Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001218 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001218
Unique NameTCONS_00001218
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3422

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001218 ID=TCONS_00001218|Name=TCONS_00001218|organism=Clytia hemisphaerica|type=transcript|length=3422bp
aatattcaatggaagaaagtggaagtgctaaaatagcaattctcgcccga
actttaaattctgaaaaacgttaaaatacactaaaatctcaatatatttc
gaaggTGATTGTAGGTTTAAAATTATTAACTTCTTACCTTTGATTGTAGA
GTCTTGCCAATGACCAAGGTCTTCTGGAACGAATAGCTGCTGCTCTACTG
AAAGGATCCTTTtatgaaaagGCTGGCGAACTGTTCCAAAGAGTCGGTTC
CGACCAGCGTGCACTAGATGCGTATCGTAAAGGGAAAGCATATCGACGAG
CGGTGGAGTTAGCACGCTCCTCCTTCCCACGAGAAGTTGTCAAACTTGAA
GAAGAATGGGGAAACCATTTAGTGCTCCATAAACAATTGGACGCTGCTAT
CAACCATTTCATTGAAGCTGGTTCTTCACAAAAAGCCATCGACGCTGCCA
TCCAAGCACGACAATGGAACAAAGCTGTTCAAATCGTCGAGTTGCAAGAT
GAAGATGTTGTTGAAAAATATTACAAAATCTTGGCAGAACATTATGCTCA
AGTTGGTGAATACCAGATGGCCGAACGATTTTATGTTCGAGGTAACATGC
CACGTACAGCTGTGGAAATGTACACCAAAGTCAATAAATACGAAGCCGCT
TACAAGCTCGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTATA
CATTGCACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTG
AAAAGTTATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTAT
AAACGAGCAAAGATGTACGACCAAATGATTAAACTGGTGAAAGAATACCA
CGGAGACTTGATCACAGATACTCATCTACACCTTGCTAAGGAATTGGAAT
CAGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGAT
TGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATGC
GTACAGGATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGG
CTTATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTG
CAAAAACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTGACACAAC
ATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGG
TGATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGC
TTCAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGC
TGTTCTTATGTATATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGG
CAGAGAGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCC
CGTTTGTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTT
GAGAGCACAACGTCCAGAATTAGCCATCAAATTTTACAAGgaGTGTCAAC
GCTGGCCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGTTG
GCAGCCTTACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGA
TAAAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGG
CCGAGTATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACATG
GCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACT
GGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCT
GTAAACGCTTATTGGAAATGCAAGCTTACGAAACTGCATCAGATTTGTAT
CAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGA
TTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAGTACG
AAGAACACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAG
ACTGACGAGCTGATCAACGTGGATGTGATCGCAGCACTTGACATGTATGT
GGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAGCAACAGagTT
TCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATCAAA
GATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGCACC
TGCCAATCCACAGAATTTCAACATCTACAAACGTTTAGTTGAAGATTTAT
TCGCCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGAT
CTCAGAACAATGCTTTATGATCTGTGTGATGGGTTCAACAAGAAGCCGAC
CAACCCTGCAGTCATGGATATCTTCAACAGGATGCTTCTCGTGGCTCACT
ATTACGCCATCCGGTCTGCTATCACCAAAAACAGCCAATTGgaggTTCTA
CATGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGATCTTATACCGTG
CGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGGGTGTTGGATGGG
AAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGGGC
ATCGAAGATGGTAACCTTGATGCGATTGACAACACAGATATCATGGACAC
AGATATTCCGTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAATGAGG
AGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAA
CGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTC
TTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAG
GTTATCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCT
GCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGTGTCACA
CAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGAA
CGTCTGGAAACCAAGCCTTCTCGTTTGGGTAACGTCTAAATAACAACAAC
ATGAGCTGGGCTCAATTCTCAAAACAATATGTTCACAACATGTAGATCAA
TCAACATGTAGATCAGATTCTAGTGACTTGTAGAAAATTGTAGAGATTCT
TTTCACGGTGCAAATATGATATTAATTTATTGGGTACATTTATAAATATT
GTTTACTGTAATATAATTCTATGTTTGTCgtcaaatttttaactttttcc
cTTCAGTTCATTTTGTATATACTTGAATAATGATAAAACTGGAAAATAAA
TGTCGTTAGTGGTAATACAGTATTCGAAATTATCTTGttgcttcttttta
ttcttataaatttgatttttttaatttttggacctaccacagtggggtag
aggtcctataaattaacctttg
Run BLAST on NCBI

protein sequence of TCONS_00001218-protein

>TCONS_00001218-protein ID=TCONS_00001218-protein|Name=TCONS_00001218-protein|organism=Clytia hemisphaerica|type=polypeptide|length=821bp
MAERFYVRGNMPRTAVEMYTKVNKYEAAYKLAVRCMDSDDVSKLYIAQAE
QLEAQGRFKEAEKLYIMIEEGDLAINMYKRAKMYDQMIKLVKEYHGDLIT
DTHLHLAKELESEGQLSTAEHHYLEVGDWKACVNMYRSNELWEDAYRIAK
QSGTPGSGKQVAYLWAKSLGGDSAIKLLQKLGLLEACIDYAIDTTSFDFA
FDLARTLKREKVMEIHLKKAMFLEDEGRFNDAEDEFIKAEKPKEAVLMYI
HQSDWDEARRVAESYDPESLVDVLIGQARLSFEKKDYTEGESFLLRAQRP
ELAIKFYKECQRWPDVLRIAKEYVPHQLAALQDEYDRIATQSGGDKGAEG
IIAQARDWETRAEYNRAIDLYMRITQDMAGNSAVIEEVYTKALELAIKFS
KDRALSVAHEVCKRLLEMQAYETASDLYQAVKLYREAISACVKGDLWTQA
RSIARDYAPKYEEHVEEEYVKYLKKKNKTDELINVDVIAALDMYVEQGLW
DKCIQEAEQQSFEVLSKYVALYAANLIKDGDQVKALRLFVEHGAPANPQN
FNIYKRLVEDLFAKQGLSGENAYKVWADLRTMLYDLCDGFNKKPTNPAVM
DIFNRMLLVAHYYAIRSAITKNSQLEVLHAKISVSLLRYCDLIPCDKAFY
EAGIHCKGVGWENMAFVFLNRYLDLSEGIEDGNLDAIDNTDIMDTDIPLE
VPLPETQYLNEEQREEVKEWVLAVSMDQRVEQTLSFDERNVYEASLTSPE
SDVVCLPCVVTGYPVLRNKMEFNKTGKAANKEDWNKFAMATKVSHSADCQ
DVLRFLSLWCGTSGNQAFSFG
Run BLAST on NCBI

transcript from alignment at sc0000007:1119867..1136644-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001218 ID=TCONS_00001218|Name=TCONS_00001218|organism=Clytia hemisphaerica|type=transcript|length=16778bp|location=Sequence derived from alignment at sc0000007:1119867..1136644- (Clytia hemisphaerica)
AATATTCAATGGAAGAAAGTGGAAGTGCTAAAATAGCAATTCTCGCCCGA ACTTTAAATTCTGAAAAACGTTAAAATACACTAAAATCTCAATATATTTC GAAGGTGATTGTAGGTTTAAAATTATTAACTTCTTACCTTTGATTGTAGA GTCTTGCCAATGACCAAGGTCTTCTGGAACGAATAGCTGCTGCTCTACTG AAAGGATCCTTTTATGAAAAGGTAAAATATAAAGTATTATTATTTTCTTG ATGATCATGTGTTTTCGCATGATTTTCTTAGAAATTGCTTGCTGTGTGCT GTGTGTCATGAAGGAATTCATTTTTAATGGTTTAATGTTATTAATTGACA TGAAATGATTTTGGTTATGTTCTATTAAAAAGCTGCTTTAATTTTATTCT TTGAAGTCAAAATAAAATGCTAAATCATCAAAACCATAGATCTCAAGAAA AGGAACCCTCTTATTTCTACAAATAATTGAATGTCTTTTTCTCCGGAAGG ATTTCCCCTTTGAGAAGTCTCAATCATAAGACTCCTTTGTTCACGCCTTC GTAACCCATAAACAAGTTACGTTCAGTTCTATAATATTCAAGTATGTTTT TTACAGGCTGGCGAACTGTTCCAAAGAGTCGGTTCCGACCAGCGTGCACT AGATGCGTATCGTAAAGGGAAAGCATATCGACGAGCGGTGGAGTTAGCAC GCTCCTCCTTCCCACGAGAAGTTGTCAAACTTGAAGAAGAATGGGGAAAC CATTTAGTGCTCCATAAACAATTGGACGCTGCTATCAACCATTTCATTGA AGCTGGGTGAGAGAACCTCTTTACATGTCTCATGCAGGTAGCATCGAACG GCTCTATTTGCATAAATAACGAAATATTTTTTCACGTGCGTAGGTGAGAC CCTCACCAAGGTTTAAACCCGAACATGCAATACGCTAATACGCAATATTC CATCTTCTCTCTTTTCAGTTCTTCACAAAAAGCCATCGACGCTGCCATCC AAGCACGACAATGGAACAAAGCTGTTCAAATCGTCGAGTTGCAAGATGAA GATGTTGTTGAAAAGTAAGACATCTTATCTGCCACCCATTTTTTGTGTTA GAATGCCTTCGGACAATGTGTATCTTTAGTTCCGTAGGAGGATCGGTAGC TTTATTCAAGCCACGCAAAAAGGTCTTTTCTAAAAGGTAGCCTACGAATA AGAACCGATAAAATTTTTACATAACCGAAATCTCATTTGCTTCTATTTTT TGCAGATATTACAAAATCTTGGCAGAACATTATGCTCAAGTTGGTGAATA CCAGGTAAATGGTCAGGCTCTTTCCTGGAAAGTTTTCTGCCTTACTAACT TTTCTTTCTTACTAACTTTTCTTTTTTACTCACTTGTGCTGTATGAGAAA TCATTTTCTACGAGTTTATGTAAGATTTTCCACGAAAAGTGATAGGCGGC CATTTCAAAGTAAGGGATAGTTAAGTCACGATAATTTTTGAATGGATACC GCCATTACGACTCATGCAACATTTGATAACACCCATTGAGGGCGGTTCCT AATCGGTCTCCAATCATGGTTGACAATTTCTTGAAATGGCCCTATGGTTA TTCATAATTATTCAAAAACCAAAACATTTCCTCTCACAAGGGAGAATTTC CTGCAAAGTCCCATACTAGTTACTTTAAGGGCAGAAAGTTTCGCGGGCAG GAAGTTTCGCGAATTTTGGTTTTAGCCGAAATTTCACAGATATTACTTTC GCGAATCCATATAAAATTTACCTTTTTTGGTAACAAAAACTCATAAAACA CGCAAAAATTTAGCAAACAGTGCAAAACTGAGTAGGAAAGTTTATTTTTC TCGAAAAAAACTTTCGTGTTTTTCAGGTTCAAATTCTTACCTGGCAGAAA CTTCCGCGAAAAATGATCAAAATCGCAAAAAACGCGAAAGTTTCTGCCCG CGAAAGTTTTTGCCCGCGAAAGTATAATATTTTTCCCTGTGAATATTTTT AGATGGCCGAACGATTTTATGTTCGAGGTAACATGCCACGTACAGCTGTG GAAATGTACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGTATAATG TTGCCATCATTTTAATGTTAACAGTGTAAGCTCCAATTGGAGACCACTGT GTAGAGACTATTAAAAACGAGAAAGAACGACAAATAACGATAACAAACAC GACAAACGACAATAAACGACGACAAATTTATTCAAAGAGACTTGGTAAGG TAAAAAAATTGTCACCTACTTTTGCCAGAGTACACCCCAGTACAATACTC ATCAAGCCACGCCTAACCTTCTTGTAAATCTCTTTTACTTTCACAGCTCG CAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTATACATTGCACAG GCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAGTAAGT CAACTGTTTCCACATACTTTTGGTTGTATTAAAGACTTGATTGACAAAGA TACAAGAATAACGATCTTGTTAATTTATGAGTTCAAAGTCATGCATTAAA ACAGAAGATTTTAGGGCTATACAACAACGCAATTCTAAACGAAATCAATC TATTCGAATCTTCGAATCTACAGTTGAGTCTCCATAACTCTAACCTCTAT AACTCGAAGTATTCATAACTCCAAGTAATTTGTGCTTCCTTTACACTGAT AAAATATACAAGGAATCTATAATCTGATTGGCTTGAGGCTTCTTTTGTAT TCTTCTAACTGATTCGAAATATTCAAAAGAAAGTATCATTATTTTTTACA CAGGTTATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTATA AACGAGCAAAGATGGTAAGAGCAGACATTTTAAAGACTTTTTTGGATGAT ATAGGCATTGACTTAAACGTTGCTTATATATCGGACCGAAAATGTAGAAA AATGGCAAAGTTTAATCTTATTAATTATCTTAAAAGCCTCATTTGTGACT CCGTAATAGTTGTCTGGCTGGTTATTGATTGAAGTATTTGTGCTTCCCAA TAGAAACTAATATAATTCGCTTTTTATTTTCAGTACGACCAAATGATTAA ACTGGTGAAAGAATACCACGGAGACTTGATCACAGATACTCATCTACACC TTGCTAAGGTAAAATAAACACACTCAGATTCGTAGTAGAAACCGTACTAG AGTGGATTCTTTAACTTAAACCTCTATAGCTCAAAATTTTCTTAACTCGA ACAAATTTGTGTTCTTCGCGCGTATTCAGTGGAATCTCAATAAACTCCAC CGTAATTGTCTTCATTATCCCTTCTATGTCACAAAAGTTCTTAAGTCAAA TGGATTGAATCTGTAATTGGAATTTCCGTAACATCTGCTTTTAAATGAAG ATCATAATCAGTCATAATCAAACAATTTTGCATTTCATACATCTCACGAT TCCCTTGAAGTATTTAAAATAAGATCGTGAAAGGATAAAACTCGACTGGA GATTTCATTGCGTATATTTCATTATATCATCAATTTCGCGTTCCAGGAAT TGGAATCAGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTG GGCGATTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGA AGATGCGTACAGGGTAATATTTCATCTTTATTAGTATCAAGTTTGATTGC CCGCTATCGTCATCCATTAGTCAAGATTGAAGGGTTATTTGGTTAACAAA TGCCAACAACAATAAGTCGTCCGTTTCGGTTGACTAACATTTCCAAAGTG CTAATCAATCTTACTAGTTCATCTTTATCTTACTATCTCGTGGCGTCCTG GCCCCCAAAACAGAAGTCAATGGCATTTGAATTGCTCTTCTAGAAATTAT TTGGACTTGAATACTTCGCATATTTTCAGATCGCCAAACAAAGTGGTACA CCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGG CGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTA TTGATTATGCTATTGACACAACGTGAGTATATGTTCCATAAGATCAATGC TCCTATAAAACCCAGCTCCACAGAAACACAGTTTAGTTGAATAGAATGAC GTCAAATTCCTANGTCCTATAAAACCCAGCTCCAGAGAAACACAGTTTAG TTGAATAGAATGACGTCAAATTCCTAATTATGGACCGATGCGACGACATT TTTTTGACGTCGTGCCACCTGGTAAAACTTGTACTAAATCAACTTCTTTA GAGCCTTTTAATTAAGGATAGTTGTGTCATTAGTGTAAGTTATTTATCTC GATAGCTGCTAAGAGGATCATTTGAACTAATTTTCAAATCTCTTCCACCT TAGATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGA AGGTGATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGT CGCTTCAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGA AGCTGTTCTTATGTAGGTCTTGTATCTTTGAAGGGAACAAAATATATAGA TTGGAATCGACATGGACATTAAACCTCTAAACAGTCTAAAGCAAAACGCG AGCGAAAACCGGGATGAATTTGTAAAAAGCTCGTGTTTTTTTAATCGGGA AGTCATTGCATTGAGTGAGTTTTCTAATTTTATGATTGCAAATCATTATC TTAGTAGAAAATAAACGATGATTTGAAATCTTTGTTGATTAGGTATATCC ACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCA GAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAA GAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAG AATTAGCCATCAAATTTTACAAGGTAAGCAATGAACTGATGATGTTTAAA CTTAATCATTTTAAGCCATCTGTTAAGCATTTCTTTCATTCGGCAAACGC ATCTCATAAATTTGACTATTTTATTTTCAGGAGTGTCAACGCTGGCCTGA TGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGGTATACTCAAATG CATTCAAAGATTACAGTAACAGATTTCTTTGTAAAATACGTAGTCTATGC CTGTTGTATCAATCAATAATAAACGATCCTTTACTTTTCGTAGTTGGCAG CCTTACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAG TAAGTACACGTTAATTCATTTCCGAGCGATGGTTGTTGGAAAGAGAGTCA ATAGAGTTAAAGAGATTCAAATGATTGAGAGCTCCACCGTGGTACAGATA GAAACACTTTGTATGAAATGGTCAAATAAAGAATTATTTATTACGCAACC TGCTCTGCTCGATTTTCAAACCTTTAAAATAAAATGATTCCCTTTCTCAT TTCAGAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAG GGCCGAGTATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACA TGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAA CTGGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGT CTGTAAACGCTTATTGGAAATGCAAGCTTACGAAACTGTGAGTTTTGCGA TGTTTTTTTTCATTTTCTCTTCTCGAATGGAAAAAAAAAAACATTCGTAA TTCTTTCTTGAGAAATAGCTATCTTCTATAGCTTAGATAGGGTTATGAAA ATTATTCTCGATGAGTATATCGATGATAGGATTGAAATAACGTCTTTTCC ACCTCTACAATTATGAATTTTTTTTCCAATTTTTTTCACCCAGGCATCAG ATTTGTATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTT AAAGGAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCC AAAGTAAAAACTATTTTGTTCGTACAGGCGAAATCGCTCAAAATAGAACT TTTAAAACTGAAGAAATTCTTTTCCAAATCTGCCAACGTCCCCTTCGCTT AATCACTGGTAAAATGTTCTCGATTTATCACTTTTGAGATATTTGAATGA CACACCTTGCTTTGAGATGAATATTTCGTAAAATGGGTAACATATCGAGA ATAAATTGTAGATTTTTTTAATCGTTTTGTCTNTTCGTAAAATGGGTAAC ATATCATGAATAAATTGTAAATTTTTTTATTCGTTTTGTCTTTCATAAGA TTTTCATTTGAACAATTTCCTCTTCTTTTCAAAAGGTACGAAGAACACGT AGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGG TCTCTTCACTTCATATCTTTTAACATGTTATGCAATTGTCACCATCTGTT ACATCATAATATTCAATATCATGGTTGCCAGAAAAACGATTTCATCAAAG ACCAAATATAATTTGATATCGTGAAAAAAAAATTCCAAAAGATAGCACAT TATTGATATGTTTTGCGTATGACTTCTCTTGCCTCCCTTTTTTAAAATTT CTTTTCCCCTCTTTTTTTCTGTAGCTGATCAACGTGGATGTGATCGCAGC ACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAG CTGAGCAACAGGTATTACCCCTACTCATCTTACCATTACAATGATGTTCG ATTTTCCAAGTAGGGTAGATCGTCAAATGGCAAAGTCAAAAAATTCAAAG TGTAATATTTTTTTGTGAAAATTTAATCTATTGTAAGACATTTTGCGCAA TTTTTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNATGGTTTCAAATGGTGTCCTGAAATTTTTTGGTGTTGAAAGTAT TCTGAAAATACTCTGGGAGAATCTAAATGGTTTGGGTCAGAAATTTGCCC TAGTCTGCCACTATGGCATTGCATTTCCAACTAAAACGGGATATTTAGAG TTAGTCTAATTTTCTCAGGCTAAAATCTCAAAAATGGTTTCCAATGGTGT CCTGAAATCTTTTGGTGTTGAAAGTATTCTGGAAATACTCTGGGAAAACC AAAATGGTTTGGGTCAGAAATTTGCCAAAGTCTGCTATTATGGAATTGTA TTTCATTCTAAAACACAATGTTTTGAGTAAGCTTGAGTGTTCTTCCTAAA GAAATAAAATTCATAATGGCAGACTGGCATATATATGTCCATTGTAAACC ACTGTGATTTTCCTTGATTGTTCCAAGAATACTTTCGACACCTAAAGATT TCAGGACCCTATTTGAAACCATTTTTTAGATTTAAGCCTGAGAAAATTAG ACTTTAACAATAAATATCACGTTTTAGTAGGAAAAGCAATACCATATTGG CAGACTTTGGCAAATTTCTGACCCAAACCATTTTGGTTTTCCCAGAGTAT ATCCAGAATACTTTCAACACCAAAAAATTTCAGGACCCTATTTGAAACCA TTTTTGAGATTTTAGCCTGAGAAAATCAGACTTTAACTCTAAATATCGCG TTTTAGTGGGAAATGCAATACCATAATGGCAGACTTGGGCAAATTTCTGA CCCAAAACATTTTGTTTCTCCCAGAGTATTTTCAGAATACTTTCAACACC AAAAAATTTCAGGACACCATTTGAAACCATTTTTGAGATTTTAGCCTGAG AAAATTAGACTTTCAACTCTAAATATCGCGTTTTAAGTGGAAAAGCAATT CCATAATGGCGGACTTTGGTAGATTTCTAACCTAAACCATTTTGATTCTC CCAGAGTTTTTCCAGAATACTTTCAACACCCAAAGATTTCAGGACACCAT TTGAAACCATTTTTGAGATTTTAACCCAAGAAAACCAAGTTTTAGCTTGA AATATTGGCATTTAGCATGAAAACTCAATTTCTAGGGCGCCATTATGGAT TTATAGGAAGTTTTTGAAAACTTAAGTTTGATTTTTCCTGGAGCTTTCTC TGAAGTGTTTAATTACTGAAAATTTCAAGTGTGTACCTTAAAAAGTTTAA AAGTTGTGGGTCCTCAAAAATGCTGCTTTCATGTATTTTGCTACCCAGAA TTGGAGAAAATCAGCCTTTTCAGCTTGAAATTGAAACATTGAGCAATCTC GCTGGGGTTTTTTTGTCTTTTTATGTTGAATATTAGTACAAGACACCATT TAGAAACCATTTTGACCCTTTACTGGGCTTTCATAGTCTTATAAATGGGC AAAAAGTGCCATTTTACTCCTTTTTCGCTTTAGTGCGAATCAAAGACCCC CCTGGGGAATGCTGGATTTTTGACCTAGGAGGTTAAAAATTGCGCAAAAT GTCTTACAATAGATTAAATTTTCACAAAAAATATTACACTTTGAATTTTT TGACATCATGCTAAAAATGGTAGTTGACGATCTACCCTATTCCAAGTATT ATTGTTTCTTCTTCATCTGGCTAGCTGTAAAGTGTGGCGAGTTTTACCCT AGTAGAACCAGGAGCTTTTGTTTTGCTTCCTAACCCTGTCCGACCTTTAA ACATAATACTGTGATTTGATTATTTGGTTAAAAACGCAAGGAATAGGAAT ATCATATCAATGATGTTTTTTACTCAACTTTTCCCAATGTTTATTTTTCT TCAGAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATT TGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACAT GGCGCACCTGCCAATCCACAGGTTTGTCTACGTCAAGAAAGTAATGAAAA TATGATGTATAGTAGGGGGCCATTCTTTAGGGCCCGTGACAACAATTTGA GGAATGGAATTTTTTTTGAAATTTTTTGAACGAAGTTTCAAAGTCGCTAA AACACAAAATTGACCATGTCCTCTATGTCGTTTTTCGAGAGCTTTCCAAT GGTATAATTGGTTTCGTCAAATTTCGGGTCCCAAGGGTTTTTGCTTGTGA CGTCAGTCTTTTCCCCATAAAAAAATGCTGGACCTAATTAATTTACTCCC TCTCAAAAAAGTTTTATAAATACATTCTTCTTTCGAATGATCAAAAAAAA TTACACTCCGGAAATTGTTGTCACGGGCCCTAAAGAATGGCCCCCTACTG CTATTCTCCATTGGAGATTCATAAAGCTTTAATTGAAAACGATGAATTTT TTCTCACGTCAATAATCATTGTTTCTCTTTTAGAATTTCAACATCTACAA ACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATG CATATAAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGGTAAGT GCTTCGTTACCAAAGATATGCCCCTATAAGGAGTTCTACAAGTTCATTCA TGCAGCGCGATAGCCTTTGGTTCCTGTGAAACCTCTTAAAGCATTTTACG TAGAAAGTATTTTAGAAGCGAGAAGAGTTTTTTACCCTTAAACAGCAAAA AAATTACTTTTCAACGCTATAGCTATGATGAAAAATTTTCCCTTCACGGG ATGGAGTTTTCGCCTTAATCCAAAAGTAGCATCTTTGGTGACAAAAGGAT TTACTTGTGGGACTTGCGACAAAGGAACGTTTTCACTTTCTTGGGAATAT TTGCAAATGTTTCCTTTCTTGTTATCACTTCTTATGAATACATTTTCATT ATCGTCCTGTTTACTTTCCTTCCCTTTTCTTGTAATATCCGGACGTTTCA ACAAGAGAGTGGGTTGTTCTCTCAAATAGATCAATCGTAAAAATAGGTAC TATTTACATATCACCACGTATTTTCCTTTTTTCATTCAATAACAGTGTGA TGGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACA GGATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAA AACAGCCAATTGGTTTGTAATCCATCCTGCACGAATTTAGGCTTAAATCT TAAGGAGAATTCTTTTATTTGAATTAGCATTCCTATTAGAATCGTATGTT TTGAATCAAATACATCAAACTACAGTCACGTAAATCAAATTTGATCGTAA ATAGAAAAGAAATTGGAATTATCCTCCGTAATTGAAACTTTTTATCGTGA TATTTTCTACTTATAGTAGAATGAGCTTAAAAAGGCCTAGACGATGCTAT CGTCCGTACAATATAATATTATGATATAACATAGTTTGTATACTATAAAA CGTAATATGTTTCGCGGCGGATAGAGTCTGTGTTTAAGACAACAGCTACT CCCGTAAAAAATTCCCGTCTTCACGTTTGTTCCCCTTATAGATGATACTA TAGCATAGTCTACCTCCGATGCTAATGCTAATTCTTTAGACAGAAAAAAA AAAAAAAAAAAAAAAAAAANAATTCCCGTCTTCACGTTTGTTCCTCTTAG ATGAAACTCGTCTTAGACTATAGCATAGTCTAAAAAGGCCCTAACTTTGA AAAAAAATATATATATTGCTGAGATTCTGAAGAAATGTTCCTTATGGGTC TCAAAACCAAAATTTAACCTGCAATCAATTCGAAAAATTTCGGACCCTTT TTGGGGCATTTTATGATGACGTCATTTTCAGTTCAAAACTCAAGTTTTAA AATTTTGCTGACTCAGAAAGAATGAAGTAAAATGTGGCGACTCATTGTGC ATCATTGATTATAAAACCTGAATATCTCATGATCTAGCCATCGAAAATCG GCAAAATCTTACAAGGTAGCAGATGACGTCTTGATTTGACTGAATTTCAA AAACGACTCCATTTCCATAAATTTTTAGATGAAAGGGACGACTTTTTTTC AAAAACATTTTAAAGTTATGTTTGAAGGATTTTGTACCGAAAATTAACAT CATCATAAAACCTGATTCTACCGAAATTAAAATCATCATTCTAAGGATAC TAGCATTCCTATACTATTTCAATCAGTTATACTTGGTTAAATCTTCAGAA ATAATTTTTCCACTTTTTTTTCATTTTCAGGAGGTTCTACATGCCAAGAT TTCAGTTTCCTTATTGAGATATTGTGATCTTATACCGTGCGATAAAGCTT TTTATGAAGCTGGCATTCACTGCAAGGTATGTCAAATGCGATTTCTCATT TTAAGTTTTTTTCTGGATTTTAATGGGTGAGATTGGCCTTGGGGGGGGGG GGGGGGGGGAGGACGAACAAACACTTGGGGGGGGGGGGGGGGGGGAGGAC GAACAAACACTTGGGGGGGGGGGGGGGGGGGCTCTTCAATAAATCAGAAA TTGTATTAGTTTACAATGTATGTAACAAACTATTGACCAACATAAATAAG ATATTTACAATGAAAAGAAATTGAATCTAAAACGATGTTGAAAGGAATTG TTCGTTCATTGTGAAGTGTTTGTTCGTCTTCGTTTGAAGATGAATTTTCT GATCTTGTTGAAGCTGAAAATGTATATAATGGGATTCGATACAGATAACG CTGTGAAAGCAAAAATGGAGAAAATCCATAATTCTTTATGTTCTCCGATG TCCATCAACATCAATATGGAGCTGATGGAAGAAGGTATGATGAACATGCA TGTCCAAAAGTTCAAATGGATGATATCCTTGATGCTACGTCTCAACTTTT TTGATTTCTGCAACTCCTCTCTCTTCATTACTGAGCTATATCTTGCTGCT AGTCTAGCTTCATTTCTATTACGCACGTCTCGTGTGATCTTACCGAAAAC GATGATACAAACACCGGTCAAGAGACGAATACACGTGGTACAGATAACAA CATTATATTTGGAATGCCACACAGTGTTTATTTCTCGTTTCGAATCATCA AAAATATAAATGCTTGACACTGTAGCTGCTAAGAGAAAGGCGGAAAGCAG TAGCAATTTGTTGATCCTTCTTTTAGTAACATAGGTTTGGTAATAGATAG CGTGTTTGACGGCTATCAGGCGATCAAGTGTGAGGAAGATAGTGATAGTT AGGGAGAACCAATGGACCCAGTAGCCTGTACCTCCCAACAATTTGGTGAG AATTTCGACCTCTATCTTCATTACGAAGACCAGTATCACAAATAAGATAA CATTCAACGAGAACAATGTATCAGCGATGGTGAGGAAGCGGATCAAGTAG TACTGGTTGTCACGGAGACCGGCTTTGTGTATGATGACGCAAATGAGGAT GAGCAAAATGAAGGCCATGATGTTGAGTAAGAAACACGTGCCTTGGATGA CCAATGACATCTCTCCTGCTATCCACTCGTTGTTCACTGTTGCTTTGAAG AATCTAAAATTTCAACGATCATTTTACAATAATGTTGCCATAAAATATGA AAGAAAAAGAAACACTTAATTTACTAAATTTAGAAATAATGTGAAAAAGT GGTGAAAGATGAAAAAAGCAGCCAGTTCATACCGACTGTACCAAATAATC ATGCGTGTAGGCTACGATGAGTCAGTTATTAAATAATTAGTGAAAGTTCC CTTGGAATTACCTTTGGATAGAATGTTGAGCTATTTTTGGAAAACTTAAC ACCTTAATTACTTCTTATGGAATCATCAAAGCTTTCGAAGCCACTCAACG AATAATGAATGACTTACATGATTATGAATGAAGAGGAGATACTTGATGAC CTTATGCTGAACTTAATTTCCAAATCCTCAACGTTGTGATTGGATAACAA CGACTTCTGTTCTCACCCTGCTTCGTATACCTTATGGTGTCTTCAACCTT CTGTGCTTTTTTTACCAAAACTTGCAATTGCCCTCTTCTTTATACTACCC TACCTGTGGATATGAATAATTAATAACATTGGATTTGTTTCACTTTTGTT TCCATGTGACTTGTACACACAGCAAGACAGTTTTTCTTGTTTTCGATTTT TGGGATTTGCTTTCCTCTGAAAAGACAGTCTACCCACTTACCTTTTGTGT TTTGGGGATCTATAATCAAATTAGTATACCCAGTCGTCCTTCTGTTTGTT ATCTTTAGGTGCAAGAACAATTTTATTTGTTGTTTTTTGGCCCTAAAATA CCAAAAGGTGAAAAAAATTGACTTTGATGGTTTATATGGAAGCTTTAACA ACAAATTTACTTATGTCCACCCCATAGCATTTTTTTCTTTTAACATATTT TAGGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGATATCT GGACTTGAGTGAGGTACTTCAAATGTTATTTACCAAGAAACTTCAGTGAA ATATCTTTAAATGTTTATAAACTTGCGGTATTTTTAAACAAAAACAGTCT CTAAACATAGCATGCTAGACTGTGATAATAGGAGAAAATGAAAGAAGAAA GATTAGTTTGGCCTAGCCCTCCAAATTCCACTGGCGCCGTATTTGATCAC TTGATTTGTTATAGGTCATATACATAGGACAAAGCAGCGCTGCGAAAAAA GGTTTTGGTTTTTCATGAGTGTTCCCGTTTCATATCAGACACATGTTTCA TATCAGGCCGGTGTCTGCTATTGTTATTTTGTGCTCGATTTCGTGCTGAA TAAACAAAAAAAATTCTTTCCTTCTGTCTAACCAATATTGACAAACTCTC CTTTCCGCGCTGAGTGAGCACAAATCTTTATAAATTCTTTTGATGCTGCT TTGGTAGCATAAGAGACTCCTTTCTACCAAATTATCTTCAAGAGTGAAGT AAAAACCGAAGCAAAACTTAGGTCTAACAAATAAGCATGAACTTTTTTAC TTAATGTCTAACGTTATTTTCTCCACAGGGCATCGAAGATGGTAACCTTG ATGCGATTGACAACACAGATATCATGGACACAGATATTCCGTTAGAGGTT CCTCTCCCTGAAACACAATATCTCAATGTACGTTCTTTATTTTTGCAATA TTTTCATTTTACAAGCGACATAAACGTGAACCCTTTCCAATTAACGCTTC CAAAAATCTAGATAGTAAAGCCCCTTTAAGATATCTCACTCTGACATTTT TAGCCTGTGCCAAACGGGGTATTTTTCAGCACCGTTTCGTCTGTAACCTT TTACCCACTCAGAAATGAGGGAGATTATTGTCACTTTTGATTTCAAGACT TTTCACAGAAATATTTTCAGGAACTGTATTTCAATGTAAAATAAAGCCTG TAAATCAATGTTACAGACCAATAAAGTGATAAAAAATGCTTAATGAGCTT GTGCGCCGAAAGAAGACTAATCTTCGAATTTGTTAAAGGATGACGGGTGA AAAGATTGAAATTATTCATACAGAAAATTCTGATCTATAATATAACAGGA GGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATC AACGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCT TCTTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCAC AGGTAAGGTTTCTCTTTCATTCAGTTTGTGTCAGTGTTAACGTTTCTCCG AACATCTTAAAATGATGTAACTTAATCTCCGAGCAAATTATGATACTCCG TGAATAGCACGTATTCACACTAAAGGCCAAGGTTCCGTAAAATAATCTGC CGAGATTGGCGCACCGCTTTGATCTTTTTCATCCAGATTTCGGATGAATA TTAAATGAAACAATGGCACCAAAATCAAGCGCAAATTAAAAACATTAACA CTAGAACCCAGTCGTTTTCGGTTACGCGGTTTTTTTTTGGCTAAACAACC AGATCAGATCGTCACATTCGCCAAGGGTTTAGAGCAGAGCGTGGTATTTG CAGAGTGGGCGATCTGTTATCAGACTAGATGCAACTTTGATCGATGAGAA TTTTATTGTCACACATCGTTTTCAATCGTATTTTATAATGGGTTTTAGAT GGATTTTTTTTGTACGTCTAAACTTGGAAAATAACAACCAAGATACTTTA CAGCCCGAAAGAGAAGAAATCTTGGTTTATGTAATTCAGTAGGGAGTTTG AAAAGTCATATAACGCCTTAAACATTTCCATTTTCTAATCTGACTATTCA GGTTATCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGC TGCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGTAAATA TAGTTTATTAATAAATAATATTATAGAGGGAATTGTATGGAAGATTCTCC TTCATCTATCATTTTTTCTGGAAAAACCATTGAGAAGGTTGATCTTAGCG AGAGGAGTGGGTGAAAGGGGTCTTCATTCCCAACTTTTACGAAACTTAGA CTTGAGGAATATTTTTGATTCGATGAAAGTATGTCTATCATCATTCATGA CTTCCTCCTAATGTTCATTCGCTTTTACTCTTTCTGGAAACCACTCTGTA GGAGATTTGTCTATCACGCAAACAAACATGGTTTTCCTACATTTCCTCAT GGCAGCCAAAAAAGCACACTCAAAGCCATAGACTCTAAGAACTTCTCAAA AAGTATGATCTCTAAGAACTTCTCAATTTGATCAATTTCACATTCCAGGT GTCACACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGT GTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAACGTCTAAATAAC AACAACATGAGCTGGGCTCAATTCTCAAAACAATATGTTCACAACATGTA GATCAATCAACATGTAGATCAGATTCTAGTGACTTGTAGAAAATTGTAGA GATTCTTTTCACGGTGCAAATATGATATTAATTTATTGGGTACATTTATA AATATTGTTTACTGTAATATAATTCTATGTTTGTCGTCAAATTTTTAACT TTTTCCCTTCAGTTCATTTTGTATATACTTGAATAATGATAAAACTGGAA AATAAATGTCGTTAGTGGTAATACAGTATTCGAAATTATCTTGTTGCTTC TTTTTATTCTTATAAATTTGATTTTTTTAATTTTTGGACCTACCACAGTG GGGTAGAGGTCCTATAAATTAACCTTTG

Coding sequence (CDS) from alignment at sc0000007:1119867..1136644-

>TCONS_00001218 ID=TCONS_00001218|Name=TCONS_00001218|organism=Clytia hemisphaerica|type=CDS|length=56718bp|location=Sequence derived from alignment at sc0000007:1119867..1136644- (Clytia hemisphaerica)
GTGTCACACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATG
GTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCCGT
TCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCAACAAAG
AGGACTGGAACAAGTTTGCCATGGCAACCAAGGAGGAGCAACGAGAAGAG
GTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACGTGTAGAGCAAAC
TTTAAGTTTTGACGAACGAAATGTATACGAAGCTTCTTTAACTTCACCGG
AGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCATCGAAGATGG
TAACCTTGATGCGATTGACAACACAGATATCATGGACACAGATATTCCGT
TAGAGGTTCCTCTCCCTGAAACACAATATCTCAATGGTGTTGGATGGGAA
AACATGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGGAGGT
TCTACATGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGATCTTATAC
CGTGCGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGTGTGATGGG
TTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACAGGAT
GCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAAAACA
GCCAATTGAATTTCAACATCTACAAACGTTTAGTTGAAGATTTATTCGCC
AAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGATCTCAG
AACAATGCTTTATGATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGCTT
TGTATGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGT
TTGTTCGTCGAACATGGCGCACCTGCCAATCCACAGCTGATCAACGTGGA
TGTGATCGCAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAAT
GTATCCAAGAAGCTGAGCAACAGGTACGAAGAACACGTAGAAGAAGAATA
TGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGGCATCAGATTTGT
ATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGA
GATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAAGG
TGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAGT
ATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACATGGCAGGG
AATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCAT
CAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAAC
GCTTATTGGAAATGCAAGCTTACGAAACTTTGGCAGCCTTACAAGACGAA
TACGATCGCATTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAACGCTGG
CCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGGTATATCC
ACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCA
GAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAA
GAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAG
AATTAGCCATCAAATTTTACAAGATCGTTCGACTTTGCTTTTGATCTCGC
GCGAACGCTTAAGCGGGAGAAGGTGATGGAAATCCACTTAAAGAAAGCCA
TGTTTTTGGAAGATGAAGGTCGCTTCAATGATGCCGAAGACGAATTCATC
AAAGCTGAAAAACCAAAAGAAGCTGTTCTTATATCGCCAAACAAAGTGGT
ACACCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGG
TGGCGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCAT
GTATTGATTATGCTATTGACACAACGAATTGGAATCAGAAGGGCAATTGA
GTACAGCCGAACATCACTATTTGGAAGTGGGCGATTGGAAAGCCTGTGTC
AACATGTATCGAAGCAATGAATTATGGGAAGATGCGTACAGGTACGACCA
AATGATTAAACTGGTGAAAGAATACCACGGAGACTTGATCACAGATACTC
ATCTACACCTTGCTAAGGTTATATATCATGATCGAAGAAGGTGACCTTGC
TATCAATATGTATAAACGAGCAAAGATGCTCGCAGTACGTTGCATGGATT
CCGATGACGTCTCCAAACTATACATTGCACAGGCTGAACAGTTAGAAGCA
CAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGAACGATTTTATGTTCGA
GGTAACATGCCACGTACAGCTGTGGAAATGTACACCAAAGTCAATAAATA
CGAAGCCGCTTACAAGGTGTCACACAGTGCAGATTGTCAAGACGTCTTAC
GCTTTCTTTCCTTATGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTT
GGGTAAGTTATCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGC
AAAGCTGCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGA
GGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATC
AACGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCT
TCTTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCAC
AGGGCATCGAAGATGGTAACCTTGATGCGATTGACAACACAGATATCATG
GACACAGATATTCCGTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAA
TGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGATATCTGG
ACTTGAGTGAGGAGGTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGA
TATTGTGATCTTATACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCA
CTGCAAGTGTGATGGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGG
ATATCTTCAACAGGATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCT
GCTATCACCAAAAACAGCCAATTGAATTTCAACATCTACAAACGTTTAGT
TGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAG
TATGGGCAGATCTCAGAACAATGCTTTATGATCTGAGTTTCGAAGTTTTA
TCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATCAAAGATGGTGATCA
AGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGCACCTGCCAATCCAC
AGCTGATCAACGTGGATGTGATCGCAGCACTTGACATGTATGTGGAGCAA
GGCTTGTGGGATAAATGTATCCAAGAAGCTGAGCAACAGGTACGAAGAAC
ACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGAC
GAGGCATCAGATTTGTATCAAGCAGTCAAATTATACCGTGAAGCAATAAG
TGCATGTGTTAAAGGAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGG
ATTACGCTCCAAAAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGG
GAGACTAGGGCCGAGTATAACCGTGCAATCGATCTGTACATGCGCATTAC
ACAAGACATGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAG
CTCTTGAACTGGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCC
CACGAAGTCTGTAAACGCTTATTGGAAATGCAAGCTTACGAAACTTTGGC
AGCCTTACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATA
AGAGTGTCAACGCTGGCCTGATGTACTTCGTATAGCAAAAGAATATGTTC
CACACCAGGTATATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGC
AGAGAGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCC
GTTTGTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTG
AGAGCACAACGTCCAGAATTAGCCATCAAATTTTACAAGATCGTTCGACT
TTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATGGAAATC
CACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAATGATGC
CGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTCTTATAT
CGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGGCTTATTTAT
GGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAAACTT
GGTTTGTTGGAAGCATGTATTGATTATGCTATTGACACAACGAATTGGAA
TCAGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGA
TTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATG
CGTACAGGTACGACCAAATGATTAAACTGGTGAAAGAATACCACGGAGAC
TTGATCACAGATACTCATCTACACCTTGCTAAGGTTATATATCATGATCG
AAGAAGGTGACCTTGCTATCAATATGTATAAACGAGCAAAGATGCTCGCA
GTACGTTGCATGGATTCCGATGACGTCTCCAAACTATACATTGCACAGGC
TGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGA
ACGATTTTATGTTCGAGGTAACATGCCACGTACAGCTGTGGAAATGTACA
CCAAAGTCAATAAATACGAAGCCGCTTACAAGGTGTCACACAGTGCAGAT
TGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGAACGTCTGGAAA
CCAAGCCTTCTCGTTTGGGTAAGTTATCCCGTTCTTCGAAATAAAATGGA
ATTCAACAAAACGGGCAAAGCTGCCAACAAAGAGGACTGGAACAAGTTTG
CCATGGCAACCAAGGAGGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTG
GCTGTTTCCATGGATCAACGTGTAGAGCAAACTTTAAGTTTTGACGAACG
AAATGTATACGAAGCTTCTTTAACTTCACCGGAGAGTGACGTGGTCTGTT
TGCCATGCGTTGTCACAGGGCATCGAAGATGGTAACCTTGATGCGATTGA
CAACACAGATATCATGGACACAGATATTCCGTTAGAGGTTCCTCTCCCTG
AAACACAATATCTCAATGGTGTTGGATGGGAAAACATGGCTTTCGTCTTC
CTCAACAGATATCTGGACTTGAGTGAGGAGGTTCTACATGCCAAGATTTC
AGTTTCCTTATTGAGATATTGTGATCTTATACCGTGCGATAAAGCTTTTT
ATGAAGCTGGCATTCACTGCAAGTGTGATGGGTTCAACAAGAAGCCGACC
AACCCTGCAGTCATGGATATCTTCAACAGGATGCTTCTCGTGGCTCACTA
TTACGCCATCCGGTCTGCTATCACCAAAAACAGCCAATTGAATTTCAACA
TCTACAAACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGT
GAGAATGCATATAAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCT
GAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGA
TCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGC
GCACCTGCCAATCCACAGCTGATCAACGTGGATGTGATCGCAGCACTTGA
CATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAGC
AACAGGTACGAAGAACACGTAGAAGAAGAATATGTGAAATATCTCAAGAA
GAAGAATAAGACTGACGAGGCATCAGATTTGTATCAAGCAGTCAAATTAT
ACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGATTTATGGACGCAAGCA
AGAAGCATCGCAAGGGATTACGCTCCAAAAGGTGCAGAAGGTATCATCGC
ACAAGCTCGTGATTGGGAGACTAGGGCCGAGTATAACCGTGCAATCGATC
TGTACATGCGCATTACACAAGACATGGCAGGGAATAGTGCAGTCATTGAA
GAAGTCTATACCAAAGCTCTTGAACTGGCCATCAAATTCTCAAAAGATCG
CGCGCTCAGTGTTGCCCACGAAGTCTGTAAACGCTTATTGGAAATGCAAG
CTTACGAAACTTTGGCAGCCTTACAAGACGAATACGATCGCATTGCTACT
CAGAGTGGTGGTGATAAGAGTGTCAACGCTGGCCTGATGTACTTCGTATA
GCAAAAGAATATGTTCCACACCAGGTATATCCACCAATCAGATTGGGACG
AAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAAGTCTTGTCGACGTC
CTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGATTATACGGAAGG
TGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAATTAGCCATCAAATTTT
ACAAGATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGA
GAAGGTGATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAG
GTCGCTTCAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAA
GAAGCTGTTCTTATATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAA
CAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAA
GTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTG
ACACAACGAATTGGAATCAGAAGGGCAATTGAGTACAGCCGAACATCACT
ATTTGGAAGTGGGCGATTGGAAAGCCTGTGTCAACATGTATCGAAGCAAT
GAATTATGGGAAGATGCGTACAGGTACGACCAAATGATTAAACTGGTGAA
AGAATACCACGGAGACTTGATCACAGATACTCATCTACACCTTGCTAAGG
TTATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACG
AGCAAAGATGCTCGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAAC
TATACATTGCACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAA
GCTGAAAAATGGCCGAACGATTTTATGTTCGAGGTAACATGCCACGTACA
GCTGTGGAAATGTACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGT
GTCACACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGT
GTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCCGTTC
TTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCAACAAAGAG
GACTGGAACAAGTTTGCCATGGCAACCAAGGAGGAGCAACGAGAAGAGGT
CAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACGTGTAGAGCAAACTT
TAAGTTTTGACGAACGAAATGTATACGAAGCTTCTTTAACTTCACCGGAG
AGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCATCGAAGATGGTA
ACCTTGATGCGATTGACAACACAGATATCATGGACACAGATATTCCGTTA
GAGGTTCCTCTCCCTGAAACACAATATCTCAATGGTGTTGGATGGGAAAA
CATGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGGAGGTTC
TACATGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGATCTTATACCG
TGCGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGTGTGATGGGTT
CAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACAGGATGC
TTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAAAACAGC
CAATTGAATTTCAACATCTACAAACGTTTAGTTGAAGATTTATTCGCCAA
GCAAGGATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGATCTCAGAA
CAATGCTTTATGATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTG
TATGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTT
GTTCGTCGAACATGGCGCACCTGCCAATCCACAGCTGATCAACGTGGATG
TGATCGCAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGT
ATCCAAGAAGCTGAGCAACAGGTACGAAGAACACGTAGAAGAAGAATATG
TGAAATATCTCAAGAAGAAGAATAAGACTGACGAGGCATCAGATTTGTAT
CAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGA
TTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAAGGTG
CAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAGTAT
AACCGTGCAATCGATCTGTACATGCGCATTACACAAGACATGGCAGGGAA
TAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCATCA
AATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAACGC
TTATTGGAAATGCAAGCTTACGAAACTTTGGCAGCCTTACAAGACGAATA
CGATCGCATTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAACGCTGGCC
TGATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGGTATATCCAC
CAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGA
AAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGA
AAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAA
TTAGCCATCAAATTTTACAAGATCGTTCGACTTTGCTTTTGATCTCGCGC
GAACGCTTAAGCGGGAGAAGGTGATGGAAATCCACTTAAAGAAAGCCATG
TTTTTGGAAGATGAAGGTCGCTTCAATGATGCCGAAGACGAATTCATCAA
AGCTGAAAAACCAAAAGAAGCTGTTCTTATATCGCCAAACAAAGTGGTAC
ACCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTG
GCGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGT
ATTGATTATGCTATTGACACAACGAATTGGAATCAGAAGGGCAATTGAGT
ACAGCCGAACATCACTATTTGGAAGTGGGCGATTGGAAAGCCTGTGTCAA
CATGTATCGAAGCAATGAATTATGGGAAGATGCGTACAGGTACGACCAAA
TGATTAAACTGGTGAAAGAATACCACGGAGACTTGATCACAGATACTCAT
CTACACCTTGCTAAGGTTATATATCATGATCGAAGAAGGTGACCTTGCTA
TCAATATGTATAAACGAGCAAAGATGCTCGCAGTACGTTGCATGGATTCC
GATGACGTCTCCAAACTATACATTGCACAGGCTGAACAGTTAGAAGCACA
AGGGAGATTCAAAGAAGCTGAAAAATGGCCGAACGATTTTATGTTCGAGG
TAACATGCCACGTACAGCTGTGGAAATGTACACCAAAGTCAATAAATACG
AAGCCGCTTACAAGGTGTCACACAGTGCAGATTGTCAAGACGTCTTACGC
TTTCTTTCCTTATGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGG
GTAAGTTATCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAA
AGCTGCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGAGG
AGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAA
CGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTC
TTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAG
GGCATCGAAGATGGTAACCTTGATGCGATTGACAACACAGATATCATGGA
CACAGATATTCCGTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAATG
GTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGAC
TTGAGTGAGGAGGTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGATA
TTGTGATCTTATACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCACT
GCAAGTGTGATGGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGAT
ATCTTCAACAGGATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGC
TATCACCAAAAACAGCCAATTGAATTTCAACATCTACAAACGTTTAGTTG
AAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTA
TGGGCAGATCTCAGAACAATGCTTTATGATCTGAGTTTCGAAGTTTTATC
AAAGTATGTGGCTTTGTATGCAGCGAATTTGATCAAAGATGGTGATCAAG
TGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGCACCTGCCAATCCACAG
CTGATCAACGTGGATGTGATCGCAGCACTTGACATGTATGTGGAGCAAGG
CTTGTGGGATAAATGTATCCAAGAAGCTGAGCAACAGGTACGAAGAACAC
GTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGA
GGCATCAGATTTGTATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTG
CATGTGTTAAAGGAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGAT
TACGCTCCAAAAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGA
GACTAGGGCCGAGTATAACCGTGCAATCGATCTGTACATGCGCATTACAC
AAGACATGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCT
CTTGAACTGGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCA
CGAAGTCTGTAAACGCTTATTGGAAATGCAAGCTTACGAAACTTTGGCAG
CCTTACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAG
AGTGTCAACGCTGGCCTGATGTACTTCGTATAGCAAAAGAATATGTTCCA
CACCAGGTATATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAG
AGAGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGT
TTGTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAG
AGCACAACGTCCAGAATTAGCCATCAAATTTTACAAGATCGTTCGACTTT
GCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATGGAAATCCA
CTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAATGATGCCG
AAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTCTTATATCG
CCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGGCTTATTTATGG
GCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAAACTTGG
TTTGTTGGAAGCATGTATTGATTATGCTATTGACACAACGAATTGGAATC
AGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGATT
GGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATGCG
TACAGGTACGACCAAATGATTAAACTGGTGAAAGAATACCACGGAGACTT
GATCACAGATACTCATCTACACCTTGCTAAGGTTATATATCATGATCGAA
GAAGGTGACCTTGCTATCAATATGTATAAACGAGCAAAGATGCTCGCAGT
ACGTTGCATGGATTCCGATGACGTCTCCAAACTATACATTGCACAGGCTG
AACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGAAC
GATTTTATGTTCGAGGTAACATGCCACGTACAGCTGTGGAAATGTACACC
AAAGTCAATAAATACGAAGCCGCTTACAAGGTGTCACACAGTGCAGATTG
TCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGAACGTCTGGAAACC
AAGCCTTCTCGTTTGGGTAAGTTATCCCGTTCTTCGAAATAAAATGGAAT
TCAACAAAACGGGCAAAGCTGCCAACAAAGAGGACTGGAACAAGTTTGCC
ATGGCAACCAAGGAGGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGC
TGTTTCCATGGATCAACGTGTAGAGCAAACTTTAAGTTTTGACGAACGAA
ATGTATACGAAGCTTCTTTAACTTCACCGGAGAGTGACGTGGTCTGTTTG
CCATGCGTTGTCACAGGGCATCGAAGATGGTAACCTTGATGCGATTGACA
ACACAGATATCATGGACACAGATATTCCGTTAGAGGTTCCTCTCCCTGAA
ACACAATATCTCAATGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCT
CAACAGATATCTGGACTTGAGTGAGGAGGTTCTACATGCCAAGATTTCAG
TTTCCTTATTGAGATATTGTGATCTTATACCGTGCGATAAAGCTTTTTAT
GAAGCTGGCATTCACTGCAAGTGTGATGGGTTCAACAAGAAGCCGACCAA
CCCTGCAGTCATGGATATCTTCAACAGGATGCTTCTCGTGGCTCACTATT
ACGCCATCCGGTCTGCTATCACCAAAAACAGCCAATTGAATTTCAACATC
TACAAACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGA
GAATGCATATAAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGA
GTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATC
AAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGC
ACCTGCCAATCCACAGCTGATCAACGTGGATGTGATCGCAGCACTTGACA
TGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAGCAA
CAGGTACGAAGAACACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGA
AGAATAAGACTGACGAGGCATCAGATTTGTATCAAGCAGTCAAATTATAC
CGTGAAGCAATAAGTGCATGTGTTAAAGGAGATTTATGGACGCAAGCAAG
AAGCATCGCAAGGGATTACGCTCCAAAAGGTGCAGAAGGTATCATCGCAC
AAGCTCGTGATTGGGAGACTAGGGCCGAGTATAACCGTGCAATCGATCTG
TACATGCGCATTACACAAGACATGGCAGGGAATAGTGCAGTCATTGAAGA
AGTCTATACCAAAGCTCTTGAACTGGCCATCAAATTCTCAAAAGATCGCG
CGCTCAGTGTTGCCCACGAAGTCTGTAAACGCTTATTGGAAATGCAAGCT
TACGAAACTTTGGCAGCCTTACAAGACGAATACGATCGCATTGCTACTCA
GAGTGGTGGTGATAAGAGTGTCAACGCTGGCCTGATGTACTTCGTATAGC
AAAAGAATATGTTCCACACCAGGTATATCCACCAATCAGATTGGGACGAA
GCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAAGTCTTGTCGACGTCCT
GATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGATTATACGGAAGGTG
AAAGCTTCTTGTTGAGAGCACAACGTCCAGAATTAGCCATCAAATTTTAC
AAGATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGA
AGGTGATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGT
CGCTTCAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGA
AGCTGTTCTTATATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACA
AGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGT
TGTTGCAAAAACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTGAC
ACAACGAATTGGAATCAGAAGGGCAATTGAGTACAGCCGAACATCACTAT
TTGGAAGTGGGCGATTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGA
ATTATGGGAAGATGCGTACAGGTACGACCAAATGATTAAACTGGTGAAAG
AATACCACGGAGACTTGATCACAGATACTCATCTACACCTTGCTAAGGTT
ATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACGAG
CAAAGATGCTCGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTA
TACATTGCACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGC
TGAAAAATGGCCGAACGATTTTATGTTCGAGGTAACATGCCACGTACAGC
TGTGGAAATGTACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGTGT
CACACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGT
GGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCCGTTCTT
CGAAATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCAACAAAGAGGA
CTGGAACAAGTTTGCCATGGCAACCAAGGAGGAGCAACGAGAAGAGGTCA
AAGAATGGGTGTTGGCTGTTTCCATGGATCAACGTGTAGAGCAAACTTTA
AGTTTTGACGAACGAAATGTATACGAAGCTTCTTTAACTTCACCGGAGAG
TGACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCATCGAAGATGGTAAC
CTTGATGCGATTGACAACACAGATATCATGGACACAGATATTCCGTTAGA
GGTTCCTCTCCCTGAAACACAATATCTCAATGGTGTTGGATGGGAAAACA
TGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGGAGGTTCTA
CATGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGATCTTATACCGTG
CGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGTGTGATGGGTTCA
ACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACAGGATGCTT
CTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAAAACAGCCA
ATTGAATTTCAACATCTACAAACGTTTAGTTGAAGATTTATTCGCCAAGC
AAGGATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGATCTCAGAACA
ATGCTTTATGATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTA
TGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGT
TCGTCGAACATGGCGCACCTGCCAATCCACAGCTGATCAACGTGGATGTG
ATCGCAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTAT
CCAAGAAGCTGAGCAACAGGTACGAAGAACACGTAGAAGAAGAATATGTG
AAATATCTCAAGAAGAAGAATAAGACTGACGAGGCATCAGATTTGTATCA
AGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGATT
TATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAAGGTGCA
GAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAGTATAA
CCGTGCAATCGATCTGTACATGCGCATTACACAAGACATGGCAGGGAATA
GTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCATCAAA
TTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAACGCTT
ATTGGAAATGCAAGCTTACGAAACTTTGGCAGCCTTACAAGACGAATACG
ATCGCATTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAACGCTGGCCTG
ATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGGTATATCCACCA
ATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAA
GTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAA
GATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAATT
AGCCATCAAATTTTACAAGATCGTTCGACTTTGCTTTTGATCTCGCGCGA
ACGCTTAAGCGGGAGAAGGTGATGGAAATCCACTTAAAGAAAGCCATGTT
TTTGGAAGATGAAGGTCGCTTCAATGATGCCGAAGACGAATTCATCAAAG
CTGAAAAACCAAAAGAAGCTGTTCTTATATCGCCAAACAAAGTGGTACAC
CAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGC
GATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTAT
TGATTATGCTATTGACACAACGAATTGGAATCAGAAGGGCAATTGAGTAC
AGCCGAACATCACTATTTGGAAGTGGGCGATTGGAAAGCCTGTGTCAACA
TGTATCGAAGCAATGAATTATGGGAAGATGCGTACAGGTACGACCAAATG
ATTAAACTGGTGAAAGAATACCACGGAGACTTGATCACAGATACTCATCT
ACACCTTGCTAAGGTTATATATCATGATCGAAGAAGGTGACCTTGCTATC
AATATGTATAAACGAGCAAAGATGCTCGCAGTACGTTGCATGGATTCCGA
TGACGTCTCCAAACTATACATTGCACAGGCTGAACAGTTAGAAGCACAAG
GGAGATTCAAAGAAGCTGAAAAATGGCCGAACGATTTTATGTTCGAGGTA
ACATGCCACGTACAGCTGTGGAAATGTACACCAAAGTCAATAAATACGAA
GCCGCTTACAAGGTGTCACACAGTGCAGATTGTCAAGACGTCTTACGCTT
TCTTTCCTTATGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGT
AAGTTATCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAG
CTGCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGAGGAG
CAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACG
TGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTCTT
TAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGG
CATCGAAGATGGTAACCTTGATGCGATTGACAACACAGATATCATGGACA
CAGATATTCCGTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAATGGT
GTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGACTT
GAGTGAGGAGGTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGATATT
GTGATCTTATACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCACTGC
AAGTGTGATGGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATAT
CTTCAACAGGATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTA
TCACCAAAAACAGCCAATTGAATTTCAACATCTACAAACGTTTAGTTGAA
GATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTATG
GGCAGATCTCAGAACAATGCTTTATGATCTGAGTTTCGAAGTTTTATCAA
AGTATGTGGCTTTGTATGCAGCGAATTTGATCAAAGATGGTGATCAAGTG
AAAGCCTTGCGTTTGTTCGTCGAACATGGCGCACCTGCCAATCCACAGCT
GATCAACGTGGATGTGATCGCAGCACTTGACATGTATGTGGAGCAAGGCT
TGTGGGATAAATGTATCCAAGAAGCTGAGCAACAGGTACGAAGAACACGT
AGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGG
CATCAGATTTGTATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCA
TGTGTTAAAGGAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTA
CGCTCCAAAAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGA
CTAGGGCCGAGTATAACCGTGCAATCGATCTGTACATGCGCATTACACAA
GACATGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCT
TGAACTGGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACG
AAGTCTGTAAACGCTTATTGGAAATGCAAGCTTACGAAACTTTGGCAGCC
TTACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAGAG
TGTCAACGCTGGCCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACA
CCAGGTATATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAG
AGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTT
GTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAG
CACAACGTCCAGAATTAGCCATCAAATTTTACAAGATCGTTCGACTTTGC
TTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATGGAAATCCACT
TAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAATGATGCCGAA
GACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTCTTATATCGCC
AAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGC
GAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTT
TGTTGGAAGCATGTATTGATTATGCTATTGACACAACGAATTGGAATCAG
AAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGATTGG
AAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATGCGTA
CAGGTACGACCAAATGATTAAACTGGTGAAAGAATACCACGGAGACTTGA
TCACAGATACTCATCTACACCTTGCTAAGGTTATATATCATGATCGAAGA
AGGTGACCTTGCTATCAATATGTATAAACGAGCAAAGATGCTCGCAGTAC
GTTGCATGGATTCCGATGACGTCTCCAAACTATACATTGCACAGGCTGAA
CAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGAACGA
TTTTATGTTCGAGGTAACATGCCACGTACAGCTGTGGAAATGTACACCAA
AGTCAATAAATACGAAGCCGCTTACAAGGTGTCACACAGTGCAGATTGTC
AAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGAACGTCTGGAAACCAA
GCCTTCTCGTTTGGGTAAGTTATCCCGTTCTTCGAAATAAAATGGAATTC
AACAAAACGGGCAAAGCTGCCAACAAAGAGGACTGGAACAAGTTTGCCAT
GGCAACCAAGGAGGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTG
TTTCCATGGATCAACGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAAT
GTATACGAAGCTTCTTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCC
ATGCGTTGTCACAGGGCATCGAAGATGGTAACCTTGATGCGATTGACAAC
ACAGATATCATGGACACAGATATTCCGTTAGAGGTTCCTCTCCCTGAAAC
ACAATATCTCAATGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCA
ACAGATATCTGGACTTGAGTGAGGAGGTTCTACATGCCAAGATTTCAGTT
TCCTTATTGAGATATTGTGATCTTATACCGTGCGATAAAGCTTTTTATGA
AGCTGGCATTCACTGCAAGTGTGATGGGTTCAACAAGAAGCCGACCAACC
CTGCAGTCATGGATATCTTCAACAGGATGCTTCTCGTGGCTCACTATTAC
GCCATCCGGTCTGCTATCACCAAAAACAGCCAATTGAATTTCAACATCTA
CAAACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGA
ATGCATATAAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGAGT
TTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATCAA
AGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGCAC
CTGCCAATCCACAGCTGATCAACGTGGATGTGATCGCAGCACTTGACATG
TATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAGCAACA
GGTACGAAGAACACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAG
AATAAGACTGACGAGGCATCAGATTTGTATCAAGCAGTCAAATTATACCG
TGAAGCAATAAGTGCATGTGTTAAAGGAGATTTATGGACGCAAGCAAGAA
GCATCGCAAGGGATTACGCTCCAAAAGGTGCAGAAGGTATCATCGCACAA
GCTCGTGATTGGGAGACTAGGGCCGAGTATAACCGTGCAATCGATCTGTA
CATGCGCATTACACAAGACATGGCAGGGAATAGTGCAGTCATTGAAGAAG
TCTATACCAAAGCTCTTGAACTGGCCATCAAATTCTCAAAAGATCGCGCG
CTCAGTGTTGCCCACGAAGTCTGTAAACGCTTATTGGAAATGCAAGCTTA
CGAAACTTTGGCAGCCTTACAAGACGAATACGATCGCATTGCTACTCAGA
GTGGTGGTGATAAGAGTGTCAACGCTGGCCTGATGTACTTCGTATAGCAA
AAGAATATGTTCCACACCAGGTATATCCACCAATCAGATTGGGACGAAGC
AAGAAGAGTGGCAGAGAGTTACGACCCAGAAAGTCTTGTCGACGTCCTGA
TTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGATTATACGGAAGGTGAA
AGCTTCTTGTTGAGAGCACAACGTCCAGAATTAGCCATCAAATTTTACAA
GATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAG
GTGATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCG
CTTCAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAG
CTGTTCTTATATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAG
TGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTG
TTGCAAAAACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTGACAC
AACGAATTGGAATCAGAAGGGCAATTGAGTACAGCCGAACATCACTATTT
GGAAGTGGGCGATTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAAT
TATGGGAAGATGCGTACAGGTACGACCAAATGATTAAACTGGTGAAAGAA
TACCACGGAGACTTGATCACAGATACTCATCTACACCTTGCTAAGGTTAT
ATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACGAGCA
AAGATGCTCGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTATA
CATTGCACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTG
AAAAATGGCCGAACGATTTTATGTTCGAGGTAACATGCCACGTACAGCTG
TGGAAATGTACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGTGTCA
CACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGG
AACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCCGTTCTTCG
AAATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCAACAAAGAGGACT
GGAACAAGTTTGCCATGGCAACCAAGGAGGAGCAACGAGAAGAGGTCAAA
GAATGGGTGTTGGCTGTTTCCATGGATCAACGTGTAGAGCAAACTTTAAG
TTTTGACGAACGAAATGTATACGAAGCTTCTTTAACTTCACCGGAGAGTG
ACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCATCGAAGATGGTAACCT
TGATGCGATTGACAACACAGATATCATGGACACAGATATTCCGTTAGAGG
TTCCTCTCCCTGAAACACAATATCTCAATGGTGTTGGATGGGAAAACATG
GCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGGAGGTTCTACA
TGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGATCTTATACCGTGCG
ATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGTGTGATGGGTTCAAC
AAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACAGGATGCTTCT
CGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAAAACAGCCAAT
TGAATTTCAACATCTACAAACGTTTAGTTGAAGATTTATTCGCCAAGCAA
GGATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGATCTCAGAACAAT
GCTTTATGATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATG
CAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTC
GTCGAACATGGCGCACCTGCCAATCCACAGCTGATCAACGTGGATGTGAT
CGCAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCC
AAGAAGCTGAGCAACAGGTACGAAGAACACGTAGAAGAAGAATATGTGAA
ATATCTCAAGAAGAAGAATAAGACTGACGAGGCATCAGATTTGTATCAAG
CAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGATTTA
TGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAAGGTGCAGA
AGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAGTATAACC
GTGCAATCGATCTGTACATGCGCATTACACAAGACATGGCAGGGAATAGT
GCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCATCAAATT
CTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAACGCTTAT
TGGAAATGCAAGCTTACGAAACTTTGGCAGCCTTACAAGACGAATACGAT
CGCATTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAACGCTGGCCTGAT
GTACTTCGTATAGCAAAAGAATATGTTCCACACCAGGTATATCCACCAAT
CAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAAGT
CTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGA
TTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAATTAG
CCATCAAATTTTACAAGATCGTTCGACTTTGCTTTTGATCTCGCGCGAAC
GCTTAAGCGGGAGAAGGTGATGGAAATCCACTTAAAGAAAGCCATGTTTT
TGGAAGATGAAGGTCGCTTCAATGATGCCGAAGACGAATTCATCAAAGCT
GAAAAACCAAAAGAAGCTGTTCTTATATCGCCAAACAAAGTGGTACACCA
GGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGA
TTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTATTG
ATTATGCTATTGACACAACGAATTGGAATCAGAAGGGCAATTGAGTACAG
CCGAACATCACTATTTGGAAGTGGGCGATTGGAAAGCCTGTGTCAACATG
TATCGAAGCAATGAATTATGGGAAGATGCGTACAGGTACGACCAAATGAT
TAAACTGGTGAAAGAATACCACGGAGACTTGATCACAGATACTCATCTAC
ACCTTGCTAAGGTTATATATCATGATCGAAGAAGGTGACCTTGCTATCAA
TATGTATAAACGAGCAAAGATGCTCGCAGTACGTTGCATGGATTCCGATG
ACGTCTCCAAACTATACATTGCACAGGCTGAACAGTTAGAAGCACAAGGG
AGATTCAAAGAAGCTGAAAAATGGCCGAACGATTTTATGTTCGAGGTAAC
ATGCCACGTACAGCTGTGGAAATGTACACCAAAGTCAATAAATACGAAGC
CGCTTACAAGGTGTCACACAGTGCAGATTGTCAAGACGTCTTACGCTTTC
TTTCCTTATGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAA
GTTATCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCT
GCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGAGGAGCA
ACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACGTG
TAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTCTTTA
ACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCA
TCGAAGATGGTAACCTTGATGCGATTGACAACACAGATATCATGGACACA
GATATTCCGTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAATGGTGT
TGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGA
GTGAGGAGGTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGATATTGT
GATCTTATACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAA
GTGTGATGGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCT
TCAACAGGATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATC
ACCAAAAACAGCCAATTGAATTTCAACATCTACAAACGTTTAGTTGAAGA
TTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTATGGG
CAGATCTCAGAACAATGCTTTATGATCTGAGTTTCGAAGTTTTATCAAAG
TATGTGGCTTTGTATGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAA
AGCCTTGCGTTTGTTCGTCGAACATGGCGCACCTGCCAATCCACAGCTGA
TCAACGTGGATGTGATCGCAGCACTTGACATGTATGTGGAGCAAGGCTTG
TGGGATAAATGTATCCAAGAAGCTGAGCAACAGGTACGAAGAACACGTAG
AAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGGCA
TCAGATTTGTATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATG
TGTTAAAGGAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACG
CTCCAAAAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACT
AGGGCCGAGTATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGA
CATGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTG
AACTGGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAA
GTCTGTAAACGCTTATTGGAAATGCAAGCTTACGAAACTTTGGCAGCCTT
ACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAGAGTG
TCAACGCTGGCCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACACC
AGGTATATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAG
TTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGT
CTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCA
CAACGTCCAGAATTAGCCATCAAATTTTACAAGATCGTTCGACTTTGCTT
TTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATGGAAATCCACTTA
AAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAATGATGCCGAAGA
CGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTCTTATATCGCCAA
ACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGA
AAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTG
TTGGAAGCATGTATTGATTATGCTATTGACACAACGAATTGGAATCAGAA
GGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGATTGGAA
AGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATGCGTACA
GGTACGACCAAATGATTAAACTGGTGAAAGAATACCACGGAGACTTGATC
ACAGATACTCATCTACACCTTGCTAAGGTTATATATCATGATCGAAGAAG
GTGACCTTGCTATCAATATGTATAAACGAGCAAAGATGCTCGCAGTACGT
TGCATGGATTCCGATGACGTCTCCAAACTATACATTGCACAGGCTGAACA
GTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGAACGATT
TTATGTTCGAGGTAACATGCCACGTACAGCTGTGGAAATGTACACCAAAG
TCAATAAATACGAAGCCGCTTACAAGGTGTCACACAGTGCAGATTGTCAA
GACGTCTTACGCTTTCTTTCCTTATGGTGTGGAACGTCTGGAAACCAAGC
CTTCTCGTTTGGGTAAGTTATCCCGTTCTTCGAAATAAAATGGAATTCAA
CAAAACGGGCAAAGCTGCCAACAAAGAGGACTGGAACAAGTTTGCCATGG
CAACCAAGGAGGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTT
TCCATGGATCAACGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGT
ATACGAAGCTTCTTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCAT
GCGTTGTCACAGGGCATCGAAGATGGTAACCTTGATGCGATTGACAACAC
AGATATCATGGACACAGATATTCCGTTAGAGGTTCCTCTCCCTGAAACAC
AATATCTCAATGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAAC
AGATATCTGGACTTGAGTGAGGAGGTTCTACATGCCAAGATTTCAGTTTC
CTTATTGAGATATTGTGATCTTATACCGTGCGATAAAGCTTTTTATGAAG
CTGGCATTCACTGCAAGTGTGATGGGTTCAACAAGAAGCCGACCAACCCT
GCAGTCATGGATATCTTCAACAGGATGCTTCTCGTGGCTCACTATTACGC
CATCCGGTCTGCTATCACCAAAAACAGCCAATTGAATTTCAACATCTACA
AACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAAT
GCATATAAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGAGTTT
CGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATCAAAG
ATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGCACCT
GCCAATCCACAGCTGATCAACGTGGATGTGATCGCAGCACTTGACATGTA
TGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAGCAACAGG
TACGAAGAACACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAA
TAAGACTGACGAGGCATCAGATTTGTATCAAGCAGTCAAATTATACCGTG
AAGCAATAAGTGCATGTGTTAAAGGAGATTTATGGACGCAAGCAAGAAGC
ATCGCAAGGGATTACGCTCCAAAAGGTGCAGAAGGTATCATCGCACAAGC
TCGTGATTGGGAGACTAGGGCCGAGTATAACCGTGCAATCGATCTGTACA
TGCGCATTACACAAGACATGGCAGGGAATAGTGCAGTCATTGAAGAAGTC
TATACCAAAGCTCTTGAACTGGCCATCAAATTCTCAAAAGATCGCGCGCT
CAGTGTTGCCCACGAAGTCTGTAAACGCTTATTGGAAATGCAAGCTTACG
AAACTTTGGCAGCCTTACAAGACGAATACGATCGCATTGCTACTCAGAGT
GGTGGTGATAAGAGTGTCAACGCTGGCCTGATGTACTTCGTATAGCAAAA
GAATATGTTCCACACCAGGTATATCCACCAATCAGATTGGGACGAAGCAA
GAAGAGTGGCAGAGAGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATT
GGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAG
CTTCTTGTTGAGAGCACAACGTCCAGAATTAGCCATCAAATTTTACAAGA
TCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGT
GATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCT
TCAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCT
GTTCTTATATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTG
GCTTATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTT
GCAAAAACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTGACACAA
CGAATTGGAATCAGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGG
AAGTGGGCGATTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTA
TGGGAAGATGCGTACAGGTACGACCAAATGATTAAACTGGTGAAAGAATA
CCACGGAGACTTGATCACAGATACTCATCTACACCTTGCTAAGGTTATAT
ATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACGAGCAAA
GATGCTCGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTATACA
TTGCACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAA
AAATGGCCGAACGATTTTATGTTCGAGGTAACATGCCACGTACAGCTGTG
GAAATGTACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGTGTCACA
CAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGAA
CGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCCGTTCTTCGAA
ATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCAACAAAGAGGACTGG
AACAAGTTTGCCATGGCAACCAAGGAGGAGCAACGAGAAGAGGTCAAAGA
ATGGGTGTTGGCTGTTTCCATGGATCAACGTGTAGAGCAAACTTTAAGTT
TTGACGAACGAAATGTATACGAAGCTTCTTTAACTTCACCGGAGAGTGAC
GTGGTCTGTTTGCCATGCGTTGTCACAGGGCATCGAAGATGGTAACCTTG
ATGCGATTGACAACACAGATATCATGGACACAGATATTCCGTTAGAGGTT
CCTCTCCCTGAAACACAATATCTCAATGGTGTTGGATGGGAAAACATGGC
TTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGGAGGTTCTACATG
CCAAGATTTCAGTTTCCTTATTGAGATATTGTGATCTTATACCGTGCGAT
AAAGCTTTTTATGAAGCTGGCATTCACTGCAAGTGTGATGGGTTCAACAA
GAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACAGGATGCTTCTCG
TGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAAAACAGCCAATTG
AATTTCAACATCTACAAACGTTTAGTTGAAGATTTATTCGCCAAGCAAGG
ATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGATCTCAGAACAATGC
TTTATGATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCA
GCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGT
CGAACATGGCGCACCTGCCAATCCACAGCTGATCAACGTGGATGTGATCG
CAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAA
GAAGCTGAGCAACAGGTACGAAGAACACGTAGAAGAAGAATATGTGAAAT
ATCTCAAGAAGAAGAATAAGACTGACGAGGCATCAGATTTGTATCAAGCA
GTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGATTTATG
GACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAAGGTGCAGAAG
GTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAGTATAACCGT
GCAATCGATCTGTACATGCGCATTACACAAGACATGGCAGGGAATAGTGC
AGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCATCAAATTCT
CAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAACGCTTATTG
GAAATGCAAGCTTACGAAACTTTGGCAGCCTTACAAGACGAATACGATCG
CATTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAACGCTGGCCTGATGT
ACTTCGTATAGCAAAAGAATATGTTCCACACCAGGTATATCCACCAATCA
GATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAAGTCT
TGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGATT
ATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAATTAGCC
ATCAAATTTTACAAGATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGC
TTAAGCGGGAGAAGGTGATGGAAATCCACTTAAAGAAAGCCATGTTTTTG
GAAGATGAAGGTCGCTTCAATGATGCCGAAGACGAATTCATCAAAGCTGA
AAAACCAAAAGAAGCTGTTCTTATATCGCCAAACAAAGTGGTACACCAGG
CTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGATT
CTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTATTGAT
TATGCTATTGACACAACGAATTGGAATCAGAAGGGCAATTGAGTACAGCC
GAACATCACTATTTGGAAGTGGGCGATTGGAAAGCCTGTGTCAACATGTA
TCGAAGCAATGAATTATGGGAAGATGCGTACAGGTACGACCAAATGATTA
AACTGGTGAAAGAATACCACGGAGACTTGATCACAGATACTCATCTACAC
CTTGCTAAGGTTATATATCATGATCGAAGAAGGTGACCTTGCTATCAATA
TGTATAAACGAGCAAAGATGCTCGCAGTACGTTGCATGGATTCCGATGAC
GTCTCCAAACTATACATTGCACAGGCTGAACAGTTAGAAGCACAAGGGAG
ATTCAAAGAAGCTGAAAAATGGCCGAACGATTTTATGTTCGAGGTAACAT
GCCACGTACAGCTGTGGAAATGTACACCAAAGTCAATAAATACGAAGCCG
CTTACAAGGTGTCACACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTT
TCCTTATGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGT
TATCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCTGC
CAACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGAGGAGCAAC
GAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACGTGTA
GAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTCTTTAAC
TTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCATC
GAAGATGGTAACCTTGATGCGATTGACAACACAGATATCATGGACACAGA
TATTCCGTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAATGGTGTTG
GATGGGAAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGT
GAGGAGGTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGA
TCTTATACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGT
GTGATGGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTC
AACAGGATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCAC
CAAAAACAGCCAATTGAATTTCAACATCTACAAACGTTTAGTTGAAGATT
TATTCGCCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTATGGGCA
GATCTCAGAACAATGCTTTATGATCTGAGTTTCGAAGTTTTATCAAAGTA
TGTGGCTTTGTATGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAG
CCTTGCGTTTGTTCGTCGAACATGGCGCACCTGCCAATCCACAGCTGATC
AACGTGGATGTGATCGCAGCACTTGACATGTATGTGGAGCAAGGCTTGTG
GGATAAATGTATCCAAGAAGCTGAGCAACAGGTACGAAGAACACGTAGAA
GAAGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGGCATC
AGATTTGTATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTG
TTAAAGGAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCT
CCAAAAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAG
GGCCGAGTATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACA
TGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAA
CTGGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGT
CTGTAAACGCTTATTGGAAATGCAAGCTTACGAAACTTTGGCAGCCTTAC
AAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAGAGTGTC
AACGCTGGCCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAG
GTATATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTT
ACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCT
TTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACA
ACGTCCAGAATTAGCCATCAAATTTTACAAGATCGTTCGACTTTGCTTTT
GATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATGGAAATCCACTTAAA
GAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAATGATGCCGAAGACG
AATTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTCTTATATCGCCAAAC
AAAGTGGTACACCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAA
AGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTT
GGAAGCATGTATTGATTATGCTATTGACACAACGAATTGGAATCAGAAGG
GCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGATTGGAAAG
CCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATGCGTACAGG
TACGACCAAATGATTAAACTGGTGAAAGAATACCACGGAGACTTGATCAC
AGATACTCATCTACACCTTGCTAAGGTTATATATCATGATCGAAGAAGGT
GACCTTGCTATCAATATGTATAAACGAGCAAAGATGCTCGCAGTACGTTG
CATGGATTCCGATGACGTCTCCAAACTATACATTGCACAGGCTGAACAGT
TAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGAACGATTTT
ATGTTCGAGGTAACATGCCACGTACAGCTGTGGAAATGTACACCAAAGTC
AATAAATACGAAGCCGCTTACAAGGTGTCACACAGTGCAGATTGTCAAGA
CGTCTTACGCTTTCTTTCCTTATGGTGTGGAACGTCTGGAAACCAAGCCT
TCTCGTTTGGGTAAGTTATCCCGTTCTTCGAAATAAAATGGAATTCAACA
AAACGGGCAAAGCTGCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCA
ACCAAGGAGGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTC
CATGGATCAACGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTAT
ACGAAGCTTCTTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGC
GTTGTCACAGGGCATCGAAGATGGTAACCTTGATGCGATTGACAACACAG
ATATCATGGACACAGATATTCCGTTAGAGGTTCCTCTCCCTGAAACACAA
TATCTCAATGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAG
ATATCTGGACTTGAGTGAGGAGGTTCTACATGCCAAGATTTCAGTTTCCT
TATTGAGATATTGTGATCTTATACCGTGCGATAAAGCTTTTTATGAAGCT
GGCATTCACTGCAAGTGTGATGGGTTCAACAAGAAGCCGACCAACCCTGC
AGTCATGGATATCTTCAACAGGATGCTTCTCGTGGCTCACTATTACGCCA
TCCGGTCTGCTATCACCAAAAACAGCCAATTGAATTTCAACATCTACAAA
CGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATGC
ATATAAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGAGTTTCG
AAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATCAAAGAT
GGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGCACCTGC
CAATCCACAGCTGATCAACGTGGATGTGATCGCAGCACTTGACATGTATG
TGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAGCAACAGGTA
CGAAGAACACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATA
AGACTGACGAGGCATCAGATTTGTATCAAGCAGTCAAATTATACCGTGAA
GCAATAAGTGCATGTGTTAAAGGAGATTTATGGACGCAAGCAAGAAGCAT
CGCAAGGGATTACGCTCCAAAAGGTGCAGAAGGTATCATCGCACAAGCTC
GTGATTGGGAGACTAGGGCCGAGTATAACCGTGCAATCGATCTGTACATG
CGCATTACACAAGACATGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTA
TACCAAAGCTCTTGAACTGGCCATCAAATTCTCAAAAGATCGCGCGCTCA
GTGTTGCCCACGAAGTCTGTAAACGCTTATTGGAAATGCAAGCTTACGAA
ACTTTGGCAGCCTTACAAGACGAATACGATCGCATTGCTACTCAGAGTGG
TGGTGATAAGAGTGTCAACGCTGGCCTGATGTACTTCGTATAGCAAAAGA
ATATGTTCCACACCAGGTATATCCACCAATCAGATTGGGACGAAGCAAGA
AGAGTGGCAGAGAGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGG
TCAAGCCCGTTTGTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCT
TCTTGTTGAGAGCACAACGTCCAGAATTAGCCATCAAATTTTACAAGATC
GTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGA
TGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTC
AATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTGT
TCTTATATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGGC
TTATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGC
AAAAACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTGACACAACG
AATTGGAATCAGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAA
GTGGGCGATTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATG
GGAAGATGCGTACAGGTACGACCAAATGATTAAACTGGTGAAAGAATACC
ACGGAGACTTGATCACAGATACTCATCTACACCTTGCTAAGGTTATATAT
CATGATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACGAGCAAAGA
TGCTCGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTATACATT
GCACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAA
ATGGCCGAACGATTTTATGTTCGAGGTAACATGCCACGTACAGCTGTGGA
AATGTACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGTGTCACACA
GTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGAACG
TCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCCGTTCTTCGAAAT
AAAATGGAATTCAACAAAACGGGCAAAGCTGCCAACAAAGAGGACTGGAA
CAAGTTTGCCATGGCAACCAAGGAGGAGCAACGAGAAGAGGTCAAAGAAT
GGGTGTTGGCTGTTTCCATGGATCAACGTGTAGAGCAAACTTTAAGTTTT
GACGAACGAAATGTATACGAAGCTTCTTTAACTTCACCGGAGAGTGACGT
GGTCTGTTTGCCATGCGTTGTCACAGGGCATCGAAGATGGTAACCTTGAT
GCGATTGACAACACAGATATCATGGACACAGATATTCCGTTAGAGGTTCC
TCTCCCTGAAACACAATATCTCAATGGTGTTGGATGGGAAAACATGGCTT
TCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGGAGGTTCTACATGCC
AAGATTTCAGTTTCCTTATTGAGATATTGTGATCTTATACCGTGCGATAA
AGCTTTTTATGAAGCTGGCATTCACTGCAAGTGTGATGGGTTCAACAAGA
AGCCGACCAACCCTGCAGTCATGGATATCTTCAACAGGATGCTTCTCGTG
GCTCACTATTACGCCATCCGGTCTGCTATCACCAAAAACAGCCAATTGAA
TTTCAACATCTACAAACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGAT
TAAGTGGTGAGAATGCATATAAAGTATGGGCAGATCTCAGAACAATGCTT
TATGATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGC
GAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCG
AACATGGCGCACCTGCCAATCCACAGCTGATCAACGTGGATGTGATCGCA
GCACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGA
AGCTGAGCAACAGGTACGAAGAACACGTAGAAGAAGAATATGTGAAATAT
CTCAAGAAGAAGAATAAGACTGACGAGGCATCAGATTTGTATCAAGCAGT
CAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGATTTATGGA
CGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAAGGTGCAGAAGGT
ATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAGTATAACCGTGC
AATCGATCTGTACATGCGCATTACACAAGACATGGCAGGGAATAGTGCAG
TCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCATCAAATTCTCA
AAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAACGCTTATTGGA
AATGCAAGCTTACGAAACTTTGGCAGCCTTACAAGACGAATACGATCGCA
TTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAACGCTGGCCTGATGTAC
TTCGTATAGCAAAAGAATATGTTCCACACCAGGTATATCCACCAATCAGA
TTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAAGTCTTG
TCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGATTAT
ACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAATTAGCCAT
CAAATTTTACAAGATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTT
AAGCGGGAGAAGGTGATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGA
AGATGAAGGTCGCTTCAATGATGCCGAAGACGAATTCATCAAAGCTGAAA
AACCAAAAGAAGCTGTTCTTATATCGCCAAACAAAGTGGTACACCAGGCT
CGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGATTCT
GCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTATTGATTA
TGCTATTGACACAACGAATTGGAATCAGAAGGGCAATTGAGTACAGCCGA
ACATCACTATTTGGAAGTGGGCGATTGGAAAGCCTGTGTCAACATGTATC
GAAGCAATGAATTATGGGAAGATGCGTACAGGTACGACCAAATGATTAAA
CTGGTGAAAGAATACCACGGAGACTTGATCACAGATACTCATCTACACCT
TGCTAAGGTTATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATG
TATAAACGAGCAAAGATGCTCGCAGTACGTTGCATGGATTCCGATGACGT
CTCCAAACTATACATTGCACAGGCTGAACAGTTAGAAGCACAAGGGAGAT
TCAAAGAAGCTGAAAAATGGCCGAACGATTTTATGTTCGAGGTAACATGC
CACGTACAGCTGTGGAAATGTACACCAAAGTCAATAAATACGAAGCCGCT
TACAAGGTGTCACACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTC
CTTATGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTA
TCCCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCA
ACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGAGGAGCAACGA
GAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACGTGTAGA
GCAAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTCTTTAACTT
CACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCATCGA
AGATGGTAACCTTGATGCGATTGACAACACAGATATCATGGACACAGATA
TTCCGTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAATGGTGTTGGA
TGGGAAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGA
GGAGGTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGATC
TTATACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGTGT
GATGGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAA
CAGGATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCA
AAAACAGCCAATTGAATTTCAACATCTACAAACGTTTAGTTGAAGATTTA
TTCGCCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGA
TCTCAGAACAATGCTTTATGATCTGAGTTTCGAAGTTTTATCAAAGTATG
TGGCTTTGTATGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCC
TTGCGTTTGTTCGTCGAACATGGCGCACCTGCCAATCCACAGCTGATCAA
CGTGGATGTGATCGCAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGG
ATAAATGTATCCAAGAAGCTGAGCAACAGGTACGAAGAACACGTAGAAGA
AGAATATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGGCATCAG
ATTTGTATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTT
AAAGGAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCC
AAAAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGG
CCGAGTATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACATG
GCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACT
GGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCT
GTAAACGCTTATTGGAAATGCAAGCTTACGAAACTTTGGCAGCCTTACAA
GACGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAA
CGCTGGCCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGGT
ATATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTAC
GACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTT
CGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAAC
GTCCAGAATTAGCCATCAAATTTTACAAGATCGTTCGACTTTGCTTTTGA
TCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATGGAAATCCACTTAAAGA
AAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAATGATGCCGAAGACGAA
TTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTCTTATATCGCCAAACAA
AGTGGTACACCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAG
TCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGG
AAGCATGTATTGATTATGCTATTGACACAACGAATTGGAATCAGAAGGGC
AATTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGATTGGAAAGCC
TGTGTCAACATGTATCGAAGCAATGAATTATGGGAAGATGCGTACAGGTA
CGACCAAATGATTAAACTGGTGAAAGAATACCACGGAGACTTGATCACAG
ATACTCATCTACACCTTGCTAAGGTTATATATCATGATCGAAGAAGGTGA
CCTTGCTATCAATATGTATAAACGAGCAAAGATGCTCGCAGTACGTTGCA
TGGATTCCGATGACGTCTCCAAACTATACATTGCACAGGCTGAACAGTTA
GAAGCACAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGAACGATTTTAT
GTTCGAGGTAACATGCCACGTACAGCTGTGGAAATGTACACCAAAGTCAA
TAAATACGAAGCCGCTTACAAGGTGTCACACAGTGCAGATTGTCAAGACG
TCTTACGCTTTCTTTCCTTATGGTGTGGAACGTCTGGAAACCAAGCCTTC
TCGTTTGGGTAAGTTATCCCGTTCTTCGAAATAAAATGGAATTCAACAAA
ACGGGCAAAGCTGCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCAAC
CAAGGAGGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCA
TGGATCAACGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATAC
GAAGCTTCTTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGT
TGTCACAGGGCATCGAAGATGGTAACCTTGATGCGATTGACAACACAGAT
ATCATGGACACAGATATTCCGTTAGAGGTTCCTCTCCCTGAAACACAATA
TCTCAATGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGAT
ATCTGGACTTGAGTGAGGAGGTTCTACATGCCAAGATTTCAGTTTCCTTA
TTGAGATATTGTGATCTTATACCGTGCGATAAAGCTTTTTATGAAGCTGG
CATTCACTGCAAGTGTGATGGGTTCAACAAGAAGCCGACCAACCCTGCAG
TCATGGATATCTTCAACAGGATGCTTCTCGTGGCTCACTATTACGCCATC
CGGTCTGCTATCACCAAAAACAGCCAATTGAATTTCAACATCTACAAACG
TTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATGCAT
ATAAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGAGTTTCGAA
GTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATCAAAGATGG
TGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGCACCTGCCA
ATCCACAGCTGATCAACGTGGATGTGATCGCAGCACTTGACATGTATGTG
GAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAGCAACAGGTACG
AAGAACACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAG
ACTGACGAGGCATCAGATTTGTATCAAGCAGTCAAATTATACCGTGAAGC
AATAAGTGCATGTGTTAAAGGAGATTTATGGACGCAAGCAAGAAGCATCG
CAAGGGATTACGCTCCAAAAGGTGCAGAAGGTATCATCGCACAAGCTCGT
GATTGGGAGACTAGGGCCGAGTATAACCGTGCAATCGATCTGTACATGCG
CATTACACAAGACATGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTATA
CCAAAGCTCTTGAACTGGCCATCAAATTCTCAAAAGATCGCGCGCTCAGT
GTTGCCCACGAAGTCTGTAAACGCTTATTGGAAATGCAAGCTTACGAAAC
TTTGGCAGCCTTACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTG
GTGATAAGAGTGTCAACGCTGGCCTGATGTACTTCGTATAGCAAAAGAAT
ATGTTCCACACCAGGTATATCCACCAATCAGATTGGGACGAAGCAAGAAG
AGTGGCAGAGAGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTC
AAGCCCGTTTGTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTC
TTGTTGAGAGCACAACGTCCAGAATTAGCCATCAAATTTTACAAGATCGT
TCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATG
GAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAA
TGATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTC
TTATATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGGCTT
ATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAA
AAACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTGACACAACGAA
TTGGAATCAGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGT
GGGCGATTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGG
AAGATGCGTACAGGTACGACCAAATGATTAAACTGGTGAAAGAATACCAC
GGAGACTTGATCACAGATACTCATCTACACCTTGCTAAGGTTATATATCA
TGATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACGAGCAAAGATG
CTCGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTATACATTGC
ACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAAT
GGCCGAACGATTTTATGTTCGAGGTAACATGCCACGTACAGCTGTGGAAA
TGTACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGTGTCACACAGT
GCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGAACGTC
TGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCCGTTCTTCGAAATAA
AATGGAATTCAACAAAACGGGCAAAGCTGCCAACAAAGAGGACTGGAACA
AGTTTGCCATGGCAACCAAGGAGGAGCAACGAGAAGAGGTCAAAGAATGG
GTGTTGGCTGTTTCCATGGATCAACGTGTAGAGCAAACTTTAAGTTTTGA
CGAACGAAATGTATACGAAGCTTCTTTAACTTCACCGGAGAGTGACGTGG
TCTGTTTGCCATGCGTTGTCACAGGGCATCGAAGATGGTAACCTTGATGC
GATTGACAACACAGATATCATGGACACAGATATTCCGTTAGAGGTTCCTC
TCCCTGAAACACAATATCTCAATGGTGTTGGATGGGAAAACATGGCTTTC
GTCTTCCTCAACAGATATCTGGACTTGAGTGAGGAGGTTCTACATGCCAA
GATTTCAGTTTCCTTATTGAGATATTGTGATCTTATACCGTGCGATAAAG
CTTTTTATGAAGCTGGCATTCACTGCAAGTGTGATGGGTTCAACAAGAAG
CCGACCAACCCTGCAGTCATGGATATCTTCAACAGGATGCTTCTCGTGGC
TCACTATTACGCCATCCGGTCTGCTATCACCAAAAACAGCCAATTGAATT
TCAACATCTACAAACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTA
AGTGGTGAGAATGCATATAAAGTATGGGCAGATCTCAGAACAATGCTTTA
TGATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGA
ATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAA
CATGGCGCACCTGCCAATCCACAGCTGATCAACGTGGATGTGATCGCAGC
ACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAG
CTGAGCAACAGGTACGAAGAACACGTAGAAGAAGAATATGTGAAATATCT
CAAGAAGAAGAATAAGACTGACGAGGCATCAGATTTGTATCAAGCAGTCA
AATTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGATTTATGGACG
CAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAAGGTGCAGAAGGTAT
CATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAGTATAACCGTGCAA
TCGATCTGTACATGCGCATTACACAAGACATGGCAGGGAATAGTGCAGTC
ATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCATCAAATTCTCAAA
AGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAACGCTTATTGGAAA
TGCAAGCTTACGAAACTTTGGCAGCCTTACAAGACGAATACGATCGCATT
GCTACTCAGAGTGGTGGTGATAAGAGTGTCAACGCTGGCCTGATGTACTT
CGTATAGCAAAAGAATATGTTCCACACCAGGTATATCCACCAATCAGATT
GGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAAGTCTTGTC
GACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGATTATAC
GGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAATTAGCCATCA
AATTTTACAAGATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAA
GCGGGAGAAGGTGATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAG
ATGAAGGTCGCTTCAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAA
CCAAAAGAAGCTGTTCTTATATCGCCAAACAAAGTGGTACACCAGGCTCG
GGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGC
CATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTATTGATTATG
CTATTGACACAACGAATTGGAATCAGAAGGGCAATTGAGTACAGCCGAAC
ATCACTATTTGGAAGTGGGCGATTGGAAAGCCTGTGTCAACATGTATCGA
AGCAATGAATTATGGGAAGATGCGTACAGGTACGACCAAATGATTAAACT
GGTGAAAGAATACCACGGAGACTTGATCACAGATACTCATCTACACCTTG
CTAAGGTTATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTA
TAAACGAGCAAAGATGCTCGCAGTACGTTGCATGGATTCCGATGACGTCT
CCAAACTATACATTGCACAGGCTGAACAGTTAGAAGCACAAGGGAGATTC
AAAGAAGCTGAAAAATGGCCGAACGATTTTATGTTCGAGGTAACATGCCA
CGTACAGCTGTGGAAATGTACACCAAAGTCAATAAATACGAAGCCGCTTA
CAAGGTGTCACACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCT
TATGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATC
CCGTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCAAC
AAAGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGAGGAGCAACGAGA
AGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACGTGTAGAGC
AAACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTCTTTAACTTCA
CCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCATCGAAG
ATGGTAACCTTGATGCGATTGACAACACAGATATCATGGACACAGATATT
CCGTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAATGGTGTTGGATG
GGAAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGG
AGGTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGATCTT
ATACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGTGTGA
TGGGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACA
GGATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAA
AACAGCCAATTGAATTTCAACATCTACAAACGTTTAGTTGAAGATTTATT
CGCCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGATC
TCAGAACAATGCTTTATGATCTGAGTTTCGAAGTTTTATCAAAGTATGTG
GCTTTGTATGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTT
GCGTTTGTTCGTCGAACATGGCGCACCTGCCAATCCACAGCTGATCAACG
TGGATGTGATCGCAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGGAT
AAATGTATCCAAGAAGCTGAGCAACAGGTACGAAGAACACGTAGAAGAAG
AATATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGGCATCAGAT
TTGTATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAA
AGGAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAA
AAGGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCC
GAGTATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACATGGC
AGGGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGG
CCATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGT
AAACGCTTATTGGAAATGCAAGCTTACGAAACTTTGGCAGCCTTACAAGA
CGAATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAACG
CTGGCCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGGTAT
ATCCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGA
CCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCG
AAAAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGT
CCAGAATTAGCCATCAAATTTTACAAGATCGTTCGACTTTGCTTTTGATC
TCGCGCGAACGCTTAAGCGGGAGAAGGTGATGGAAATCCACTTAAAGAAA
GCCATGTTTTTGGAAGATGAAGGTCGCTTCAATGATGCCGAAGACGAATT
CATCAAAGCTGAAAAACCAAAAGAAGCTGTTCTTATATCGCCAAACAAAG
TGGTACACCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTC
TTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAA
GCATGTATTGATTATGCTATTGACACAACGAATTGGAATCAGAAGGGCAA
TTGAGTACAGCCGAACATCACTATTTGGAAGTGGGCGATTGGAAAGCCTG
TGTCAACATGTATCGAAGCAATGAATTATGGGAAGATGCGTACAGGTACG
ACCAAATGATTAAACTGGTGAAAGAATACCACGGAGACTTGATCACAGAT
ACTCATCTACACCTTGCTAAGGTTATATATCATGATCGAAGAAGGTGACC
TTGCTATCAATATGTATAAACGAGCAAAGATGCTCGCAGTACGTTGCATG
GATTCCGATGACGTCTCCAAACTATACATTGCACAGGCTGAACAGTTAGA
AGCACAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGAACGATTTTATGT
TCGAGGTAACATGCCACGTACAGCTGTGGAAATGTACACCAAAGTCAATA
AATACGAAGCCGCTTACAAGGTGTCACACAGTGCAGATTGTCAAGACGTC
TTACGCTTTCTTTCCTTATGGTGTGGAACGTCTGGAAACCAAGCCTTCTC
GTTTGGGTAAGTTATCCCGTTCTTCGAAATAAAATGGAATTCAACAAAAC
GGGCAAAGCTGCCAACAAAGAGGACTGGAACAAGTTTGCCATGGCAACCA
AGGAGGAGCAACGAGAAGAGGTCAAAGAATGGGTGTTGGCTGTTTCCATG
GATCAACGTGTAGAGCAAACTTTAAGTTTTGACGAACGAAATGTATACGA
AGCTTCTTTAACTTCACCGGAGAGTGACGTGGTCTGTTTGCCATGCGTTG
TCACAGGGCATCGAAGATGGTAACCTTGATGCGATTGACAACACAGATAT
CATGGACACAGATATTCCGTTAGAGGTTCCTCTCCCTGAAACACAATATC
TCAATGGTGTTGGATGGGAAAACATGGCTTTCGTCTTCCTCAACAGATAT
CTGGACTTGAGTGAGGAGGTTCTACATGCCAAGATTTCAGTTTCCTTATT
GAGATATTGTGATCTTATACCGTGCGATAAAGCTTTTTATGAAGCTGGCA
TTCACTGCAAGTGTGATGGGTTCAACAAGAAGCCGACCAACCCTGCAGTC
ATGGATATCTTCAACAGGATGCTTCTCGTGGCTCACTATTACGCCATCCG
GTCTGCTATCACCAAAAACAGCCAATTGAATTTCAACATCTACAAACGTT
TAGTTGAAGATTTATTCGCCAAGCAAGGATTAAGTGGTGAGAATGCATAT
AAAGTATGGGCAGATCTCAGAACAATGCTTTATGATCTGAGTTTCGAAGT
TTTATCAAAGTATGTGGCTTTGTATGCAGCGAATTTGATCAAAGATGGTG
ATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACATGGCGCACCTGCCAAT
CCACAGCTGATCAACGTGGATGTGATCGCAGCACTTGACATGTATGTGGA
GCAAGGCTTGTGGGATAAATGTATCCAAGAAGCTGAGCAACAGGTACGAA
GAACACGTAGAAGAAGAATATGTGAAATATCTCAAGAAGAAGAATAAGAC
TGACGAGGCATCAGATTTGTATCAAGCAGTCAAATTATACCGTGAAGCAA
TAAGTGCATGTGTTAAAGGAGATTTATGGACGCAAGCAAGAAGCATCGCA
AGGGATTACGCTCCAAAAGGTGCAGAAGGTATCATCGCACAAGCTCGTGA
TTGGGAGACTAGGGCCGAGTATAACCGTGCAATCGATCTGTACATGCGCA
TTACACAAGACATGGCAGGGAATAGTGCAGTCATTGAAGAAGTCTATACC
AAAGCTCTTGAACTGGCCATCAAATTCTCAAAAGATCGCGCGCTCAGTGT
TGCCCACGAAGTCTGTAAACGCTTATTGGAAATGCAAGCTTACGAAACTT
TGGCAGCCTTACAAGACGAATACGATCGCATTGCTACTCAGAGTGGTGGT
GATAAGAGTGTCAACGCTGGCCTGATGTACTTCGTATAGCAAAAGAATAT
GTTCCACACCAGGTATATCCACCAATCAGATTGGGACGAAGCAAGAAGAG
TGGCAGAGAGTTACGACCCAGAAAGTCTTGTCGACGTCCTGATTGGTCAA
GCCCGTTTGTCTTTCGAAAAGAAAGATTATACGGAAGGTGAAAGCTTCTT
GTTGAGAGCACAACGTCCAGAATTAGCCATCAAATTTTACAAGATCGTTC
GACTTTGCTTTTGATCTCGCGCGAACGCTTAAGCGGGAGAAGGTGATGGA
AATCCACTTAAAGAAAGCCATGTTTTTGGAAGATGAAGGTCGCTTCAATG
ATGCCGAAGACGAATTCATCAAAGCTGAAAAACCAAAAGAAGCTGTTCTT
ATATCGCCAAACAAAGTGGTACACCAGGCTCGGGCAAACAAGTGGCTTAT
TTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCATCAAGTTGTTGCAAAA
ACTTGGTTTGTTGGAAGCATGTATTGATTATGCTATTGACACAACGAATT
GGAATCAGAAGGGCAATTGAGTACAGCCGAACATCACTATTTGGAAGTGG
GCGATTGGAAAGCCTGTGTCAACATGTATCGAAGCAATGAATTATGGGAA
GATGCGTACAGGTACGACCAAATGATTAAACTGGTGAAAGAATACCACGG
AGACTTGATCACAGATACTCATCTACACCTTGCTAAGGTTATATATCATG
ATCGAAGAAGGTGACCTTGCTATCAATATGTATAAACGAGCAAAGATGCT
CGCAGTACGTTGCATGGATTCCGATGACGTCTCCAAACTATACATTGCAC
AGGCTGAACAGTTAGAAGCACAAGGGAGATTCAAAGAAGCTGAAAAATGG
CCGAACGATTTTATGTTCGAGGTAACATGCCACGTACAGCTGTGGAAATG
TACACCAAAGTCAATAAATACGAAGCCGCTTACAAGGTGTCACACAGTGC
AGATTGTCAAGACGTCTTACGCTTTCTTTCCTTATGGTGTGGAACGTCTG
GAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCCGTTCTTCGAAATAAAA
TGGAATTCAACAAAACGGGCAAAGCTGCCAACAAAGAGGACTGGAACAAG
TTTGCCATGGCAACCAAGGAGGAGCAACGAGAAGAGGTCAAAGAATGGGT
GTTGGCTGTTTCCATGGATCAACGTGTAGAGCAAACTTTAAGTTTTGACG
AACGAAATGTATACGAAGCTTCTTTAACTTCACCGGAGAGTGACGTGGTC
TGTTTGCCATGCGTTGTCACAGGGCATCGAAGATGGTAACCTTGATGCGA
TTGACAACACAGATATCATGGACACAGATATTCCGTTAGAGGTTCCTCTC
CCTGAAACACAATATCTCAATGGTGTTGGATGGGAAAACATGGCTTTCGT
CTTCCTCAACAGATATCTGGACTTGAGTGAGGAGGTTCTACATGCCAAGA
TTTCAGTTTCCTTATTGAGATATTGTGATCTTATACCGTGCGATAAAGCT
TTTTATGAAGCTGGCATTCACTGCAAGTGTGATGGGTTCAACAAGAAGCC
GACCAACCCTGCAGTCATGGATATCTTCAACAGGATGCTTCTCGTGGCTC
ACTATTACGCCATCCGGTCTGCTATCACCAAAAACAGCCAATTGAATTTC
AACATCTACAAACGTTTAGTTGAAGATTTATTCGCCAAGCAAGGATTAAG
TGGTGAGAATGCATATAAAGTATGGGCAGATCTCAGAACAATGCTTTATG
ATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGCTTTGTATGCAGCGAAT
TTGATCAAAGATGGTGATCAAGTGAAAGCCTTGCGTTTGTTCGTCGAACA
TGGCGCACCTGCCAATCCACAGCTGATCAACGTGGATGTGATCGCAGCAC
TTGACATGTATGTGGAGCAAGGCTTGTGGGATAAATGTATCCAAGAAGCT
GAGCAACAGGTACGAAGAACACGTAGAAGAAGAATATGTGAAATATCTCA
AGAAGAAGAATAAGACTGACGAGGCATCAGATTTGTATCAAGCAGTCAAA
TTATACCGTGAAGCAATAAGTGCATGTGTTAAAGGAGATTTATGGACGCA
AGCAAGAAGCATCGCAAGGGATTACGCTCCAAAAGGTGCAGAAGGTATCA
TCGCACAAGCTCGTGATTGGGAGACTAGGGCCGAGTATAACCGTGCAATC
GATCTGTACATGCGCATTACACAAGACATGGCAGGGAATAGTGCAGTCAT
TGAAGAAGTCTATACCAAAGCTCTTGAACTGGCCATCAAATTCTCAAAAG
ATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAAACGCTTATTGGAAATG
CAAGCTTACGAAACTTTGGCAGCCTTACAAGACGAATACGATCGCATTGC
TACTCAGAGTGGTGGTGATAAGAGTGTCAACGCTGGCCTGATGTACTTCG
TATAGCAAAAGAATATGTTCCACACCAGGTATATCCACCAATCAGATTGG
GACGAAGCAAGAAGAGTGGCAGAGAGTTACGACCCAGAAAGTCTTGTCGA
CGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAAAAGAAAGATTATACGG
AAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCCAGAATTAGCCATCAAA
TTTTACAAGATCGTTCGACTTTGCTTTTGATCTCGCGCGAACGCTTAAGC
GGGAGAAGGTGATGGAAATCCACTTAAAGAAAGCCATGTTTTTGGAAGAT
GAAGGTCGCTTCAATGATGCCGAAGACGAATTCATCAAAGCTGAAAAACC
AAAAGAAGCTGTTCTTATATCGCCAAACAAAGTGGTACACCAGGCTCGGG
CAAACAAGTGGCTTATTTATGGGCGAAAAGTCTTGGTGGCGATTCTGCCA
TCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGCATGTATTGATTATGCT
ATTGACACAACGAATTGGAATCAGAAGGGCAATTGAGTACAGCCGAACAT
CACTATTTGGAAGTGGGCGATTGGAAAGCCTGTGTCAACATGTATCGAAG
CAATGAATTATGGGAAGATGCGTACAGGTACGACCAAATGATTAAACTGG
TGAAAGAATACCACGGAGACTTGATCACAGATACTCATCTACACCTTGCT
AAGGTTATATATCATGATCGAAGAAGGTGACCTTGCTATCAATATGTATA
AACGAGCAAAGATGCTCGCAGTACGTTGCATGGATTCCGATGACGTCTCC
AAACTATACATTGCACAGGCTGAACAGTTAGAAGCACAAGGGAGATTCAA
AGAAGCTGAAAAATGGCCGAACGATTTTATGTTCGAGGTAACATGCCACG
TACAGCTGTGGAAATGTACACCAAAGTCAATAAATACGAAGCCGCTTACA
AGGTGTCACACAGTGCAGATTGTCAAGACGTCTTACGCTTTCTTTCCTTA
TGGTGTGGAACGTCTGGAAACCAAGCCTTCTCGTTTGGGTAAGTTATCCC
GTTCTTCGAAATAAAATGGAATTCAACAAAACGGGCAAAGCTGCCAACAA
AGAGGACTGGAACAAGTTTGCCATGGCAACCAAGGAGGAGCAACGAGAAG
AGGTCAAAGAATGGGTGTTGGCTGTTTCCATGGATCAACGTGTAGAGCAA
ACTTTAAGTTTTGACGAACGAAATGTATACGAAGCTTCTTTAACTTCACC
GGAGAGTGACGTGGTCTGTTTGCCATGCGTTGTCACAGGGCATCGAAGAT
GGTAACCTTGATGCGATTGACAACACAGATATCATGGACACAGATATTCC
GTTAGAGGTTCCTCTCCCTGAAACACAATATCTCAATGGTGTTGGATGGG
AAAACATGGCTTTCGTCTTCCTCAACAGATATCTGGACTTGAGTGAGGAG
GTTCTACATGCCAAGATTTCAGTTTCCTTATTGAGATATTGTGATCTTAT
ACCGTGCGATAAAGCTTTTTATGAAGCTGGCATTCACTGCAAGTGTGATG
GGTTCAACAAGAAGCCGACCAACCCTGCAGTCATGGATATCTTCAACAGG
ATGCTTCTCGTGGCTCACTATTACGCCATCCGGTCTGCTATCACCAAAAA
CAGCCAATTGAATTTCAACATCTACAAACGTTTAGTTGAAGATTTATTCG
CCAAGCAAGGATTAAGTGGTGAGAATGCATATAAAGTATGGGCAGATCTC
AGAACAATGCTTTATGATCTGAGTTTCGAAGTTTTATCAAAGTATGTGGC
TTTGTATGCAGCGAATTTGATCAAAGATGGTGATCAAGTGAAAGCCTTGC
GTTTGTTCGTCGAACATGGCGCACCTGCCAATCCACAGCTGATCAACGTG
GATGTGATCGCAGCACTTGACATGTATGTGGAGCAAGGCTTGTGGGATAA
ATGTATCCAAGAAGCTGAGCAACAGGTACGAAGAACACGTAGAAGAAGAA
TATGTGAAATATCTCAAGAAGAAGAATAAGACTGACGAGGCATCAGATTT
GTATCAAGCAGTCAAATTATACCGTGAAGCAATAAGTGCATGTGTTAAAG
GAGATTTATGGACGCAAGCAAGAAGCATCGCAAGGGATTACGCTCCAAAA
GGTGCAGAAGGTATCATCGCACAAGCTCGTGATTGGGAGACTAGGGCCGA
GTATAACCGTGCAATCGATCTGTACATGCGCATTACACAAGACATGGCAG
GGAATAGTGCAGTCATTGAAGAAGTCTATACCAAAGCTCTTGAACTGGCC
ATCAAATTCTCAAAAGATCGCGCGCTCAGTGTTGCCCACGAAGTCTGTAA
ACGCTTATTGGAAATGCAAGCTTACGAAACTTTGGCAGCCTTACAAGACG
AATACGATCGCATTGCTACTCAGAGTGGTGGTGATAAGAGTGTCAACGCT
GGCCTGATGTACTTCGTATAGCAAAAGAATATGTTCCACACCAGGTATAT
CCACCAATCAGATTGGGACGAAGCAAGAAGAGTGGCAGAGAGTTACGACC
CAGAAAGTCTTGTCGACGTCCTGATTGGTCAAGCCCGTTTGTCTTTCGAA
AAGAAAGATTATACGGAAGGTGAAAGCTTCTTGTTGAGAGCACAACGTCC
AGAATTAGCCATCAAATTTTACAAGATCGTTCGACTTTGCTTTTGATCTC
GCGCGAACGCTTAAGCGGGAGAAGGTGATGGAAATCCACTTAAAGAAAGC
CATGTTTTTGGAAGATGAAGGTCGCTTCAATGATGCCGAAGACGAATTCA
TCAAAGCTGAAAAACCAAAAGAAGCTGTTCTTATATCGCCAAACAAAGTG
GTACACCAGGCTCGGGCAAACAAGTGGCTTATTTATGGGCGAAAAGTCTT
GGTGGCGATTCTGCCATCAAGTTGTTGCAAAAACTTGGTTTGTTGGAAGC
ATGTATTGATTATGCTATTGACACAACGAATTGGAATCAGAAGGGCAATT
GAGTACAGCCGAACATCACTATTTGGAAGTGGGCGATTGGAAAGCCTGTG
TCAACATGTATCGAAGCAATGAATTATGGGAAGATGCGTACAGGTACGAC
CAAATGATTAAACTGGTGAAAGAATACCACGGAGACTTGATCACAGATAC
TCATCTACACCTTGCTAAGGTTATATATCATGATCGAAGAAGGTGACCTT
GCTATCAATATGTATAAACGAGCAAAGATGCTCGCAGTACGTTGCATGGA
TTCCGATGACGTCTCCAAACTATACATTGCACAGGCTGAACAGTTAGAAG
CACAAGGGAGATTCAAAGAAGCTGAAAAATGGCCGAACGATTTTATGTTC
GAGGTAACATGCCACGTACAGCTGTGGAAATGTACACCAAAGTCAATAAA
TACGAAGCCGCTTACAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000660XLOC_000660Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001218-proteinTCONS_00001218-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001218-exon-sc0000007-1575043694:1136424..1136644TCONS_00001218-exon-sc0000007-1575043694:1136424..1136644Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1135839..1136038TCONS_00001218-exon-sc0000007-1575043694:1135839..1136038Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1135581..1135676TCONS_00001218-exon-sc0000007-1575043694:1135581..1135676Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1135341..1135389TCONS_00001218-exon-sc0000007-1575043694:1135341..1135389Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1134553..1134642TCONS_00001218-exon-sc0000007-1575043694:1134553..1134642Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1134201..1134298TCONS_00001218-exon-sc0000007-1575043694:1134201..1134298Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1133781..1133841TCONS_00001218-exon-sc0000007-1575043694:1133781..1133841Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1133487..1133561TCONS_00001218-exon-sc0000007-1575043694:1133487..1133561Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1132982..1133098TCONS_00001218-exon-sc0000007-1575043694:1132982..1133098Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1132573..1132715TCONS_00001218-exon-sc0000007-1575043694:1132573..1132715Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1132083..1132241TCONS_00001218-exon-sc0000007-1575043694:1132083..1132241Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1131672..1131852TCONS_00001218-exon-sc0000007-1575043694:1131672..1131852Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1131508..1131564TCONS_00001218-exon-sc0000007-1575043694:1131508..1131564Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1131346..1131401TCONS_00001218-exon-sc0000007-1575043694:1131346..1131401Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1130908..1131139TCONS_00001218-exon-sc0000007-1575043694:1130908..1131139Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1130592..1130701TCONS_00001218-exon-sc0000007-1575043694:1130592..1130701Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1130196..1130259TCONS_00001218-exon-sc0000007-1575043694:1130196..1130259Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1129884..1129970TCONS_00001218-exon-sc0000007-1575043694:1129884..1129970Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1127124..1127240TCONS_00001218-exon-sc0000007-1575043694:1127124..1127240Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1126551..1126661TCONS_00001218-exon-sc0000007-1575043694:1126551..1126661Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1125933..1126049TCONS_00001218-exon-sc0000007-1575043694:1125933..1126049Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1124769..1124864TCONS_00001218-exon-sc0000007-1575043694:1124769..1124864Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1122682..1122741TCONS_00001218-exon-sc0000007-1575043694:1122682..1122741Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1122018..1122116TCONS_00001218-exon-sc0000007-1575043694:1122018..1122116Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1121443..1121596TCONS_00001218-exon-sc0000007-1575043694:1121443..1121596Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1120752..1120843TCONS_00001218-exon-sc0000007-1575043694:1120752..1120843Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1575043694:1119867..1120346TCONS_00001218-exon-sc0000007-1575043694:1119867..1120346Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1136424..1136644TCONS_00001218-exon-sc0000007-1510915933:1136424..1136644Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1135839..1136038TCONS_00001218-exon-sc0000007-1510915933:1135839..1136038Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1135581..1135676TCONS_00001218-exon-sc0000007-1510915933:1135581..1135676Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1135341..1135389TCONS_00001218-exon-sc0000007-1510915933:1135341..1135389Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1134553..1134642TCONS_00001218-exon-sc0000007-1510915933:1134553..1134642Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1134201..1134298TCONS_00001218-exon-sc0000007-1510915933:1134201..1134298Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1133781..1133841TCONS_00001218-exon-sc0000007-1510915933:1133781..1133841Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1133487..1133561TCONS_00001218-exon-sc0000007-1510915933:1133487..1133561Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1132982..1133098TCONS_00001218-exon-sc0000007-1510915933:1132982..1133098Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1132573..1132715TCONS_00001218-exon-sc0000007-1510915933:1132573..1132715Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1132083..1132241TCONS_00001218-exon-sc0000007-1510915933:1132083..1132241Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1131672..1131852TCONS_00001218-exon-sc0000007-1510915933:1131672..1131852Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1131508..1131564TCONS_00001218-exon-sc0000007-1510915933:1131508..1131564Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1131346..1131401TCONS_00001218-exon-sc0000007-1510915933:1131346..1131401Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1130908..1131139TCONS_00001218-exon-sc0000007-1510915933:1130908..1131139Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1130592..1130701TCONS_00001218-exon-sc0000007-1510915933:1130592..1130701Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1130196..1130259TCONS_00001218-exon-sc0000007-1510915933:1130196..1130259Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1129884..1129970TCONS_00001218-exon-sc0000007-1510915933:1129884..1129970Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1127124..1127240TCONS_00001218-exon-sc0000007-1510915933:1127124..1127240Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1126551..1126661TCONS_00001218-exon-sc0000007-1510915933:1126551..1126661Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1125933..1126049TCONS_00001218-exon-sc0000007-1510915933:1125933..1126049Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1124769..1124864TCONS_00001218-exon-sc0000007-1510915933:1124769..1124864Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1122682..1122741TCONS_00001218-exon-sc0000007-1510915933:1122682..1122741Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1122018..1122116TCONS_00001218-exon-sc0000007-1510915933:1122018..1122116Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1121443..1121596TCONS_00001218-exon-sc0000007-1510915933:1121443..1121596Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1120752..1120843TCONS_00001218-exon-sc0000007-1510915933:1120752..1120843Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1510915933:1119867..1120346TCONS_00001218-exon-sc0000007-1510915933:1119867..1120346Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1136424..1136644TCONS_00001218-exon-sc0000007-1491911889:1136424..1136644Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1135839..1136038TCONS_00001218-exon-sc0000007-1491911889:1135839..1136038Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1135581..1135676TCONS_00001218-exon-sc0000007-1491911889:1135581..1135676Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1135341..1135389TCONS_00001218-exon-sc0000007-1491911889:1135341..1135389Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1134553..1134642TCONS_00001218-exon-sc0000007-1491911889:1134553..1134642Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1134201..1134298TCONS_00001218-exon-sc0000007-1491911889:1134201..1134298Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1133781..1133841TCONS_00001218-exon-sc0000007-1491911889:1133781..1133841Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1133487..1133561TCONS_00001218-exon-sc0000007-1491911889:1133487..1133561Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1132982..1133098TCONS_00001218-exon-sc0000007-1491911889:1132982..1133098Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1132573..1132715TCONS_00001218-exon-sc0000007-1491911889:1132573..1132715Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1132083..1132241TCONS_00001218-exon-sc0000007-1491911889:1132083..1132241Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1131672..1131852TCONS_00001218-exon-sc0000007-1491911889:1131672..1131852Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1131508..1131564TCONS_00001218-exon-sc0000007-1491911889:1131508..1131564Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1131346..1131401TCONS_00001218-exon-sc0000007-1491911889:1131346..1131401Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1130908..1131139TCONS_00001218-exon-sc0000007-1491911889:1130908..1131139Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1130592..1130701TCONS_00001218-exon-sc0000007-1491911889:1130592..1130701Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1130196..1130259TCONS_00001218-exon-sc0000007-1491911889:1130196..1130259Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1129884..1129970TCONS_00001218-exon-sc0000007-1491911889:1129884..1129970Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1127124..1127240TCONS_00001218-exon-sc0000007-1491911889:1127124..1127240Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1126551..1126661TCONS_00001218-exon-sc0000007-1491911889:1126551..1126661Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1125933..1126049TCONS_00001218-exon-sc0000007-1491911889:1125933..1126049Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1124769..1124864TCONS_00001218-exon-sc0000007-1491911889:1124769..1124864Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1122682..1122741TCONS_00001218-exon-sc0000007-1491911889:1122682..1122741Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1122018..1122116TCONS_00001218-exon-sc0000007-1491911889:1122018..1122116Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1121443..1121596TCONS_00001218-exon-sc0000007-1491911889:1121443..1121596Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1120752..1120843TCONS_00001218-exon-sc0000007-1491911889:1120752..1120843Clytia hemisphaericaexon
TCONS_00001218-exon-sc0000007-1491911889:1119867..1120346TCONS_00001218-exon-sc0000007-1491911889:1119867..1120346Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1119867..1136644 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
35.8234 30.5557 72.2753 72.8049 30.1867 22.1608 30.8384 34.9204 34.0601 36.8207 30.3385 32.7431 14.7881 15.5331 10.2267 14.0241 11.6699 13.7514 18.9118 20.5948 17.0453 16.1907 15.4804 15.5136 73.2621 58.7205 27.3507 27.3929 12.2504 12.4907
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom
IPR016024ARM-type_fold
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005488 binding
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00001218 vs. Swiss-Prot (Human)
Match: IF172 (Intraflagellar transport protein 172 homolog OS=Homo sapiens GN=IFT172 PE=1 SV=2)

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 525/954 (55.03%), Postives = 719/954 (75.37%), Query Frame = 3
Query:  171 LLERIAAALLKGSFYEKAGELFQRVGSDQRALDAYRKGKAYRRAVELARSSFPREVVKLEEEWGNHLVLHKQLDAAINHFIEAGSSQKAIDAAIQARQWNKAVQIVELQDEDVVEKYYKILAEHYAQVGEYQMAERFYVRGNMPRTAVEMYTKVNKYEAAYKLAVRCMDSDDVSKLYIAQAEQLEAQGRFKEAEKLYIMIEEGDLAINMYKRAKMYDQMIKLVKEYHGDLITDTHLHLAKELESEGQLSTAEHHYLEVGDWKACVNMYRSNELWEDAYRIAKQSGTPGSGKQVAYLWAKSLGGDSAIKLLQKLGLLEACIDYAIDTTSFDFAFDLARTLKREKVMEIHLKKAMFLEDEGRFNDAEDEFIKAEKPKEAVLMYIHQSDWDEARRVAESYDPESLVDVLIGQARLSFEKKDYTEGESFLLRAQRPELAIKFYKECQRWPDVLRIAKEYVPHQLAALQDEYDRIATQSGGDKGAEGIIAQARDWETRAEYNRAIDLYMRITQDMAGNSAVIEEVYTKALELAIKF-SKDRALSVAHEVCKRLLEMQAYETASDLYQAVKLYREAISACVKGDLWTQARSIARDYAPXXXXXXXXXXXXXXXXXNKTDELINVDVIAALDMYVEQGLWDKCIQEAEQQSFEVLSKYVALYAANLIKDGDQVKALRLFVEHGAPANPQNFNIYKRLVEDLFAKQGLSGENAYKVWADLRTMLYDLCDGFNKKP-TNPAVMDIFNRMLLVAHYYAIRSAITKNSQLEVLHAKISVSLLRYCDLIPCDKAFYEAGIHCKGVGWENMAFVFLNRYLDLSEGIEDGNLDAIDNTDIMDTDIPLEVPLPETQYLNEEQREEVKEWVLAVSMDQRVEQTLSFDERNVYEASLTSPESDVVCLPCVVTGYPVLRNKMEFNKTGKAANKEDWNKFAMATKVSHSADCQDVLRFLSLWCGTSGNQAFSF 3026
            L+E I AAL+KG  YE+AG+LF+++ + Q+AL+ YRKG A+ +AVELAR +FP EVVKLEE WG+HLV  KQLDAAINH+IEA  S KAI+AA+ ARQW KA+ I++LQD +   KYY ++A+HYA + EY++AE  Y +G+  + A++MYT+  ++E A+KLA++CM  +DVS LYI QA+++E QG+++EAE+LY+ ++E DLAI MYK+ K+YD MI+LV ++H DL++DTHLHL KELE+EG+L  AE+HYLE  +WKA VNMYR++ LWE+AYR+A+  G   + K VAYLWAKSLGG++A++LL KLGLLEA +D+A D  SF+FAF+L+R   + K  E+HLK AMFLEDEG+F +AE EFI+A KPKEAVLM++H  DW+ A+RVAE++DP+S+ +VL+GQAR + E+KD+ + E  LLRAQRP LA+ +YKE   W D LRI K+YVP QL ALQ+EY+R AT+ G  +G EG + QAR WE   EY+RA+D Y+++    +GNS + E+ + KA EL+IKF    R + V   V  +L+ +  +  A++LY  + L +EAI A ++G+ W +A+ +A++  P+YE++V++ Y ++LK + K D L+ VDVIAALD+YVEQG WDKCI+ A +Q++++L KYVALYA +LI++G   +AL L+V+HGAPANPQNFNIYKR+  D+ +  G +   AY  WADLR +L++LC+   K    N    + F  MLL+AHYYA RSA     QLE + A++SVSLLR+  L+P DKAFYEAGI  K VGW+NMAF+FLNR+LDL++ IE+G LD +D++D  DTDIP EVPLP  Q++ E +REEV++WVL VSMDQR+EQ L  DER  YEASL +  + V  LPC++TGYP+LRNK+EF + GKAANK++WNKF MA K SHS  CQDVL+F+S WCG   + +FSF
Sbjct:  798 LVEHITAALIKGELYERAGDLFEKIHNPQKALECYRKGNAFMKAVELARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTASKYYPLVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVQEPDLAITMYKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRASGLWEEAYRVARTQGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAVDHAADNCSFEFAFELSRLALKHKTPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYEREATKKGA-RGVEGFVEQARHWEQAGEYSRAVDCYLKVRD--SGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGSSAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNRFLDLTDAIEEGTLDGLDHSDFQDTDIPFEVPLPAKQHVPEAEREEVRDWVLTVSMDQRLEQVLPRDERGAYEASLVAASTGVRALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPSTSFSF 1748          
The following BLAST results are available for this feature:
BLAST of TCONS_00001218 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
IF1720.000e+055.03Intraflagellar transport protein 172 homolog OS=Ho... [more]
back to top