Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001196 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001196
Unique NameTCONS_00001196
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2006

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001196 ID=TCONS_00001196|Name=TCONS_00001196|organism=Clytia hemisphaerica|type=transcript|length=2006bp
CGATGATAgcgaaatgaaatattttcacTTGTTACTTACTTTATTGATTC
CTGAATTTTCATTGGCTGTGTGGTTTCCGAAACCATGTGTGGAGATACGT
TGCCAGGCCCGTTACGCTGGTTACCAGCCTACCGTCATCCCTGAAGGGAA
ATGCatcaaacaaataaataaagtgGTTCACATCAATACACCTATAGTGA
AAATGGGGAGTTGCAGAAGTAAAAGATGTACGGAAGTTGATAAAACGAGA
ACAGCGTGTTCATGCAGAGAGGTCACGAATTGTTGGTGGGCTAGTTGGGG
AGCTTGGACAGGTTCAATAACACAAGGGACCTGTGGAAAACAACATCGTA
GACGAGCTGAGAAAGACAGAGCAAGATATGTGGAAAGATATGGAAGTTGT
AGTGGAGTAAAAGGCCAATGCAATGGAAGTTACAACTCAGAAGATCGAAC
CATGTGTAATTGCAGGAAAGCAAGTAGTTGTCCAGTAGCACCATGGAGTT
CGTGGACACCAGCAGTTGGTAATGGACAATGTAAAGACCAAACACGACAC
CAAGACAAAAAGCCTTCATACACTTACGTTATGAAAGAACAGAAGAAAGG
AGAAGTGGCTTGCTTTGGCATCGATCCTGATTGTCGACCACCAAGAATTA
CTGATACAAGAACATTCTGTAAATGTCCGACGAAGGAATGCACAGAGAGA
AGTTGGACATCTTGGAATATCGACACATGGACGGGAAGCTGCCCAAATGA
GAAGAGGACCAAAACATatgatttcaaaatcaaatataTTGAGGCTTACA
AGAGCTGCAATGGTGTAGGAAAAGATTGCCCACCTACCAAGAACGAGTAT
AGAAAAAAAGTGATCAAATGTCCAGCAATCAAGTTATCACTAAACTCCAT
CCACCTTGACAAATCATGCAATGGAGTAGACAGCTCATGTACATCTGTCT
GTCGCATTGACTGTAAGAAAGGCTACAAGCTGATTGGTCAAAACCATGTC
ACGTGTCACGGATCAGGAAAATGGACAGGAAAACTAGGGTATTGTAAAGA
TTCTGAGCCACCGACGATAACATGTCCTAAATTGCCAATTCCAACCGTCA
ACAACAAGCCAGGCACCAATTACTCCATCATCTCATTCCCCAATGCGACG
GCAACCGATAATTCAGGTTTTCCAGTGACAATCACCACAAGTCATCCATC
ACCACTGAAAGTGTTCGTTCACCATCCAGTTGAAGTTACTTACACTGCTA
CTGATGCTGTTGGAAACACCAATAAATGCAAACGGAAATTCATCGTCAAA
GATCACGAGGCACCAGTTGTAACTTATTGCCCCAAAAAACATCGAATCAT
CAAAACAGGGTTATTCCCACACCGAGTATTTTGGCCCATGCCACGCTTCA
CAGACAACGTGGAGGCTGACAACGAGTTGGTCTTCATCCCTTCCGTGGTG
AATGGAACTAAGTTCTACCAAGGGAAACACAGTGTTGATATCAAAGCCAG
AGATAAATCATCCAATACTGGAAACTGCACCATGACATTCGAGCTCCAAA
TGTTGAAATGCCCAGTGGATGCGCCACCCAAGCATGGTTCCGCCACATGC
AACATTAAGAACAACGGGAAAGTTGAAGCTTTCATTTGTACTGCAGCTTG
TCAAAAAGGTTCATGGTTTCTGGAAGGTGCAAACATTCCGAAAGTGTACA
ATTTGTATGTGTGTTCGATGGATGGAGCATGGCAAGGTGCAAGTGTTTTC
AACTTTGACAACTTGGTACACTCTCCTATGGTTCCTATCAATAGAGGAGA
TCCTATGTGGCCAGACTGCTCAGTGGGCAAGTCACCAAACGGCGTGGCGC
TAGATATGCAAATCTTCAGTGGCAAATGTTCAGACCAAGCCTCTATGGAA
AAGTTGAAGCGTGATTTTGTCGCAACGTTGAAGAAAGATTTCATTTGGGG
AGCAGCATTCTgttcacaacaacaacaatgtGATGTGGAGAATGCTGTTG
TGTNtt
Run BLAST on NCBI

transcript from alignment at sc0000007:930008..937677-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001196 ID=TCONS_00001196|Name=TCONS_00001196|organism=Clytia hemisphaerica|type=transcript|length=7670bp|location=Sequence derived from alignment at sc0000007:930008..937677- (Clytia hemisphaerica)
CGATGATAGCGAAATGAAATATTTTCACTTGTTACTTACTTTATTGATTC CTGAATTTTCATTGGCTGTGTGGTTTCCGAAACCATGTGTGGAGATACGT TGCCAGGCCCGTTACGCTGGTTACCAGCCTACCGTCATCCCTGAAGGGAA ATGCATCAAACAAATAAATAAAGTGGTTCACATCAATACACCTATAGTGA AAATGGGGAGTTGCAGAAGTAAAAGATGTACGGAAGTTGATAAAACGAGA ACAGCGTGTAAGTGGGTTTTGTTGAGACTTAGAAATTACCCTGACTAAAC ACCATTCGAATTATCAGCTCATGCTCCGATTACGATAAAATTGGAATTGC TGATGAAATATTACCACGCACTATAATTTTCATGAAAGAAATTCTCCAAA ATTTGAAAAACGAAAATAAAAGATGAAGAAGAAAGAATGATCTTTTTATC CGTTTTCACTATAAAATGAAATTGACTTTTGGTCAAAGATATTTTGAACC TTGCTGATTCGAGAAACACTTTTCATTTCTTCCTTACATCAAAAGTTATA ATTCTTGGGGAGATGAAAACAGCAAAAAAATCAAAAACCATTTAGGGCCT GTAACTTTTCATGAAGCTATGGAAAACATATTCTACAGTGAAAGGAAACG AAATGGAGCTGAAGTTTTTTCTGTTACAAGGACAACACTTTACCAAGCTA TTTTCACTCGTCTTCATCTTTAATAAGGGCAAAAATCAAAGGTTGCTAAT TTCGTGTTTCCAAAGCTTTTGAGGAAAAAGAGTCAACTGTAAAACTGTAA AAGTTCTGTTTGATGTAATGTAAGTTTCATATCCTAAATTTCAGAACACA TCGTAGATAAAAAAAACAAGTGATACTTTTATGGACCTACCTGGTTGTGC ATTTAACAAATTTATAATTAATATCTACGTGACGTGACCATCAAACAATC ATTCAGAACACAAATAGTGACGATCTATCAAAAGTCGTTTGTTTCTTATA AAAAAACATTTGGAAACCAAAATTTCATGCTCTTGAAATATTCTTCCATA TTCAAGACTTCGTGAGCAAAAAAACATCCATCTCGTCAAAAAATCGAGTA GTTTGGCTAAGAAAATTAATGTATGCTTATTAATAGTGATTCTTATAGAT AAAAATAATTTTTTGAGCTGAAAAATTCTTCTTTTACAAAAATCTGCTTG AGCCATCTATTACCTACTTTCATGCAAAAAATCAGAAAAAAACAATGATC CAATATTTCACAAAGTCCAAAAAACTCTTTTTTTTGGCCGTTTTTTAGCT GAAATTTACCCCCGGGGGGGGGCACTGGGTTTGCGGACTGACGGTATGTG CGGGCCAAAAATTGGCTTTTAAAATTGCACCCTTACAGTGCAGCAAAAAT CAGAGAAAATCATACCCTTAGAGTGCATTTTCCCCCAAATTTTTGATCCC TTTCGTGCAAAAATTGGTCAAAATTCTAGCATTTTTGGTCAAAATATCTA GATTTTTCAAGAATTTTCTAAAATTTCTACCCTTACAGTGCATCTCTAGT TTTTCCGACCCTTACAGTGCATTTTAAACATATTGGAAAAGGTACCCTTA GGACCCGCACATACCCGTCGGTTCTTTTGCCCAGCTGCCCCCCCCCCCGG GAATTTACCCCAAATTTTTTTTTCAAAAAATCGAGCTCCGTCACATTCGA GGGTTTATAGTTACACATCTTTGTGCAAATAATCAGAAAAAACTAATGAG CTAATCTCGAGAAAAATTGGTAACGAACGAACGGACGAACGAACAGAGGT TAATCCGAGGTTAATTTATAGGACCTCCACCGGGGTAGGTCCAAAAAATT TGAAAAATACCAAGGAGCTGAAGTGTTCAAAGTGAGAAAAAAAGGACAAA CTCAGTGGAAATCTATAACATAAGGCCTCTTGAATCTTTACGTTTGCAAA CTCTTAATTCTTTTCAAATGCAGGTTCATGCAGAGAGGTCACGAATTGTT GGTGGGCTAGTTGGGGAGCTTGGACAGGTTCAATAACACAAGGGACCTGT GGAAAACAACATCGTAGACGAGCTGAGAAAGACAGAGCAAGATATGTGGA AAGATATGGAAGTTGTAGTGGAGTAAAAGGCCAATGCAATGGAAGTTACA ACTCAGAAGATCGAACCATGTGTAAGTTATATCCTGAAGTCTTTCAGCTT TTTGTTTACATAGTTTCGGTGGCAATTTGATCTACTAATATTAATATTTC AATTAGCCGTCCTGGAATCGTCTCTTGAGATGACTCTTTACAATGATAAT CAAGCTCGCGAGACATTAAATGTATCTCATCCTTATGAGAGATATGTAAC CGATTTCCTGTATTTTCCAAGGAAAAAAAGAACTACAATATTTTCTTGTA TATTGATTGGAACATTGATTATAAAACGCAGTTTCCTGCATTTTCCAAGG AAAATTATGTATGTCTTGTAGTTTCAAAGGAAAATTAGACAAACACATTT CTTTTTTTGGTAATAGAAACAACCTAAAGCAAATTCTTGTATTTTCCAAG GAAAATCGGCCAAGACAATTTCTTGTATTTTCCAAGGAAAAAATTACATA AGATAAAATGTTTCAAGAAAATTGTCTAAATTAATTTTTTGCTACTTTCA CCCTTTCACCAAGTTGATTTTGCAAGAAAGTTAAAAAAGGAGTTATTTTG AAAGCAAACCGAATCGAAACTGGCATATTTTAATAGACTAAAACTATAAT TTTACAAGAATAATCCTTATGCTAGGAGTTGTTCAGCCATCGTGGCTAGC GATGGTGGGTGGACATTCGTGGGTGGCTTTGAAAGTTATTTGAAAATGAA AAAGAAAAAGAAAATGAGTGTTAAATTTCAAAGCGCTCTTGAAAATGTTC AAAAAATAAGATTAGAAAAAAGGAACGAAAAAATGCATGTTTTCACGGTT TTCATTTTAAGGCTGAAAATTAAAGACCAAATACAGAAAAGGCGCGAAAA AGAGTTGCCATTTCCAAAAGAATCGCTAGCGAAAAAGTTTTATGCGAGAA TGAGAGAGTTCGGATTTAAGCGTATTATGATAATGATTATTTTAAATATC AACTTCTCATACATGGAATACTGTTTTAATCTTTAGGTAAATTCTCTCCA CTTTAAAAGACATTTCAGGAAATCCAGTTAAATCATGCCTCCTATCTTTT TCATGATTTGTAGGTAATTGCAGGAAAGCAAGTAGTTGTCCAGTAGCACC ATGGAGTTCGTGGACACCAGCAGTTGGTAATGGACAATGTAAAGACCAAA CACGACACCAAGACAAAAAGCCTTCATACACTTACGTTATGAAAGAACAG AAGAAAGGAGAAGTGGCTTGCTTTGGCATCGATCCTGATTGTCGACCACC AAGAATTACTGATACAAGAACATTCTGTAAGATAATTTTCATCGACTCGA CTTTCGAAGACAATTATTTGTTAGTTTTAGTTGGTCTGTTGTTTCATAGT CTGTGCTTCTTGCAGAAGGAATTTTCAAAATATTTTTGAAACGAATAAGC GTTTGATTCAATCAAAAAGTGTGAGAAAGCTATGTTAAGATCTATCAGTT TTGACAATCTCAAAGAAGCCTTCTTTTAACCGAATACATTTCTACATTCA GGTAAATGTCCGACGAAGGAATGCACAGAGAGAAGTTGGACATCTTGGAA TATCGACACATGGACGGGAAGCTGCCCAAATGAGAAGAGGACCAAAACAT ATGATTTCAAAATCAAATATATTGAGGCTTACAAGAGCTGCAATGGTGTA GGAAAAGATTGCCCACCTACCAAGAACGAGTATAGAAAAAAAGGTTGACA ACTTTGACTCGATGTTGTATCTTCATCATAAGTACCTTTTAATTGTCTCT CTGATTCTTATCATTTAGCAAACATCAAATTGTGAGTTTCCGAGAAGTCA GCAGTACATATGAGCCAAATCAAAACAAAAATTTCGGGTGTTAAAATACG GCAAACTATAAACTTTTGATCTATGGTAGTACAGCGGAGTCTCCATAACT CGGACACAATTTGTTCGAGTTAAGGAGACATTTAAGTTATAGAGGTTCGA GATAAAGAGACTCCACTATATCTTACGTCATCTTCTAATATTTCCAGTGA TCAAATGTCCAGCAATCAAGTTATCACTAAACTCCATCCACCTTGACAAA TCATGCAATGGAGTAGACAGCTCATGTACATCTGTCTGTCGCATTGACTG TAAGAAAGGCTACAAGCTGATTGGTCAAAACCATGTCACGTGTCACGGAT CAGGAAAATGGACAGGAAAACTAGGGTATTGTAAAGGTAAGATACAATAA AACTTGTCATTGCAAACCATTCTATCGAAATTTATCGTAGAATTTAACAA TTTCTCCTGGAAAGAATTCCAATTACATGTTATGATCAGGAACCAAGATA TTCAAAATACACTATTTCCACTGAACTTCGCTCGTCTGACTTTGTTTTTC ACTCATTATGGCACCATATTTTTAGATTCTGAGCCACCGACGATAACATG TCCTAAATTGCCAATTCCAACCGTCAACAACAAGCCAGGCACCAATTACT CCATCATCTCATTCCCCAATGCGACGGCAACCGATAATTCAGGTTTTCCA GTGACAATCACCACAAGTCATCCATCACCACTGAAAGTGTTCGTTCACCA TCCAGTTGAAGTTACTTACACTGCTACTGATGCTGTTGGAAACACCAATA AATGCAAACGGAAATTCATCGTCAAAGGTAGACATTTTTGAATATCATTA CTGCCGTTGGTTATAGGTTTTGTGAGTGAGGACAAGTTATTTTACTGAGA TGAAAAGAAGTCATTGGAATTTTAACTAGACAAAAAAGATGTAAGACTGC CACCAGCACAATATGTTCTCACTTCTTTTATACTGTTCTCACTTCTTTTA TACTGTTCATACTTCTTTTATACTGTTCATACTTTTTATTGCCGGTAGCA ATAATTTTGAATCTTCAAGATGTTGACAAGGCTTTATAAATGAAATGATT TCCTATTTTAAACCCTCAAACCCATTTCTAGATCACGAGGCACCAGTTGT AACTTATTGCCCCAAAAAACATCGAATCATCAAAACAGGGTTATTCCCAC ACCGAGTATTTTGGCCCATGCCACGCTTCACAGACAACGTGGAGGCTGAC AACGAGTTGGTCTTCATCCCTTCCGTGGTGAATGGAACTAAGTTCTACCA AGGGAAACACAGTGTTGATATCAAAGCCAGAGATAAATCATCCAATACTG GAAACTGCACCATGACATTCGAGCTCCAAAGTAAGTAAACAAAAAACATG GCATTCGTTATTGTCAAAGTTAGGTAGCAAATAAAAATGAAAGGAAAGGC AATAGAGTGTCTTTGCAAATAATTAAAAAAAAAAACTAAAAACAGGTTTT ACTACATAAAGAGTTTCTGATGAACATGTGAGGGCTATCGAAACTTTTAA CTAATTAACTTTCTAGTGTTGAAATGCCCAGTGGATGCGCCACCCAAGCA TGGTTCCGCCACATGCAACATTAAGAACAACGGGAAAGTTGAAGCTTTCA TTTGTACTGCAGCTTGTCAAAAAGGTTCATGGTTTCTGGAAGGTGCAAAC ATTCCGAAAGTGTACAATTTGTATGTGTGTTCGATGGATGGAGCATGGCA AGGTGCAAGTGTTTTCAACTTTGACAACTTGGTACACTCTCCTATGGTTC CTATCAATAGAGGAGATCCTATGTGGCCAGACTGCTCAGGTATCTCTGAT GATTTTCTCGGGTTCAAAGCCAAGGGTAGACTCCTAAGTGTTCACATTAA CTCCTTCGCATATAATTCATCTTTGGGTTATAATCACAATAGTGTATAAA AGATTTTAGCAGCCTATAGACACATCAAAACGAGAGGTTTAATAGTTTAT TTTCTTATCTTCGAACCGAAAATAACTTTATTTATTTACTATTTCTCCAA AATGAGACACTCACCCCCACTCAAAAAGGATAGGAAGAGAAAGACACACA AATTTTACGAGACAGGTTTCACACTTATTCTAATAGTAATAGTCGGGTCC AAGCCTCTCAAAATAAATACATTTATTTTCCTTACCAAATANNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNAGCTGTTTGGAAGAAACCGTAAG GAATTGAAAATTCGAGTTATGCTTCATAGTCAGATACCCTCATCCTCTTC TAACTGTCCACTTACCTTTATTTTATAAAATTATACCCAATGATTTAATA GTTTTTGTCTTGTGCTCCCTCGCACCGTATATGTGCTCCCTCACACCGTA TAATGTACTCCCTCGCACCGTATATGTACTCCTTCACAATTATTTATGTA TGATAATATATCATCGTCTACTTAAAATCTACATAAATTGCTAAGGGAAG TAACTAATAGCTAATGGAACTGTGGCGAAGTTGCTAGAGTTTGCAAGAAG TTACTAGTTGAGAGCTTGCCGACGTGTGAATAGCATCACTCAGAACACCC TTTTGAATTGCACGCTTCTGATCTTTAATTTTCGGAACGCAAATTAAAAC CAAAATCGACATTTTATCCGAAACCGTAAATAAATTCATTTAGTTTGAAG ATATTTTATCTTATATTACACATTTTTTTATATAAATAACCAGCTTGTAT TGGTAAGGCTAAAGGGCTCAGATTAGCCATTTTTTTTTACTATCTCGTAA AGTATAAGTTAACCATGGCAGGCCTAGCCTGGATATCTAAGCTGTAAACT TTTTTTTCTTCTAGACGTTCCTGGTTTCCTTCAGTCTTCCTAAATCCTAA ATCGATTTATATTCTAAAATCGGAGACAGCGCATGCGTACTTTGTCGATT TAATAATTCAATAAAAGCTAAAAATTTACCGGCCCCGGGTTTACAAGCAT CTAGGTAGACCAAGCTATTGAAAACATCAAAATACAAAGCAATTTACAGC TTGGTCATTCAGGCTACTCTTGACCCATTAAGCATAAACATGGTATAATA TCAAGGATACTTTTTCACAAAATGAGTTAGAATACTGAGCCCAGGCCCTG ACGCGAAATTTTGAGTTTCTTATAATGAAAAAATGTGTAATAAACCTTGT TAGCTATCATATATGTTCACAAAATTTCTGTCTTTAGTGGGCAAGTCACC AAACGGCGTGGCGCTAGATATGCAAATCTTCAGTGGCAAATGTTCAGACC AAGCCTCTATGGAAAAGTTGAAGCGTGATTTTGTCGCAACGTTGAAGAAA GATTTCATTTGGGGAGCAGCATTCTGTTCACAACAACAACAATGTGATGT GGAGAATGCTGTTGTGTNTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000649XLOC_000649Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001196-exon-sc0000007-1575043694:937421..937677TCONS_00001196-exon-sc0000007-1575043694:937421..937677Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1575043694:935507..935704TCONS_00001196-exon-sc0000007-1575043694:935507..935704Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1575043694:934252..934464TCONS_00001196-exon-sc0000007-1575043694:934252..934464Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1575043694:933835..934026TCONS_00001196-exon-sc0000007-1575043694:933835..934026Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1575043694:933342..933530TCONS_00001196-exon-sc0000007-1575043694:933342..933530Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1575043694:932901..933152TCONS_00001196-exon-sc0000007-1575043694:932901..933152Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1575043694:932348..932596TCONS_00001196-exon-sc0000007-1575043694:932348..932596Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1575043694:931889..932161TCONS_00001196-exon-sc0000007-1575043694:931889..932161Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1575043694:930008..930190TCONS_00001196-exon-sc0000007-1575043694:930008..930190Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:937421..937677TCONS_00001196-exon-sc0000007-1510915933:937421..937677Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:935507..935704TCONS_00001196-exon-sc0000007-1510915933:935507..935704Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:934252..934464TCONS_00001196-exon-sc0000007-1510915933:934252..934464Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:933835..934026TCONS_00001196-exon-sc0000007-1510915933:933835..934026Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:933342..933530TCONS_00001196-exon-sc0000007-1510915933:933342..933530Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:932901..933152TCONS_00001196-exon-sc0000007-1510915933:932901..933152Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:932348..932596TCONS_00001196-exon-sc0000007-1510915933:932348..932596Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:931889..932161TCONS_00001196-exon-sc0000007-1510915933:931889..932161Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1510915933:930008..930190TCONS_00001196-exon-sc0000007-1510915933:930008..930190Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:937421..937677TCONS_00001196-exon-sc0000007-1491911889:937421..937677Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:935507..935704TCONS_00001196-exon-sc0000007-1491911889:935507..935704Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:934252..934464TCONS_00001196-exon-sc0000007-1491911889:934252..934464Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:933835..934026TCONS_00001196-exon-sc0000007-1491911889:933835..934026Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:933342..933530TCONS_00001196-exon-sc0000007-1491911889:933342..933530Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:932901..933152TCONS_00001196-exon-sc0000007-1491911889:932901..933152Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:932348..932596TCONS_00001196-exon-sc0000007-1491911889:932348..932596Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:931889..932161TCONS_00001196-exon-sc0000007-1491911889:931889..932161Clytia hemisphaericaexon
TCONS_00001196-exon-sc0000007-1491911889:930008..930190TCONS_00001196-exon-sc0000007-1491911889:930008..930190Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:930008..937677 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.263837 0.139226 0.128211 0.113051 0.0532484 0.0210388 0 0 0 0.0322675 0 0.0913187 3.51801 4.24964 2.19661 2.32823 1.08966 1.33037 16.0398 14.8379 2.72076 3.96066 2.01066 3.352 16.9259 12.8532 0.562474 0.294514 2.30125 3.25923
Blast
BLAST of TCONS_00001196 vs. Swiss-Prot (Human)
Match: SVEP1 (Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens GN=SVEP1 PE=1 SV=3)

HSP 1 Score: 117.472 bits (293), Expect = 8.045e-27
Identity = 107/381 (28.08%), Postives = 159/381 (41.73%), Query Frame = 2
Query:  869 CPAIKLSLNSIHLDKSCNGVDSSCTSVCRIDCKKGYKLIG-QNHVTCHGSGKWTG--KLGYCKDSEPPTITCPK-LPIPTVNNKPGTNYSIISFPNATATDNSGFPVTITTSHPS--PLKVFVHHPVEVTYTATDAVGNTNKCKRKFIVKDHEAPVVTYCPKKHRIIKTGLFPHRVFWPMPRFTDNVEADNELVFIPSVVNGTKFYQGKHSVDIKARDKSSNTGNCTMTFELQMLKCPVDAPPKHGSATCNIKNNGKVEAFICTAACQKGSWFLEGANIPKVYNLYVCSM-DGAWQGASVFNFDNLVHSPMVPINRGDPMWPDCSVGKSPNGVALDMQIF--SGKCSDQASMEKLKRDFVATLKKDFIWGAAFCSQQQQCD 1984
            C   ++  + I    +C    +   ++C + C++G+ L G +  + C  SGKW    +   CKD E P I CPK +   T+  +   N   +++   TA DNSG  V++   HP+  P  +F    V + YTATD  GN   C     V D E PV+ +C +    ++     H   W  P+F+DN  A  ELV   S   G  F QG+  V   A D S N   C +   ++   C +   P +G   C   N G      CT  C +G  F EG+      + Y C+  DG W+                        WPDC+  +  N      ++F  + +C D   M+K    F  TL K      +FCS  +  D
Sbjct:  498 CSTFQMPKDVIISPHNCGKQPAKFGTICYVSCRQGFILSGVKEMLRCTTSGKWNVGVQAAVCKDVEAPQINCPKDIEAKTLEQQDSAN---VTWQIPTAKDNSGEKVSVHV-HPAFTPPYLFPIGDVAIVYTATDLSGNQASCIFHIKVIDAEPPVIDWC-RSPPPVQVSEKVHAASWDEPQFSDNSGA--ELVITRSHTQGDLFPQGETIVQYTATDPSGNNRTCDIHIVIKGSPCEIPFTPVNGDFICTPDNTG----VNCTLTCLEGYDFTEGST-----DKYYCAYEDGVWKPTYTTE------------------WPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMV---PSFCSDAEDID 841          
The following BLAST results are available for this feature:
BLAST of TCONS_00001196 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SVEP18.045e-2728.08Sushi, von Willebrand factor type A, EGF and pentr... [more]
back to top