Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001214 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001214
Unique NameTCONS_00001214
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2748

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001214 ID=TCONS_00001214|Name=TCONS_00001214|organism=Clytia hemisphaerica|type=transcript|length=2748bp
GAGCttgaaccattgagtttcaagcccgaagggctagaggtcaatctctt
tggtaggatttgaagccaacaaatcctaccaaagttgcgcggccttgagc
gacccgcctggtttttacacaaatgacaggttgaaactaaaatttaacgc
ttaatttcgaaaaatatatcactcgaagacaaaggaattgctagattcaa
tccgtcatcaaaaatacggcgcatattttaaggcttcaatttttcttccc
tgagaaaggttagagattgacctctagcccttcgggcttgaaactcaatg
gcttGAACTACTACACTGAAACGAAATTAATATTTCACTGTCATGACAAC
GGGGCATTTATTTACATTCCCGATATTCTAAATCTCTACTGCGCACGCGC
ATGTTTTgatttgtgcttgattcaaaaTGTCTGACAtcactttgcaaaat
attagaCAAGATGTCATAAAATCTCGCAATTTGTAATGATTTGATGGTAA
TGGAGAAATCACAGTCTAATTGCAAGTGAAGATAACACAGAGATGAACAC
AGATATCGATCAACACATTTTGGTGAGGTATGAAATAAAGAAAAGACTTG
GAAAAGGGGCGTATGGTATTGTTTGGAAAGGTATTGACAGAAAAACTGGT
GAAATAGTTgcattaaaaaagatttttgatgcTTTTCGAAATCAAACGGA
TGCACAGAGAACATTTAGAGAGATATGCTTCTTGCAGGAATTTGGAAGTC
ATGACAATGTTATTAAACTGTTGAATGTGATAAAAGCTGACAATGATAAA
GACATTTACTTGGTGTTCGAATTTATGGACACTGACTTGCATAATGTTAT
CAAGAAAGGCAACATTCTGAAAGATGTGCACAAACGGTACATTATGTATC
AGCTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGTAATCCACAGG
GATCTGAAGCCAAGCAACGTTTTACTGGATAGAGAATGTTTTATTAAAGT
ATGCGACTTTGGACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATG
GGGATCCAAGTTTGACAGATTACGTTGCAACACGTTGGTACCGAGCACCC
GAAATCCTCCTAGCTTCACCAAAATATACGAAAGGAGTGGACATGTGGTC
GATGGGGTGTATCCTGGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTG
GATCCTCAACTCTCAATCAAATCGAACGAATTATGGCCGTTATACCAACC
CCAAGTAGACAAGACATCGATAGTATCAAATCATCATACAGCACCTCACT
ACTCGACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGACCTTTTCC
CGGATGCACCCAATGATGCACTTGATATGGTTCAATCACTTTTACAATTT
AATCCGGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATCCGTACCT
AGCGAAATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTATGACGTAG
TCCCACCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATATCGAACC
AAACTATACGATAGCATCATGCAAAAGAAGTTGGACATTCGAAGGCAGCG
ACGAACGctggaaagtgaagaaaaacctGCCTCAGCTTCAGGCGGGGTGG
GTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGCTCTTGCTAAAGCT
TCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACCACCAAATCTGCACC
AACAAAGAATGCACGTACACCGGCCGATCAACAGACTTACAAATCCAGCC
CTTCCAACATGCGTTCTCGTCCTATCTCATCACAGTATGATAGAAAAGCT
AATAATAATATCCTGACGCGCCCAGATAACAATTTACAGATTACCAGTAC
CTCCAAAgTGGCGCACCAGAGACCAGGACAATATTCTTCTCCGAAGGTTC
AACGAGTGGCCGGCAAAAAGCCCTCTTCAACGCAGGCAACGTCAGGTCTA
ACCATGTCAAGTTACACGCAAAGTCACGCCTCTGTCAGTAAAAGTACACT
GGATGCAATCCATGGACTGTCAATCAAATAGGGCTGTTGAAATAATGACA
AACAATCTATTATAATGCACTTATTGAAATGAAACGGAAAAAAGTTTCCC
CGAAAAGTCAATGAGTACGAGAATATTTAGTCCGCACTTTATTGTCAGAA
CCNCTTCTTCCGAAAAGTCAATGAGTACGAGAATATTAAGTCCACCCTTT
ATTGTCAGAACCTTAAAATTGACGATTCTTCGTAAGATTCTTAGTTTTct
ttgaaacatttttgtaaaGTCTTTATCTGCGACATTTTACTTCGAATTTA
GTCTTTTTCAACCAGAGTTAGGGTCTTGACTTAAAATGATTTTAACAGAA
AATAAAGgggagaaaattgaaaatatttaagttaAATTATACTCagtaga
gaaatctattttgatgtttttgtgtAAATGCGCGTATTGTATcataaatt
ttttgtcaattttttagaTGTAATATTACATTAGtagagaaatttttatt
tcatggcttttaattcaattttttaagaaagtcTTCGAAGACAAACATTT
CAGTCGAATTTCCACACGTACAACGTTTCAAGGTCTCATTGATGGAGGTC
CCTGAAACTCAATTTTTAGATGTTGTTAGAAATCAAAATGTATAGAAAGT
TTTTGTACATGCATTTTAATTTTATGCTCAAGAAATACAAActtcaaa
Run BLAST on NCBI

protein sequence of TCONS_00001214-protein

>TCONS_00001214-protein ID=TCONS_00001214-protein|Name=TCONS_00001214-protein|organism=Clytia hemisphaerica|type=polypeptide|length=512bp
MNTDIDQHILVRYEIKKRLGKGAYGIVWKGIDRKTGEIVALKKIFDAFRN
QTDAQRTFREICFLQEFGSHDNVIKLLNVIKADNDKDIYLVFEFMDTDLH
NVIKKGNILKDVHKRYIMYQLMKAINFIHSGNVIHRDLKPSNVLLDRECF
IKVCDFGLARSVQCLTLEHGDPSLTDYVATRWYRAPEILLASPKYTKGVD
MWSMGCILGEMLLGKPLFPGSSTLNQIERIMAVIPTPSRQDIDSIKSSYS
TSLLDKATMRSRKNLPDLFPDAPNDALDMVQSLLQFNPDKRMTAEEALAH
PYLAKFHNPAEEHSLTYDVVPPVDDDVQLSVAEYRTKLYDSIMQKKLDIR
RQRRTLESEEKPASASGGVGSPKVGAVRSQAALAKASSSSPSHKAVRTTK
SAPTKNARTPADQQTYKSSPSNMRSRPISSQYDRKANNNILTRPDNNLQI
TSTSKVAHQRPGQYSSPKVQRVAGKKPSSTQATSGLTMSSYTQSHASVSK
STLDAIHGLSIK
Run BLAST on NCBI

transcript from alignment at sc0000007:1086988..1097129-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001214 ID=TCONS_00001214|Name=TCONS_00001214|organism=Clytia hemisphaerica|type=transcript|length=10142bp|location=Sequence derived from alignment at sc0000007:1086988..1097129- (Clytia hemisphaerica)
GAGCTTGAACCATTGAGTTTCAAGCCCGAAGGGCTAGAGGTCAATCTCTT TGGTAGGATTTGAAGCCAACAAATCCTACCAAAGTTGCGCGGCCTTGAGC GACCCGCCTGGTTTTTACACAAATGACAGGTTGAAACTAAAATTTAACGC TTAATTTCGAAAAATATATCACTCGAAGACAAAGGAATTGCTAGATTCAA TCCGTCATCAAAAATACGGCGCATATTTTAAGGCTTCAATTTTTCTTCCC TGAGAAAGGTTAGAGATTGACCTCTAGCCCTTCGGGCTTGAAACTCAATG GCTTGAACTACTACACTGAAACGAAATTAATATTTCACTGTCATGACAAC GGGGCATTTATTTACATTCCCGATATTCTAAATCTCTACTGCGCACGCGC ATGTTTTGATTTGTGCTTGATTCAAAATGTCTGACATCACTTTGCAAAAT ATTAGACAAGATGTCATAAAATCTCGCAATTTGTAATGATTTGATGGTAA TGGAGAAATCACAGTCTAATTGCAAGTGAAGATAACACAGAGATGAACAC AGATATCGATCAACACATTTTGGTGAGGTATGAAATAAAGAAAAGACTTG GAAAAGGGGTACGTTTTTCTCTGCTGAAGCCTTCATATTTACCTTTTTTT TCTAGCTTTGTTTATCTTTGATCTTGTATTGAATTTTAGGACACCAAACT TTTTTCTCGTTTGTTTTCACGAAGTTATTTCTTTTTCTTTCTGACTGATC ATTACCGTAAGTTGGTCTAATATCGACATCCCTCGTCTAATTCCGACACC CTTCTTTAGTTTAGAGACAGGAATTATATGAAAGCTTGAATCACTGCATT GCTGATTGAAAAAGGATTATTCCTCTCTGACCCACTAAGCAAGGAAAAAC AGTTTCAACCTTTCAATCAATTTCAGCTGATAAATAGGGTGTCAGAATTA GAGGAGGGGTGTCGACATTAGACCAAGTTACGGTATATTTTTGTTGTGTT ACTTTTGACAGTAAGGTGATTTCCAGACAATATCTGGTCCTTTAAATGTT TATCAGTAAGACCTTCTGAGTAAGCTGGTTAAAAAAATAACTCTAACTAC ATTGTAGACCAGTAATTTTGTGAGCGTAGTGCAAGAATGACTTTGAGCAG GAGGTTTGGGGGAATTTTAAGGCCTAACAAGTGGGAGTTCAGGGCCCAGC GCAGCGCTCTCTTACAAAATTTTGGAGTCTGAAATGACCCTAAACTTTGC TAAACACCTGTTTTGATTTAATGAAAAACAACTAAAGAAATGTAAAAATA CTTAAAAAGCCTATAAAGCCTACCGTGAAGTCGGGTAACATGTTAGCCTC CACTGATGCAAGTTGGTATAGCCTTCAAGTTTTACCCTGACCAAGTTAAA AGTACCGTAAGTTAGTCTAATTTCAACATCCTTTTTTAGAGATAGGAATG ATAGAAAAGTTGGGATCAATGATGACTCCTCAACTGATTGCTAAGCAAAG AAAATTAGTTTAATCAGCGATTTCGGACCATCCTATCATTCCTATCTCTA AAGAAGGGTGACAAAATTAGAAGAGGGATGTCAACATTAGACCAACTTAC GGTAAGCTTCAGAATGACCAGCGGCTATTTACTTCAGGCGGGGATGGTAC AAAGTTAAGCTATGGTAAACTTGAATCGCTCAATAATCGCACAGAAATCA CCCCCGTGTAAAGCTAACAGATCTGAAAATACGACGCTAGATTTTAGATG CAGATATCTGTGTTGTAGAGCGCGAGTGAGCGCGTGTACACTGGCGCGTG TTTAACTATAGAATTTATTTCATATTTCAATTTAAAAGCCTACTCGGTGC GGAAGAGAAATCGTGTATTTTTTAATACGCGGTTCATTAACTCAAATCAA ATGACTTTGGAGGTTCAGTGAAATGGTGGCTGAATTGCCATCCCATGTTT TGTCAGATAGTCCCAAGTTAGAGCAGTTGACGGTAATAGAAAACCAGAAT GCGGATCTTCTATAAATATTAACTATAGTAATGAAAACTGTAATGTGCAC TCTCAAACATCAATTGATGACAGATGGTACAAAATTTAATAAAGGAACTG TCATTATTTGATAATCGAACAGAAGATTTTCTGTCAAGAATCTTGTAAAC ATTCAAACAAATTCCATAAAGATTATCTGTTGTAGCTAAATCAAAATGCT ACCATTTAACAAACATACCAGGTGCGCCACAAAAAATTTTCTCTCTTTGA AACTAATTTTCAAGAAATCTAAAAATTTTAAAAGAGCCATTCCTATTTCA TTGGAAAGAAGAAAGATAAACATAAATTTTGATGGGTCATTTATTAAATT CGATTCACTAGATCAAAAGTTATGCTCAATTGAATGAAAAACTTACTTTC GGGATGTGCTCAAAAACGTTGAAAATCGACTTATCAAATTAAACAGAAGC ATAATTACATGATACATCAGTACTTTCGTTTCAGTCATTAAAAATGATAA TAAGCTGTCTAAATGACCTTTTGTTATNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNAAATTTGGCAAATTTTTAGCAGGGGACC ACCCTTTTTTGCAGTTAGTACATCTGAGTACTAAGTGATTTTATCCAATT CATATGGCACACCACCACGGTACTAATTGGCATGATGTCTTGTACTAACT GCTTCACCCCCCCTGGTTTTAAGGTAGATCCAGTCTTACTTAGACTTCAT CCAGTCGAGAACCAAAAATCTGAGGAAAATTTCGGTAAAAGTAAATTAAA TTGATTTTGATGAAGATTTTAAACAGTTTTAAACCCTTTCGACCCTTCAG TTTCAAAATTTATGTGTTTATTTACTGAGAAATGCTCTTAATCATGTAAA GGCTATTGCGATTGCCAGATTTAAAATAAAAAATTGATAGGTCGATTTTT AACATTTTCTTATCCAATTGAGCATAACTTTTGATCTAATGAATCAAATT TAATAAATGACCCATGAAAATTTAAGTCTATCTTTCTTCTTTCCAATGAA ATAGGAATGGCTCTTTTGAAAGTTTTAGATTTTGAGAAAATTAGTTTTAA AGAGAGAAACTTTTTTGTGGCGCACCCGGTATGCGCNATTTAATAAATGA CCCATGAAAGTTTAAGTCTATCTTTCTTCTTTCCAATGAAATAGGAATGG CTCTTTTGAAAGTTTTAGATTTTGAGAAAATTAGTTTTAAAGAGAGAAAC TTTTTTGTGGCGCACCCGGTATGCGCTGTTCCAGGATTGATCCCATTAAA TAAAGCCACACCCACAAAAACACCAGCAAACAGCCTTAAAGGTTGACAAA TTTTAATCTGTCAATCAATTTCTCAAGTAAAGAGTACACAGATTAAACAA ATAATATGATAACAATAAGGTTTTAATACAGAAATACCAAATTAAATTGG ACATCTAAAATGCTATTCACAATTTTAAAATGCCCATTCACAGAGTTTTT TAGCTGCTAACTAAGAAAACAAAAGAGCCATCTGGGTGGATTTCCCTTTA ACGTTAAAAGCTATGAACTTTGAACAAATCGTGAACATACTAAGGACACT TGTGTTGATTTCCAATTTTGTCAATGTTTTGCAAATAGAACAAAGGTAAC AATTGTAATTGATATTTATTCGCATCTATCTCATATATTTGGTTGATTTA CAGCAGGTTGTTCAGCCTATCCTCACAGCTGCTAGTACAATTAAGTCATG TAAGCAAATGCTTAATAAACATTGCAATTTTTAATTTCTTAGCAATAAAC CTTGGATATTTGGCAAAAGTAAAACTGAGCTTTATTTAGCTGCAACAATA AATTCTCTAATTCCTGTCATAGTGTCAAATATATTTAGCAGATTAGTGCG CCTCATTAAAAAATTTTCTGTCTTGTCTTCTGCATGGCATAATATCCGAG TCTCAAAATTAAAAAAAAAATTACCTCAGCCATATAATAATGTAAAATTA CACATCTTGATGTACCCAAACAATTTTGTATCCCTTTGATTTGAAAGGGG GAATTCACTGTATGTTTCCTCTCTTGAAACCACTAAGATTATTGGCAAAA TTTTAAACTTTAAGTTGTGAAAAAATGGCCATCATGTTTTCACATTTTTT AAATCCTCCAGCGGACCTGATAGTATTGGATTCATTTTTTGATAAATCTA ATAATTTCCTGAAATTACCTTTATCTTGTTTGTTGACTGATAGCATTTTT TATTTTGTTTGTAATAATGTATTTTTTACATTCAAAGCACATTAACTTGT ATACACAAATAACCCCATAAAGAACTTGTTTAGAATTTACCAGGAAGGTA TGACGTCAAATGTCTATATCTGTAAGAAAATCCATACAACTACTTCAGGC ATTCAATCTCAATCCTTCCTGGTAATCTCAGTCTGTCTGGTCGTTGATGT TCACCAATTTGTTACAATTCTTTTTCAGGCGTATGGTATTGTTTGGAAAG GTATTGACAGAAAAACTGGTGAAATAGTTGCATTAAAAAAGATTTTTGAT GCTTTTCGAAATCAAACGGATGCACAGGTTCGTTTTACTTTTCATCTTCT GCATATTCTGTATTTTATTAGGCTGTTAATTCTGAAGGTATCCAAGTAAT TGGCACCAGCTTTATTTTGTTTCAATCCTATTTCACAGTTCTGTCATTGT TTTCTTTTCACAGAGAACATTTAGAGAGATATGCTTCTTGCAGGTAAGTT AATTTCTATTTCTATTTCATAATTAGTAGCTTTTCTGCATTTTGAAACAT ATGTAGTTAGTAGTATTTTTAATTTGTTGTTGAATCTTTTTTCAAAACCA TCATCACGATCGAATTGTGGTATATATCAAACTTCATTACATGCATTACA TTACATTACATTTACTTGGATGTCTAGAAGATTTGCTCGATATTGCTACT CAATATTAAAACATTGTTGTTCTGTTTAGGAATTTGGAAGTCATGACAAT GTTATTAAACTGTTGAATGTGATAAAAGCTGACAATGATAAAGACATTTA CTTGGTGTTCGAATTTATGGGTAAGTGCTTTCATTGATTATCAATAATTT TATCAATCGACCATGTATATTTTTTGTTTTGATAAATTTGGCCCTGTATG AAATTTGGTTTTTGATATTTTTAATTTTTCATTTCTCAGACACTGACTTG CATAATGTTATCAAGAAAGGCAACATTCTGAAAGATGTGCACAAACGGTA CATTATGTATCAGGTATGTAAATCTCATCTGAACGTTTCCAAAATATAAG GGAAGGACATGTTATTAATGGGATCTCAATCTTATACAAGTCATGTTTCA AAATGATGGGTTTATGTTCATGTTTATGTTCATGTTTTATGCTCATTTTT TCTAGCTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGTAATCCAC AGGGATCTGAAGGTATACTTTTTTCTAAGGTCTTTTCGCATTTTTCCTGT CGGTTTCTTTTAAATGTGTATAATAAAAAAATGATTTTTCAATTATTTAT CTGATTCAACAAACTATCAATAAAATATGACGTCAATTGATCAATTTTGC AAGTATTTTTCTCACATACAAAAATGTACTGAATAGTCGATTGAGTGGAA ATAAACCGTACTGTTTATTTATTTATTTACTTTCAGCCAAGCAACGTTTT ACTGGATAGAGAATGTTTTATTAAAGTAAGAGCAAATTTTTTTATTCCAT TCAATTCAAACCCAACTCTTCCTTGTTGCAAACTTCTGCAAAAATTCCAT GATCTGTAAATATTTTTTAAAAACAAAGTCATAGAGTGTAAGAATTACAC TTTTTGTGACGGATTTCCCTAAAGTTCCTTGAAATTCTTATCGGAAGNCT TAAAAACAAGAGTGTAAGAATTACACTTTTTGTGACGGATTTCCCTAAAG TTCCTTGAAATTCTTTTCGGAAGAAATATCTGAAACGTTTCCATTTCTTT AAAAATGAAAATAACATTGGGGCGTGACCCCCTTCCGATTAGTGCTATAC TTAGCACAACAAAAATGCCCCTAGGTTTCTCACGCTTCACCCCAAGTTTT AGGCTGCCTAGGTTCTTCGCCTTGTCTATTTAAGTGATTGAAACTCGCAC ATCCTTTCCTACACACTTTATTAACATTTTATTCTGTTAAAGGTATGCGA CTTTGGACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATGGGGATC CAAGTTTGACAGATTACGTTGCAACACGTTGGTACCGAGCACCCGAAATC CTCCTAGCTTCACCAAAGTAAGGGGATCTATTTCACCCAAAGTCATTAGT TTACTATCTTGACTGAAACCTATGAGGTTAACTAACTAACTAACAAGACC CTTTTTGGAAATATTTATGTATAAAATGTTGTAAAAATGCAATTGTTTTG AACTAATAAGACTGATGAGTTTGCTTCAAAATGTGTTTAGAAGGTTGCAG AAATCAGCAGAAATAGGTAAAAATTGCTGATATTGAAAGGGCCCACCATG ATAGTTGGGAAGAGCAATCAAATATCACCAAAATATTATAATTTCTCTTA TTATCGTCTAGATATACGAAAGGAGTGGACATGTGGTCGATGGGGTGTAT CCTGGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTGGATCCTCAACTC TCAATCAAATCGAACGAATTATGGCCGTTATACCAACCCCAAGTAGACAA GGTTGGTATTTCCTTTGATATCATTTGTATCTGGTAGTTTATAAACTTAG AAAGTTTACATGTTGTATAGTGTATGTAGCACTGAGCTCAAAGACTGAAA TACTCTCAATTCCATTGATCAATAGTTTTTAATAGAGATTATAATGCAAC ATTTATCTCCCTTTAGACATCGATAGTATCAAATCATCATACAGCACCTC ACTACTCGACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGACCTTT TCCCGGATGCACCCAATGATGCACTTGATATGGTTCAATCACTTTTACAA TTTAATCCGGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATCCGTA CCTAGCGAAATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTATGACG TAGTCCCACCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATATCGA ACCAAACTATACGATGTATGTATGATTATGTTGTTTCTAAAACTATGAGA AATTTTGAGTTTGCCAGAATAATTTACTAATAAAAGTGAAGACAAGAAAC TTAATTCTATTCATCTTGGCTTTTTGATGATTTCGATTTTGCTTTTAGAA AAGATGAGTTGAGTTTGAGCAAGTTTCGAATCTCCATAAAGTAAATAATT CACACAACTCTTGTCTATTTTCAGAGCATCATGCAAAAGAAGTTGGACAT TCGAAGGCAGCGACGAACGCTGGAAAGTGAAGAAAAACCTGCCTCAGCTT CAGGCGGGGTGGGTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGCT CTTGCTAAAGCTTCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACCAC CAAATCTGCACCAACAAAGAATGCACGTACACCGGCCGATCAACAGGTAT TTATGGTCTTCCTCTAAAACCTTGAATTCAATGCACTTTCAACATTTAAN GCCGAGTCATAAAGCTGTTCGAACCACCAAATCTGCACCAACAAAGAATG CACGTACACCGGCCGATCAACAGGTATTTATGGTCTTCCTCTAAAACCTT GAATTCAATGCACTTTCAACATTTAATGATCCATCACCATCAGACATCCA TACATGATTACTGTTCACAACCTCATACATTCCACCTTTTCCGTCCACAC ACATTTCTAATAAAATTGACCCTTCTCTCTTTTCCTTTTGTAGACTTACA AATCCAGCCCTTCCAACATGCGTTCTCGTCCTATCTCATCACAGTATGAT AGAAAAGCTAATAATAATATCCTGACGCGCCCAGATAACAATTTACAGAT TACCAGTACCTCCAAAGTAAGACATTTTTTGTAATTCCTTCCCTTTCACA ACCCTTGTTCCAATTCACCCATCCTCCCCATGTCATCGACAATGTTTTAT GACGGCTGACACTTATGTGTAAAGGAAAGACCAGAACAATTTGCCATCCT TTTGTTTAATGGATTCATCAAACTCCTCAAAGCCTCTTTTCATAATTCTT GCAAGTCAGTTTTCCATGGTATAAGGCTCTAACAGTCAGTATGGATTTAC TCATTCGAGTGTGAAACTTTTCGATCTGAATAACTTTTTTGTTTTCATTA GGTGGCGCACCAGAGACCAGGACAATATTCTTCTCCGAAGGTTCAACGAG TGGCCGGCAAAAAGCCCTCTTCAACGCAGGCAACGTCAGGTCTAACCATG TCAAGTTACACGCAAAGTCACGCCTCTGTCAGTAAAAGTACACTGGATGC AATCCATGGACTGTCAATCAAATAGGGCTGTTGAAATAATGACAAACAAT CTATTATAATGCACTTATTGAAATGAAACGGAAAAAAGTTTCCCCGAAAA GTCAATGAGTACGAGAATATTTAGTCCGCACTTTATTGTCAGAACCNCTT CTTCCGAAAAGTCAATGAGTACGAGAATATTAAGTCCACCCTTTATTGTC AGAACCTTAAAATTGACGATTCTTCGTAAGATTCTTAGTTTTCTTTGAAA CATTTTTGTAAAGTCTTTATCTGCGACATTTTACTTCGAATTTAGTCTTT TTCAACCAGAGTTAGGGTCTTGACTTAAAATGATTTTAACAGAAAATAAA GGGGAGAAAATTGAAAATATTTAAGTTAAATTATACTCAGTAGAGAAATC TATTTTGATGTTTTTGTGTAAATGCGCGTATTGTATCATAAATTTTTTGT CAATTTTTTAGATGTAATATTACATTAGTAGAGAAATTTTTATTTCATGG CTTTTAATTCAATTTTTTAAGAAAGTCTTCGAAGACAAACATTTCAGTCG AATTTCCACACGTACAACGTTTCAAGGTCTCATTGATGGAGGTCCCTGAA ACTCAATTTTTAGATGTTGTTAGAAATCAAAATGTATAGAAAGTTTTTGT ACATGCATTTTAATTTTATGCTCAAGAAATACAAACTTCAAA

Coding sequence (CDS) from alignment at sc0000007:1086988..1097129-

>TCONS_00001214 ID=TCONS_00001214|Name=TCONS_00001214|organism=Clytia hemisphaerica|type=CDS|length=20007bp|location=Sequence derived from alignment at sc0000007:1086988..1097129- (Clytia hemisphaerica)
GTGGCGCACCAGAGACCAGGACAATATTCTTCTCCGAAGGTTCAACGAGT
GGCCGGCAAAAAGCCCTCTTCAACGCAGGCAACGTCAGGTCTAACCATGT
CAAGTTACACGCAAAGTCACGCCTCTGTCAGTAAAAGTACACTGGATGCA
ATCCATGGACTGTCAATCAAATAGACTTACAAATCCAGCCCTTCCAACAT
GCGTTCTCGTCCTATCTCATCACAGTATGATAGAAAAGCTAATAATAATA
TCCTGACGCGCCCAGATAACAATTTACAGATTACCAGTACCTCCAAAAGC
ATCATGCAAAAGAAGTTGGACATTCGAAGGCAGCGACGAACGCTGGAAAG
TGAAGAAAAACCTGCCTCAGCTTCAGGCGGGGTGGGTTCACCAAAGGTTG
GTGCGGTCCGCTCACAAGCCGCTCTTGCTAAAGCTTCGTCCTCCTCACCG
AGTCATAAAGCTGTTCGGACCACCAAATCTGCACCAACAAAGAATGCACG
TACACCGGCCGATCAACAGACATCGATAGTATCAAATCATCATACAGCAC
CTCACTACTCGACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGACC
TTTTCCCGGATGCACCCAATGATGCACTTGATATGGTTCAATCACTTTTA
CAATTTAATCCGGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATCC
GTACCTAGCGAAATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTATG
ACGTAGTCCCACCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATAT
CGAACCAAACTATACGATATATACGAAAGGAGTGGACATGTGGTCGATGG
GGTGTATCCTGGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTGGATCC
TCAACTCTCAATCAAATCGAACGAATTATGGCCGTTATACCAACCCCAAG
TAGACAAGGTATGCGACTTTGGACTTGCGCGTTCTGTACAATGTTTAACC
CTGGAACATGGGGATCCAAGTTTGACAGATTACGTTGCAACACGTTGGTA
CCGAGCACCCGAAATCCTCCTAGCTTCACCAAACCAAGCAACGTTTTACT
GGATAGAGAATGTTTTATTAAACTAATGAAAGCAATCAATTTCATTCACT
CTGGCAATGTAATCCACAGGGATCTGAAGACACTGACTTGCATAATGTTA
TCAAGAAAGGCAACATTCTGAAAGATGTGCACAAACGGTACATTATGTAT
CAGGAATTTGGAAGTCATGACAATGTTATTAAACTGTTGAATGTGATAAA
AGCTGACAATGATAAAGACATTTACTTGGTGTTCGAATTTATGGAGAACA
TTTAGAGAGATATGCTTCTTGCAGGCGTATGGTATTGTTTGGAAAGGTAT
TGACAGAAAAACTGGTGAAATAGTTGCATTAAAAAAGATTTTTGATGCTT
TTCGAAATCAAACGGATGCACAGATGAACACAGATATCGATCAACACATT
TTGGTGAGGTATGAAATAAAGAAAAGACTTGGAAAAGGGGTGGCGCACCA
GAGACCAGGACAATATTCTTCTCCGAAGGTTCAACGAGTGGCCGGCAAAA
AGCCCTCTTCAACGCAGGCAACGTCAGGTCTAACCATGTCAAGTTACACG
CAAAGTCACGCCTCTGTCAGTAAAAGTACACTGGATGCAATCCATGGACT
GTCAATCAAATAGACTTACAAATCCAGCCCTTCCAACATGCGTTCTCGTC
CTATCTCATCACAGTATGATAGAAAAGCTAATAATAATATCCTGACGCGC
CCAGATAACAATTTACAGATTACCAGTACCTCCAAAAGCATCATGCAAAA
GAAGTTGGACATTCGAAGGCAGCGACGAACGCTGGAAAGTGAAGAAAAAC
CTGCCTCAGCTTCAGGCGGGGTGGGTTCACCAAAGGTTGGTGCGGTCCGC
TCACAAGCCGCTCTTGCTAAAGCTTCGTCCTCCTCACCGAGTCATAAAGC
TGTTCGGACCACCAAATCTGCACCAACAAAGAATGCACGTACACCGGCCG
ATCAACAGACATCGATAGTATCAAATCATCATACAGCACCTCACTACTCG
ACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGACCTTTTCCCGGAT
GCACCCAATGATGCACTTGATATGGTTCAATCACTTTTACAATTTAATCC
GGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATCCGTACCTAGCGA
AATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTATGACGTAGTCCCA
CCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATATCGAACCAAACT
ATACGATATATACGAAAGGAGTGGACATGTGGTCGATGGGGTGTATCCTG
GGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTGGATCCTCAACTCTCAA
TCAAATCGAACGAATTATGGCCGTTATACCAACCCCAAGTAGACAAGGTA
TGCGACTTTGGACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATGG
GGATCCAAGTTTGACAGATTACGTTGCAACACGTTGGTACCGAGCACCCG
AAATCCTCCTAGCTTCACCAAACCAAGCAACGTTTTACTGGATAGAGAAT
GTTTTATTAAACTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGTA
ATCCACAGGGATCTGAAGACACTGACTTGCATAATGTTATCAAGAAAGGC
AACATTCTGAAAGATGTGCACAAACGGTACATTATGTATCAGGAATTTGG
AAGTCATGACAATGTTATTAAACTGTTGAATGTGATAAAAGCTGACAATG
ATAAAGACATTTACTTGGTGTTCGAATTTATGGAGAACATTTAGAGAGAT
ATGCTTCTTGCAGGCGTATGGTATTGTTTGGAAAGGTATTGACAGAAAAA
CTGGTGAAATAGTTGCATTAAAAAAGATTTTTGATGCTTTTCGAAATCAA
ACGGATGCACAGATGAACACAGATATCGATCAACACATTTTGGTGAGGTA
TGAAATAAAGAAAAGACTTGGAAAAGGGGTGGCGCACCAGAGACCAGGAC
AATATTCTTCTCCGAAGGTTCAACGAGTGGCCGGCAAAAAGCCCTCTTCA
ACGCAGGCAACGTCAGGTCTAACCATGTCAAGTTACACGCAAAGTCACGC
CTCTGTCAGTAAAAGTACACTGGATGCAATCCATGGACTGTCAATCAAAT
AGACTTACAAATCCAGCCCTTCCAACATGCGTTCTCGTCCTATCTCATCA
CAGTATGATAGAAAAGCTAATAATAATATCCTGACGCGCCCAGATAACAA
TTTACAGATTACCAGTACCTCCAAAAGCATCATGCAAAAGAAGTTGGACA
TTCGAAGGCAGCGACGAACGCTGGAAAGTGAAGAAAAACCTGCCTCAGCT
TCAGGCGGGGTGGGTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGC
TCTTGCTAAAGCTTCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACCA
CCAAATCTGCACCAACAAAGAATGCACGTACACCGGCCGATCAACAGACA
TCGATAGTATCAAATCATCATACAGCACCTCACTACTCGACAAAGCAACC
ATGAGATCGCGTAAAAATCTACCGGACCTTTTCCCGGATGCACCCAATGA
TGCACTTGATATGGTTCAATCACTTTTACAATTTAATCCGGACAAACGAA
TGACAGCGGAAGAAGCTTTAGCACATCCGTACCTAGCGAAATTCCATAAC
CCTGCAGAAGAGCATAGTCTGACGTATGACGTAGTCCCACCAGTTGATGA
CGATGTTCAACTGTCTGTCGCTGAATATCGAACCAAACTATACGATATAT
ACGAAAGGAGTGGACATGTGGTCGATGGGGTGTATCCTGGGTGAAATGTT
GCTCGGGAAACCCCTCTTCCCTGGATCCTCAACTCTCAATCAAATCGAAC
GAATTATGGCCGTTATACCAACCCCAAGTAGACAAGGTATGCGACTTTGG
ACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATGGGGATCCAAGTT
TGACAGATTACGTTGCAACACGTTGGTACCGAGCACCCGAAATCCTCCTA
GCTTCACCAAACCAAGCAACGTTTTACTGGATAGAGAATGTTTTATTAAA
CTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGTAATCCACAGGGA
TCTGAAGACACTGACTTGCATAATGTTATCAAGAAAGGCAACATTCTGAA
AGATGTGCACAAACGGTACATTATGTATCAGGAATTTGGAAGTCATGACA
ATGTTATTAAACTGTTGAATGTGATAAAAGCTGACAATGATAAAGACATT
TACTTGGTGTTCGAATTTATGGAGAACATTTAGAGAGATATGCTTCTTGC
AGGCGTATGGTATTGTTTGGAAAGGTATTGACAGAAAAACTGGTGAAATA
GTTGCATTAAAAAAGATTTTTGATGCTTTTCGAAATCAAACGGATGCACA
GATGAACACAGATATCGATCAACACATTTTGGTGAGGTATGAAATAAAGA
AAAGACTTGGAAAAGGGGTGGCGCACCAGAGACCAGGACAATATTCTTCT
CCGAAGGTTCAACGAGTGGCCGGCAAAAAGCCCTCTTCAACGCAGGCAAC
GTCAGGTCTAACCATGTCAAGTTACACGCAAAGTCACGCCTCTGTCAGTA
AAAGTACACTGGATGCAATCCATGGACTGTCAATCAAATAGACTTACAAA
TCCAGCCCTTCCAACATGCGTTCTCGTCCTATCTCATCACAGTATGATAG
AAAAGCTAATAATAATATCCTGACGCGCCCAGATAACAATTTACAGATTA
CCAGTACCTCCAAAAGCATCATGCAAAAGAAGTTGGACATTCGAAGGCAG
CGACGAACGCTGGAAAGTGAAGAAAAACCTGCCTCAGCTTCAGGCGGGGT
GGGTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGCTCTTGCTAAAG
CTTCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACCACCAAATCTGCA
CCAACAAAGAATGCACGTACACCGGCCGATCAACAGACATCGATAGTATC
AAATCATCATACAGCACCTCACTACTCGACAAAGCAACCATGAGATCGCG
TAAAAATCTACCGGACCTTTTCCCGGATGCACCCAATGATGCACTTGATA
TGGTTCAATCACTTTTACAATTTAATCCGGACAAACGAATGACAGCGGAA
GAAGCTTTAGCACATCCGTACCTAGCGAAATTCCATAACCCTGCAGAAGA
GCATAGTCTGACGTATGACGTAGTCCCACCAGTTGATGACGATGTTCAAC
TGTCTGTCGCTGAATATCGAACCAAACTATACGATATATACGAAAGGAGT
GGACATGTGGTCGATGGGGTGTATCCTGGGTGAAATGTTGCTCGGGAAAC
CCCTCTTCCCTGGATCCTCAACTCTCAATCAAATCGAACGAATTATGGCC
GTTATACCAACCCCAAGTAGACAAGGTATGCGACTTTGGACTTGCGCGTT
CTGTACAATGTTTAACCCTGGAACATGGGGATCCAAGTTTGACAGATTAC
GTTGCAACACGTTGGTACCGAGCACCCGAAATCCTCCTAGCTTCACCAAA
CCAAGCAACGTTTTACTGGATAGAGAATGTTTTATTAAACTAATGAAAGC
AATCAATTTCATTCACTCTGGCAATGTAATCCACAGGGATCTGAAGACAC
TGACTTGCATAATGTTATCAAGAAAGGCAACATTCTGAAAGATGTGCACA
AACGGTACATTATGTATCAGGAATTTGGAAGTCATGACAATGTTATTAAA
CTGTTGAATGTGATAAAAGCTGACAATGATAAAGACATTTACTTGGTGTT
CGAATTTATGGAGAACATTTAGAGAGATATGCTTCTTGCAGGCGTATGGT
ATTGTTTGGAAAGGTATTGACAGAAAAACTGGTGAAATAGTTGCATTAAA
AAAGATTTTTGATGCTTTTCGAAATCAAACGGATGCACAGATGAACACAG
ATATCGATCAACACATTTTGGTGAGGTATGAAATAAAGAAAAGACTTGGA
AAAGGGGTGGCGCACCAGAGACCAGGACAATATTCTTCTCCGAAGGTTCA
ACGAGTGGCCGGCAAAAAGCCCTCTTCAACGCAGGCAACGTCAGGTCTAA
CCATGTCAAGTTACACGCAAAGTCACGCCTCTGTCAGTAAAAGTACACTG
GATGCAATCCATGGACTGTCAATCAAATAGACTTACAAATCCAGCCCTTC
CAACATGCGTTCTCGTCCTATCTCATCACAGTATGATAGAAAAGCTAATA
ATAATATCCTGACGCGCCCAGATAACAATTTACAGATTACCAGTACCTCC
AAAAGCATCATGCAAAAGAAGTTGGACATTCGAAGGCAGCGACGAACGCT
GGAAAGTGAAGAAAAACCTGCCTCAGCTTCAGGCGGGGTGGGTTCACCAA
AGGTTGGTGCGGTCCGCTCACAAGCCGCTCTTGCTAAAGCTTCGTCCTCC
TCACCGAGTCATAAAGCTGTTCGGACCACCAAATCTGCACCAACAAAGAA
TGCACGTACACCGGCCGATCAACAGACATCGATAGTATCAAATCATCATA
CAGCACCTCACTACTCGACAAAGCAACCATGAGATCGCGTAAAAATCTAC
CGGACCTTTTCCCGGATGCACCCAATGATGCACTTGATATGGTTCAATCA
CTTTTACAATTTAATCCGGACAAACGAATGACAGCGGAAGAAGCTTTAGC
ACATCCGTACCTAGCGAAATTCCATAACCCTGCAGAAGAGCATAGTCTGA
CGTATGACGTAGTCCCACCAGTTGATGACGATGTTCAACTGTCTGTCGCT
GAATATCGAACCAAACTATACGATATATACGAAAGGAGTGGACATGTGGT
CGATGGGGTGTATCCTGGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCT
GGATCCTCAACTCTCAATCAAATCGAACGAATTATGGCCGTTATACCAAC
CCCAAGTAGACAAGGTATGCGACTTTGGACTTGCGCGTTCTGTACAATGT
TTAACCCTGGAACATGGGGATCCAAGTTTGACAGATTACGTTGCAACACG
TTGGTACCGAGCACCCGAAATCCTCCTAGCTTCACCAAACCAAGCAACGT
TTTACTGGATAGAGAATGTTTTATTAAACTAATGAAAGCAATCAATTTCA
TTCACTCTGGCAATGTAATCCACAGGGATCTGAAGACACTGACTTGCATA
ATGTTATCAAGAAAGGCAACATTCTGAAAGATGTGCACAAACGGTACATT
ATGTATCAGGAATTTGGAAGTCATGACAATGTTATTAAACTGTTGAATGT
GATAAAAGCTGACAATGATAAAGACATTTACTTGGTGTTCGAATTTATGG
AGAACATTTAGAGAGATATGCTTCTTGCAGGCGTATGGTATTGTTTGGAA
AGGTATTGACAGAAAAACTGGTGAAATAGTTGCATTAAAAAAGATTTTTG
ATGCTTTTCGAAATCAAACGGATGCACAGATGAACACAGATATCGATCAA
CACATTTTGGTGAGGTATGAAATAAAGAAAAGACTTGGAAAAGGGGTGGC
GCACCAGAGACCAGGACAATATTCTTCTCCGAAGGTTCAACGAGTGGCCG
GCAAAAAGCCCTCTTCAACGCAGGCAACGTCAGGTCTAACCATGTCAAGT
TACACGCAAAGTCACGCCTCTGTCAGTAAAAGTACACTGGATGCAATCCA
TGGACTGTCAATCAAATAGACTTACAAATCCAGCCCTTCCAACATGCGTT
CTCGTCCTATCTCATCACAGTATGATAGAAAAGCTAATAATAATATCCTG
ACGCGCCCAGATAACAATTTACAGATTACCAGTACCTCCAAAAGCATCAT
GCAAAAGAAGTTGGACATTCGAAGGCAGCGACGAACGCTGGAAAGTGAAG
AAAAACCTGCCTCAGCTTCAGGCGGGGTGGGTTCACCAAAGGTTGGTGCG
GTCCGCTCACAAGCCGCTCTTGCTAAAGCTTCGTCCTCCTCACCGAGTCA
TAAAGCTGTTCGGACCACCAAATCTGCACCAACAAAGAATGCACGTACAC
CGGCCGATCAACAGACATCGATAGTATCAAATCATCATACAGCACCTCAC
TACTCGACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGACCTTTTC
CCGGATGCACCCAATGATGCACTTGATATGGTTCAATCACTTTTACAATT
TAATCCGGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATCCGTACC
TAGCGAAATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTATGACGTA
GTCCCACCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATATCGAAC
CAAACTATACGATATATACGAAAGGAGTGGACATGTGGTCGATGGGGTGT
ATCCTGGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTGGATCCTCAAC
TCTCAATCAAATCGAACGAATTATGGCCGTTATACCAACCCCAAGTAGAC
AAGGTATGCGACTTTGGACTTGCGCGTTCTGTACAATGTTTAACCCTGGA
ACATGGGGATCCAAGTTTGACAGATTACGTTGCAACACGTTGGTACCGAG
CACCCGAAATCCTCCTAGCTTCACCAAACCAAGCAACGTTTTACTGGATA
GAGAATGTTTTATTAAACTAATGAAAGCAATCAATTTCATTCACTCTGGC
AATGTAATCCACAGGGATCTGAAGACACTGACTTGCATAATGTTATCAAG
AAAGGCAACATTCTGAAAGATGTGCACAAACGGTACATTATGTATCAGGA
ATTTGGAAGTCATGACAATGTTATTAAACTGTTGAATGTGATAAAAGCTG
ACAATGATAAAGACATTTACTTGGTGTTCGAATTTATGGAGAACATTTAG
AGAGATATGCTTCTTGCAGGCGTATGGTATTGTTTGGAAAGGTATTGACA
GAAAAACTGGTGAAATAGTTGCATTAAAAAAGATTTTTGATGCTTTTCGA
AATCAAACGGATGCACAGATGAACACAGATATCGATCAACACATTTTGGT
GAGGTATGAAATAAAGAAAAGACTTGGAAAAGGGGTGGCGCACCAGAGAC
CAGGACAATATTCTTCTCCGAAGGTTCAACGAGTGGCCGGCAAAAAGCCC
TCTTCAACGCAGGCAACGTCAGGTCTAACCATGTCAAGTTACACGCAAAG
TCACGCCTCTGTCAGTAAAAGTACACTGGATGCAATCCATGGACTGTCAA
TCAAATAGACTTACAAATCCAGCCCTTCCAACATGCGTTCTCGTCCTATC
TCATCACAGTATGATAGAAAAGCTAATAATAATATCCTGACGCGCCCAGA
TAACAATTTACAGATTACCAGTACCTCCAAAAGCATCATGCAAAAGAAGT
TGGACATTCGAAGGCAGCGACGAACGCTGGAAAGTGAAGAAAAACCTGCC
TCAGCTTCAGGCGGGGTGGGTTCACCAAAGGTTGGTGCGGTCCGCTCACA
AGCCGCTCTTGCTAAAGCTTCGTCCTCCTCACCGAGTCATAAAGCTGTTC
GGACCACCAAATCTGCACCAACAAAGAATGCACGTACACCGGCCGATCAA
CAGACATCGATAGTATCAAATCATCATACAGCACCTCACTACTCGACAAA
GCAACCATGAGATCGCGTAAAAATCTACCGGACCTTTTCCCGGATGCACC
CAATGATGCACTTGATATGGTTCAATCACTTTTACAATTTAATCCGGACA
AACGAATGACAGCGGAAGAAGCTTTAGCACATCCGTACCTAGCGAAATTC
CATAACCCTGCAGAAGAGCATAGTCTGACGTATGACGTAGTCCCACCAGT
TGATGACGATGTTCAACTGTCTGTCGCTGAATATCGAACCAAACTATACG
ATATATACGAAAGGAGTGGACATGTGGTCGATGGGGTGTATCCTGGGTGA
AATGTTGCTCGGGAAACCCCTCTTCCCTGGATCCTCAACTCTCAATCAAA
TCGAACGAATTATGGCCGTTATACCAACCCCAAGTAGACAAGGTATGCGA
CTTTGGACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATGGGGATC
CAAGTTTGACAGATTACGTTGCAACACGTTGGTACCGAGCACCCGAAATC
CTCCTAGCTTCACCAAACCAAGCAACGTTTTACTGGATAGAGAATGTTTT
ATTAAACTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGTAATCCA
CAGGGATCTGAAGACACTGACTTGCATAATGTTATCAAGAAAGGCAACAT
TCTGAAAGATGTGCACAAACGGTACATTATGTATCAGGAATTTGGAAGTC
ATGACAATGTTATTAAACTGTTGAATGTGATAAAAGCTGACAATGATAAA
GACATTTACTTGGTGTTCGAATTTATGGAGAACATTTAGAGAGATATGCT
TCTTGCAGGCGTATGGTATTGTTTGGAAAGGTATTGACAGAAAAACTGGT
GAAATAGTTGCATTAAAAAAGATTTTTGATGCTTTTCGAAATCAAACGGA
TGCACAGATGAACACAGATATCGATCAACACATTTTGGTGAGGTATGAAA
TAAAGAAAAGACTTGGAAAAGGGGTGGCGCACCAGAGACCAGGACAATAT
TCTTCTCCGAAGGTTCAACGAGTGGCCGGCAAAAAGCCCTCTTCAACGCA
GGCAACGTCAGGTCTAACCATGTCAAGTTACACGCAAAGTCACGCCTCTG
TCAGTAAAAGTACACTGGATGCAATCCATGGACTGTCAATCAAATAGACT
TACAAATCCAGCCCTTCCAACATGCGTTCTCGTCCTATCTCATCACAGTA
TGATAGAAAAGCTAATAATAATATCCTGACGCGCCCAGATAACAATTTAC
AGATTACCAGTACCTCCAAAAGCATCATGCAAAAGAAGTTGGACATTCGA
AGGCAGCGACGAACGCTGGAAAGTGAAGAAAAACCTGCCTCAGCTTCAGG
CGGGGTGGGTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGCTCTTG
CTAAAGCTTCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACCACCAAA
TCTGCACCAACAAAGAATGCACGTACACCGGCCGATCAACAGACATCGAT
AGTATCAAATCATCATACAGCACCTCACTACTCGACAAAGCAACCATGAG
ATCGCGTAAAAATCTACCGGACCTTTTCCCGGATGCACCCAATGATGCAC
TTGATATGGTTCAATCACTTTTACAATTTAATCCGGACAAACGAATGACA
GCGGAAGAAGCTTTAGCACATCCGTACCTAGCGAAATTCCATAACCCTGC
AGAAGAGCATAGTCTGACGTATGACGTAGTCCCACCAGTTGATGACGATG
TTCAACTGTCTGTCGCTGAATATCGAACCAAACTATACGATATATACGAA
AGGAGTGGACATGTGGTCGATGGGGTGTATCCTGGGTGAAATGTTGCTCG
GGAAACCCCTCTTCCCTGGATCCTCAACTCTCAATCAAATCGAACGAATT
ATGGCCGTTATACCAACCCCAAGTAGACAAGGTATGCGACTTTGGACTTG
CGCGTTCTGTACAATGTTTAACCCTGGAACATGGGGATCCAAGTTTGACA
GATTACGTTGCAACACGTTGGTACCGAGCACCCGAAATCCTCCTAGCTTC
ACCAAACCAAGCAACGTTTTACTGGATAGAGAATGTTTTATTAAACTAAT
GAAAGCAATCAATTTCATTCACTCTGGCAATGTAATCCACAGGGATCTGA
AGACACTGACTTGCATAATGTTATCAAGAAAGGCAACATTCTGAAAGATG
TGCACAAACGGTACATTATGTATCAGGAATTTGGAAGTCATGACAATGTT
ATTAAACTGTTGAATGTGATAAAAGCTGACAATGATAAAGACATTTACTT
GGTGTTCGAATTTATGGAGAACATTTAGAGAGATATGCTTCTTGCAGGCG
TATGGTATTGTTTGGAAAGGTATTGACAGAAAAACTGGTGAAATAGTTGC
ATTAAAAAAGATTTTTGATGCTTTTCGAAATCAAACGGATGCACAGATGA
ACACAGATATCGATCAACACATTTTGGTGAGGTATGAAATAAAGAAAAGA
CTTGGAAAAGGGGTGGCGCACCAGAGACCAGGACAATATTCTTCTCCGAA
GGTTCAACGAGTGGCCGGCAAAAAGCCCTCTTCAACGCAGGCAACGTCAG
GTCTAACCATGTCAAGTTACACGCAAAGTCACGCCTCTGTCAGTAAAAGT
ACACTGGATGCAATCCATGGACTGTCAATCAAATAGACTTACAAATCCAG
CCCTTCCAACATGCGTTCTCGTCCTATCTCATCACAGTATGATAGAAAAG
CTAATAATAATATCCTGACGCGCCCAGATAACAATTTACAGATTACCAGT
ACCTCCAAAAGCATCATGCAAAAGAAGTTGGACATTCGAAGGCAGCGACG
AACGCTGGAAAGTGAAGAAAAACCTGCCTCAGCTTCAGGCGGGGTGGGTT
CACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGCTCTTGCTAAAGCTTCG
TCCTCCTCACCGAGTCATAAAGCTGTTCGGACCACCAAATCTGCACCAAC
AAAGAATGCACGTACACCGGCCGATCAACAGACATCGATAGTATCAAATC
ATCATACAGCACCTCACTACTCGACAAAGCAACCATGAGATCGCGTAAAA
ATCTACCGGACCTTTTCCCGGATGCACCCAATGATGCACTTGATATGGTT
CAATCACTTTTACAATTTAATCCGGACAAACGAATGACAGCGGAAGAAGC
TTTAGCACATCCGTACCTAGCGAAATTCCATAACCCTGCAGAAGAGCATA
GTCTGACGTATGACGTAGTCCCACCAGTTGATGACGATGTTCAACTGTCT
GTCGCTGAATATCGAACCAAACTATACGATATATACGAAAGGAGTGGACA
TGTGGTCGATGGGGTGTATCCTGGGTGAAATGTTGCTCGGGAAACCCCTC
TTCCCTGGATCCTCAACTCTCAATCAAATCGAACGAATTATGGCCGTTAT
ACCAACCCCAAGTAGACAAGGTATGCGACTTTGGACTTGCGCGTTCTGTA
CAATGTTTAACCCTGGAACATGGGGATCCAAGTTTGACAGATTACGTTGC
AACACGTTGGTACCGAGCACCCGAAATCCTCCTAGCTTCACCAAACCAAG
CAACGTTTTACTGGATAGAGAATGTTTTATTAAACTAATGAAAGCAATCA
ATTTCATTCACTCTGGCAATGTAATCCACAGGGATCTGAAGACACTGACT
TGCATAATGTTATCAAGAAAGGCAACATTCTGAAAGATGTGCACAAACGG
TACATTATGTATCAGGAATTTGGAAGTCATGACAATGTTATTAAACTGTT
GAATGTGATAAAAGCTGACAATGATAAAGACATTTACTTGGTGTTCGAAT
TTATGGAGAACATTTAGAGAGATATGCTTCTTGCAGGCGTATGGTATTGT
TTGGAAAGGTATTGACAGAAAAACTGGTGAAATAGTTGCATTAAAAAAGA
TTTTTGATGCTTTTCGAAATCAAACGGATGCACAGATGAACACAGATATC
GATCAACACATTTTGGTGAGGTATGAAATAAAGAAAAGACTTGGAAAAGG
GGTGGCGCACCAGAGACCAGGACAATATTCTTCTCCGAAGGTTCAACGAG
TGGCCGGCAAAAAGCCCTCTTCAACGCAGGCAACGTCAGGTCTAACCATG
TCAAGTTACACGCAAAGTCACGCCTCTGTCAGTAAAAGTACACTGGATGC
AATCCATGGACTGTCAATCAAATAGACTTACAAATCCAGCCCTTCCAACA
TGCGTTCTCGTCCTATCTCATCACAGTATGATAGAAAAGCTAATAATAAT
ATCCTGACGCGCCCAGATAACAATTTACAGATTACCAGTACCTCCAAAAG
CATCATGCAAAAGAAGTTGGACATTCGAAGGCAGCGACGAACGCTGGAAA
GTGAAGAAAAACCTGCCTCAGCTTCAGGCGGGGTGGGTTCACCAAAGGTT
GGTGCGGTCCGCTCACAAGCCGCTCTTGCTAAAGCTTCGTCCTCCTCACC
GAGTCATAAAGCTGTTCGGACCACCAAATCTGCACCAACAAAGAATGCAC
GTACACCGGCCGATCAACAGACATCGATAGTATCAAATCATCATACAGCA
CCTCACTACTCGACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGAC
CTTTTCCCGGATGCACCCAATGATGCACTTGATATGGTTCAATCACTTTT
ACAATTTAATCCGGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATC
CGTACCTAGCGAAATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTAT
GACGTAGTCCCACCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATA
TCGAACCAAACTATACGATATATACGAAAGGAGTGGACATGTGGTCGATG
GGGTGTATCCTGGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTGGATC
CTCAACTCTCAATCAAATCGAACGAATTATGGCCGTTATACCAACCCCAA
GTAGACAAGGTATGCGACTTTGGACTTGCGCGTTCTGTACAATGTTTAAC
CCTGGAACATGGGGATCCAAGTTTGACAGATTACGTTGCAACACGTTGGT
ACCGAGCACCCGAAATCCTCCTAGCTTCACCAAACCAAGCAACGTTTTAC
TGGATAGAGAATGTTTTATTAAACTAATGAAAGCAATCAATTTCATTCAC
TCTGGCAATGTAATCCACAGGGATCTGAAGACACTGACTTGCATAATGTT
ATCAAGAAAGGCAACATTCTGAAAGATGTGCACAAACGGTACATTATGTA
TCAGGAATTTGGAAGTCATGACAATGTTATTAAACTGTTGAATGTGATAA
AAGCTGACAATGATAAAGACATTTACTTGGTGTTCGAATTTATGGAGAAC
ATTTAGAGAGATATGCTTCTTGCAGGCGTATGGTATTGTTTGGAAAGGTA
TTGACAGAAAAACTGGTGAAATAGTTGCATTAAAAAAGATTTTTGATGCT
TTTCGAAATCAAACGGATGCACAGATGAACACAGATATCGATCAACACAT
TTTGGTGAGGTATGAAATAAAGAAAAGACTTGGAAAAGGGGTGGCGCACC
AGAGACCAGGACAATATTCTTCTCCGAAGGTTCAACGAGTGGCCGGCAAA
AAGCCCTCTTCAACGCAGGCAACGTCAGGTCTAACCATGTCAAGTTACAC
GCAAAGTCACGCCTCTGTCAGTAAAAGTACACTGGATGCAATCCATGGAC
TGTCAATCAAATAGACTTACAAATCCAGCCCTTCCAACATGCGTTCTCGT
CCTATCTCATCACAGTATGATAGAAAAGCTAATAATAATATCCTGACGCG
CCCAGATAACAATTTACAGATTACCAGTACCTCCAAAAGCATCATGCAAA
AGAAGTTGGACATTCGAAGGCAGCGACGAACGCTGGAAAGTGAAGAAAAA
CCTGCCTCAGCTTCAGGCGGGGTGGGTTCACCAAAGGTTGGTGCGGTCCG
CTCACAAGCCGCTCTTGCTAAAGCTTCGTCCTCCTCACCGAGTCATAAAG
CTGTTCGGACCACCAAATCTGCACCAACAAAGAATGCACGTACACCGGCC
GATCAACAGACATCGATAGTATCAAATCATCATACAGCACCTCACTACTC
GACAAAGCAACCATGAGATCGCGTAAAAATCTACCGGACCTTTTCCCGGA
TGCACCCAATGATGCACTTGATATGGTTCAATCACTTTTACAATTTAATC
CGGACAAACGAATGACAGCGGAAGAAGCTTTAGCACATCCGTACCTAGCG
AAATTCCATAACCCTGCAGAAGAGCATAGTCTGACGTATGACGTAGTCCC
ACCAGTTGATGACGATGTTCAACTGTCTGTCGCTGAATATCGAACCAAAC
TATACGATATATACGAAAGGAGTGGACATGTGGTCGATGGGGTGTATCCT
GGGTGAAATGTTGCTCGGGAAACCCCTCTTCCCTGGATCCTCAACTCTCA
ATCAAATCGAACGAATTATGGCCGTTATACCAACCCCAAGTAGACAAGGT
ATGCGACTTTGGACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATG
GGGATCCAAGTTTGACAGATTACGTTGCAACACGTTGGTACCGAGCACCC
GAAATCCTCCTAGCTTCACCAAACCAAGCAACGTTTTACTGGATAGAGAA
TGTTTTATTAAACTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGT
AATCCACAGGGATCTGAAGACACTGACTTGCATAATGTTATCAAGAAAGG
CAACATTCTGAAAGATGTGCACAAACGGTACATTATGTATCAGGAATTTG
GAAGTCATGACAATGTTATTAAACTGTTGAATGTGATAAAAGCTGACAAT
GATAAAGACATTTACTTGGTGTTCGAATTTATGGAGAACATTTAGAGAGA
TATGCTTCTTGCAGGCGTATGGTATTGTTTGGAAAGGTATTGACAGAAAA
ACTGGTGAAATAGTTGCATTAAAAAAGATTTTTGATGCTTTTCGAAATCA
AACGGATGCACAGATGAACACAGATATCGATCAACACATTTTGGTGAGGT
ATGAAATAAAGAAAAGACTTGGAAAAGGGGTGGCGCACCAGAGACCAGGA
CAATATTCTTCTCCGAAGGTTCAACGAGTGGCCGGCAAAAAGCCCTCTTC
AACGCAGGCAACGTCAGGTCTAACCATGTCAAGTTACACGCAAAGTCACG
CCTCTGTCAGTAAAAGTACACTGGATGCAATCCATGGACTGTCAATCAAA
TAGACTTACAAATCCAGCCCTTCCAACATGCGTTCTCGTCCTATCTCATC
ACAGTATGATAGAAAAGCTAATAATAATATCCTGACGCGCCCAGATAACA
ATTTACAGATTACCAGTACCTCCAAAAGCATCATGCAAAAGAAGTTGGAC
ATTCGAAGGCAGCGACGAACGCTGGAAAGTGAAGAAAAACCTGCCTCAGC
TTCAGGCGGGGTGGGTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCG
CTCTTGCTAAAGCTTCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACC
ACCAAATCTGCACCAACAAAGAATGCACGTACACCGGCCGATCAACAGAC
ATCGATAGTATCAAATCATCATACAGCACCTCACTACTCGACAAAGCAAC
CATGAGATCGCGTAAAAATCTACCGGACCTTTTCCCGGATGCACCCAATG
ATGCACTTGATATGGTTCAATCACTTTTACAATTTAATCCGGACAAACGA
ATGACAGCGGAAGAAGCTTTAGCACATCCGTACCTAGCGAAATTCCATAA
CCCTGCAGAAGAGCATAGTCTGACGTATGACGTAGTCCCACCAGTTGATG
ACGATGTTCAACTGTCTGTCGCTGAATATCGAACCAAACTATACGATATA
TACGAAAGGAGTGGACATGTGGTCGATGGGGTGTATCCTGGGTGAAATGT
TGCTCGGGAAACCCCTCTTCCCTGGATCCTCAACTCTCAATCAAATCGAA
CGAATTATGGCCGTTATACCAACCCCAAGTAGACAAGGTATGCGACTTTG
GACTTGCGCGTTCTGTACAATGTTTAACCCTGGAACATGGGGATCCAAGT
TTGACAGATTACGTTGCAACACGTTGGTACCGAGCACCCGAAATCCTCCT
AGCTTCACCAAACCAAGCAACGTTTTACTGGATAGAGAATGTTTTATTAA
ACTAATGAAAGCAATCAATTTCATTCACTCTGGCAATGTAATCCACAGGG
ATCTGAAGACACTGACTTGCATAATGTTATCAAGAAAGGCAACATTCTGA
AAGATGTGCACAAACGGTACATTATGTATCAGGAATTTGGAAGTCATGAC
AATGTTATTAAACTGTTGAATGTGATAAAAGCTGACAATGATAAAGACAT
TTACTTGGTGTTCGAATTTATGGAGAACATTTAGAGAGATATGCTTCTTG
CAGGCGTATGGTATTGTTTGGAAAGGTATTGACAGAAAAACTGGTGAAAT
AGTTGCATTAAAAAAGATTTTTGATGCTTTTCGAAATCAAACGGATGCAC
AGATGAACACAGATATCGATCAACACATTTTGGTGAGGTATGAAATAAAG
AAAAGACTTGGAAAAGGGGTGGCGCACCAGAGACCAGGACAATATTCTTC
TCCGAAGGTTCAACGAGTGGCCGGCAAAAAGCCCTCTTCAACGCAGGCAA
CGTCAGGTCTAACCATGTCAAGTTACACGCAAAGTCACGCCTCTGTCAGT
AAAAGTACACTGGATGCAATCCATGGACTGTCAATCAAATAGACTTACAA
ATCCAGCCCTTCCAACATGCGTTCTCGTCCTATCTCATCACAGTATGATA
GAAAAGCTAATAATAATATCCTGACGCGCCCAGATAACAATTTACAGATT
ACCAGTACCTCCAAAAGCATCATGCAAAAGAAGTTGGACATTCGAAGGCA
GCGACGAACGCTGGAAAGTGAAGAAAAACCTGCCTCAGCTTCAGGCGGGG
TGGGTTCACCAAAGGTTGGTGCGGTCCGCTCACAAGCCGCTCTTGCTAAA
GCTTCGTCCTCCTCACCGAGTCATAAAGCTGTTCGGACCACCAAATCTGC
ACCAACAAAGAATGCACGTACACCGGCCGATCAACAGACATCGATAGTAT
CAAATCATCATACAGCACCTCACTACTCGACAAAGCAACCATGAGATCGC
GTAAAAATCTACCGGACCTTTTCCCGGATGCACCCAATGATGCACTTGAT
ATGGTTCAATCACTTTTACAATTTAATCCGGACAAACGAATGACAGCGGA
AGAAGCTTTAGCACATCCGTACCTAGCGAAATTCCATAACCCTGCAGAAG
AGCATAGTCTGACGTATGACGTAGTCCCACCAGTTGATGACGATGTTCAA
CTGTCTGTCGCTGAATATCGAACCAAACTATACGATATATACGAAAGGAG
TGGACATGTGGTCGATGGGGTGTATCCTGGGTGAAATGTTGCTCGGGAAA
CCCCTCTTCCCTGGATCCTCAACTCTCAATCAAATCGAACGAATTATGGC
CGTTATACCAACCCCAAGTAGACAAGGTATGCGACTTTGGACTTGCGCGT
TCTGTACAATGTTTAACCCTGGAACATGGGGATCCAAGTTTGACAGATTA
CGTTGCAACACGTTGGTACCGAGCACCCGAAATCCTCCTAGCTTCACCAA
ACCAAGCAACGTTTTACTGGATAGAGAATGTTTTATTAAACTAATGAAAG
CAATCAATTTCATTCACTCTGGCAATGTAATCCACAGGGATCTGAAGACA
CTGACTTGCATAATGTTATCAAGAAAGGCAACATTCTGAAAGATGTGCAC
AAACGGTACATTATGTATCAGGAATTTGGAAGTCATGACAATGTTATTAA
ACTGTTGAATGTGATAAAAGCTGACAATGATAAAGACATTTACTTGGTGT
TCGAATTTATGGAGAACATTTAGAGAGATATGCTTCTTGCAGGCGTATGG
TATTGTTTGGAAAGGTATTGACAGAAAAACTGGTGAAATAGTTGCATTAA
AAAAGATTTTTGATGCTTTTCGAAATCAAACGGATGCACAGATGAACACA
GATATCGATCAACACATTTTGGTGAGGTATGAAATAAAGAAAAGACTTGG
AAAAGGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000658XLOC_000658Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001214-exon-sc0000007-1575043694:1096522..1097129TCONS_00001214-exon-sc0000007-1575043694:1096522..1097129Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1091603..1091701TCONS_00001214-exon-sc0000007-1575043694:1091603..1091701Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1091437..1091466TCONS_00001214-exon-sc0000007-1575043694:1091437..1091466Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1091110..1091200TCONS_00001214-exon-sc0000007-1575043694:1091110..1091200Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1090917..1090990TCONS_00001214-exon-sc0000007-1575043694:1090917..1090990Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1090718..1090774TCONS_00001214-exon-sc0000007-1575043694:1090718..1090774Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1090455..1090493TCONS_00001214-exon-sc0000007-1575043694:1090455..1090493Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1089863..1089987TCONS_00001214-exon-sc0000007-1575043694:1089863..1089987Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1089429..1089568TCONS_00001214-exon-sc0000007-1575043694:1089429..1089568Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1088965..1089263TCONS_00001214-exon-sc0000007-1575043694:1088965..1089263Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1088534..1088755TCONS_00001214-exon-sc0000007-1575043694:1088534..1088755Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1088114..1088236TCONS_00001214-exon-sc0000007-1575043694:1088114..1088236Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1575043694:1086988..1087828TCONS_00001214-exon-sc0000007-1575043694:1086988..1087828Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1096522..1097129TCONS_00001214-exon-sc0000007-1510915933:1096522..1097129Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1091603..1091701TCONS_00001214-exon-sc0000007-1510915933:1091603..1091701Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1091437..1091466TCONS_00001214-exon-sc0000007-1510915933:1091437..1091466Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1091110..1091200TCONS_00001214-exon-sc0000007-1510915933:1091110..1091200Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1090917..1090990TCONS_00001214-exon-sc0000007-1510915933:1090917..1090990Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1090718..1090774TCONS_00001214-exon-sc0000007-1510915933:1090718..1090774Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1090455..1090493TCONS_00001214-exon-sc0000007-1510915933:1090455..1090493Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1089863..1089987TCONS_00001214-exon-sc0000007-1510915933:1089863..1089987Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1089429..1089568TCONS_00001214-exon-sc0000007-1510915933:1089429..1089568Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1088965..1089263TCONS_00001214-exon-sc0000007-1510915933:1088965..1089263Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1088534..1088755TCONS_00001214-exon-sc0000007-1510915933:1088534..1088755Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1088114..1088236TCONS_00001214-exon-sc0000007-1510915933:1088114..1088236Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1510915933:1086988..1087828TCONS_00001214-exon-sc0000007-1510915933:1086988..1087828Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1096522..1097129TCONS_00001214-exon-sc0000007-1491911889:1096522..1097129Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1091603..1091701TCONS_00001214-exon-sc0000007-1491911889:1091603..1091701Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1091437..1091466TCONS_00001214-exon-sc0000007-1491911889:1091437..1091466Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1091110..1091200TCONS_00001214-exon-sc0000007-1491911889:1091110..1091200Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1090917..1090990TCONS_00001214-exon-sc0000007-1491911889:1090917..1090990Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1090718..1090774TCONS_00001214-exon-sc0000007-1491911889:1090718..1090774Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1090455..1090493TCONS_00001214-exon-sc0000007-1491911889:1090455..1090493Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1089863..1089987TCONS_00001214-exon-sc0000007-1491911889:1089863..1089987Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1089429..1089568TCONS_00001214-exon-sc0000007-1491911889:1089429..1089568Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1088965..1089263TCONS_00001214-exon-sc0000007-1491911889:1088965..1089263Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1088534..1088755TCONS_00001214-exon-sc0000007-1491911889:1088534..1088755Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1088114..1088236TCONS_00001214-exon-sc0000007-1491911889:1088114..1088236Clytia hemisphaericaexon
TCONS_00001214-exon-sc0000007-1491911889:1086988..1087828TCONS_00001214-exon-sc0000007-1491911889:1086988..1087828Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001214-proteinTCONS_00001214-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1086988..1097129 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
15.3118 14.8092 38.9575 42.3715 93.2787 69.9356 48.887 52.3592 31.1427 39.8456 26.0191 21.3643 11.9366 12.8866 10.9129 15.6297 11.8371 12.2128 11.8102 16.9778 13.0383 10.9125 13.7671 14.4778 53.3921 41.8673 12.2606 13.0811 11.7948 11.8416
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR003527MAP_kinase_CS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004707MAP kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
molecular_function GO:0005524 ATP binding
molecular_function GO:0004707 MAP kinase activity
molecular_function GO:0004672 protein kinase activity
Blast
BLAST of TCONS_00001214 vs. Swiss-Prot (Human)
Match: MK15 (Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 9.454e-139
Identity = 201/345 (58.26%), Postives = 268/345 (77.68%), Query Frame = 3
Query:  543 MNTDIDQHILVRYEIKKRLGKGAYGIVWKGIDRKTGEIVALKKIFDAFRNQTDAQRTFREICFLQEFGSHDNVIKLLNVIKADNDKDIYLVFEFMDTDLHNVIKKGNILKDVHKRYIMYQLMKAINFIHSGNVIHRDLKPSNVLLDRECFIKVCDFGLARSVQCLTLEHGDPSLTDYVATRWYRAPEILLASPKYTKGVDMWSMGCILGEMLLGKPLFPGSSTLNQIERIMAVIPTPSRQDIDSIKSSYSTSLLDKATMRSRKNLPDLF-PDAPNDALDMVQSLLQFNPDKRMTAEEALAHPYLAKFHNPAEEHSLTYXXXXXXXXXXQLSVAEYRTKLYDSIMQ 1574
            M T +D  I+ RY ++++LG+GAYGIVWK +DR+TGE+VA+KKIFDAFR++TDAQRTFREI  LQEFG H N+I LL+VI+A+ND+DIYLVFEFMDTDL+ VI+KG +L+DVH R I YQL++A  F+HSG+V+HRD KPSNVLLD  C +K+CDFGLARS+  L     D ++T+YVATRWYRAPE+LL+S +YT GVDMWS+GCILGEML G+PLFPG+STL+Q+E I+  IP PS +D+ ++ S    S+L +   R R+ L  L  PD   +ALD+++ LL F PDKR++A +AL HPY+ +FH P++E +   DV P   + VQLSV EYR+++Y  I++
Sbjct:    1 MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQHPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILE 345          
The following BLAST results are available for this feature:
BLAST of TCONS_00001214 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MK159.454e-13958.26Mitogen-activated protein kinase 15 OS=Homo sapien... [more]
back to top