG IVRY F+D G+G +QG++V H CPPYAL W + SI+AAGCD++IVAYGKEG +LQ FDYS+D +E+EFT A++SP GQSVV+GSYDRLRVFNW PRR  WEE+KPKEI NLYTI++L+WKRDGSRLC GTLCGGVE FDCCLRRSI+KNKFE+TYVG SQVIVKNL+SG RVVLKSHYGYE++EVKI+GK+R+LV HTSETLL+GDLN N+LSE+ W  SGGNEK+FFENE VCM+FNAGEL+L+EYG N+ L +VRTEFMNPHLISVR+NER  +  EDNKKL YLID+KTI ++DL+ G  +  +SH+ ++DWLE+NETG KLLFRD+KLRL L DI+S +KT I  +CSY+QWVP SDV+VAQ+R+ LCVWYNIE+PERVT+  I+GD+  LE+  GKT V+V EGV ++ YTLDEGLIEFGTA++DG+Y RA +FLE LEM+PETEAMWKTLSK+A+E ++L IAERCF+ALG V+KAR+L   N++ D+++  Y G+      +RA+LA+ EK +KLAE I+LEQ  V+EAM MYQE+H+WDE +A+AEAK HP LE LR  Y Q+LM + QEE+AGE++
Sbjct:    1 MHLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAE-YIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAWATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQEREFTTAVSSPGGQSVVLGSYDRLRVFNWIPRRSIWEEAKPKEITNLYTITALAWKRDGSRLCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIGTVSHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYMQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMFTIRGDVIGLERGGGKTEVMVMEGVTTVAYTLDEGLIEFGTAIDDGNYIRATAFLETLEMTPETEAMWKTLSKLALEARQLHIAERCFSALGQVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMGMYQELHRWDECIAVAEAKGHPALEKLRRSYYQWLMDTQQEERAGELQ 760          
The following BLAST results are available for this feature:
BLAST of TCONS_00001224 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
IF1720.000e+067.02Intraflagellar transport protein 172 homolog OS=Ho... [more]
back to top