Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001187 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001187
Unique NameTCONS_00001187
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1921

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001187 ID=TCONS_00001187|Name=TCONS_00001187|organism=Clytia hemisphaerica|type=transcript|length=1921bp
AAGTATCTGCGAAGCCCTGATGCCATTGCTTTGAAAGTGCCCTGTATCTA
CTTCTGCTCCACAATTAAGGTTGTCGATAGTCAGAGAACGATGTTCTCTC
GTCAAATCTCCTCCAGAAATTCTTGCAATGTTAGATAAATTGTTTTCCGA
CGTCGCCGCCATGTTAACTAGCCTTCTTCAAGAACAGGTCACGTGATGTT
AGTTTTAAAATAATGACCAACTAAGCATATGATAATAAGGCAGACTTTAA
ACACGCAACTGAAACGGTCAGTTTCTaagcaatgttttgattttctacaT
CTACCCGCACCCGTATTCAAATGTTCTAATTTGACCCATATTGAATTTTC
GACAGATCAAGATCACATTTTGTGAATTTAGGAAATTTTCtattaaaacc
aaaaaaaatGGCAGATTACTGGAAATCAACTGGTAAACATTATTGTGATT
TTTGCAAATGCTGGACGGCAGATAATAAACCTAGTAtacaatttcatgaa
aaaggtaaaaatcaTCAGGCAAATGTGAAGAAAAGACTCGCAGAGATCAA
AAGAAACTCAATCGAAAAGCgaaagaaagatgaaaaatcccAACACATGT
TCCAAGAGATGGAGAAGGCTGCGTTGGCTGCCGTTCAAAAAGATATGAAT
AGCTCAGATGTGTCTATTGGTAAAGCTGACATGAGAAATATTGTCAAAGc
tcACTCTAAAACAGAAGAATCGGGAAATGATGATATTAGTAACAAAGATA
TTTATCCATGGCAAGTGATGGCTGGGCCACAAGGAACAACATATTACTAC
AATGCAACGAGTGGAGaatctACTTGGGTGATGCCAGAAATCGTGAAAAA
CCAATTAGAGAAAAAGAAACGGACTGCCGAGGACACCTCAACGAAGACTG
TCAGTAAACCATCGAAGTCATATTCATCAAGTACAAGCACTGCTTCAAAA
GATCCCTATCGTGCACAACCCAAGAAAGAAGAACCTCCTGAAGAAGTTCG
AGACTCTCATCCTTTGTTAGGTGGATGGTCGACCGTCAAACGATACGATA
ACACCGCTCAAGAAGAGACGAGCGAAGAACAAAATGTGAAAGAAGAACAG
CCGGCGGAAAAACCTACAGAGACAACGGAAGCACCCGAAAATAGCGGAAC
AACGCCTGCAGAACCTGTTGCGGGGAAAAAGTTTAAAGAGAGACAATTGA
AAACTAGTCTAGCCACAGAATCCGATGCACCAGTTGCTTTCAAGAAACGG
AAATTCGGAAACCGGAATGTTCGTAGGAGGAATGACGATGACTGATTTTT
ATGTAGAGATACATTTTTGATAGActttgtaaatattttgttttaaatcc
acttttttgtatttttgaagatagcACTgttagcttcgttgccgcctcgt
taaaatcatcaaatgtaACAATAAATTCTGTtggtatacctcttgggaat
accttgctaacaacgtcaaaatttcgactAAAGTCTtttgttgttctact
cttctcaagtcgatattcttatgacacaggctctcaactttggcaagtta
tttttttcaagtcataaaaaaaattattggagtgacaaaagggattcaaa
agtatacacgcagttgaaattctgcatttcagagttgaaaatgttgataa
aatatattgcaaactcgtgaaaaaattttaaaattttttttgtgcattag
gagtaatgttcaagctctatcaatcattttacctaaacaattcaaagaaa
taaaattacgacggaatattgtcagatttttcatttatcaattttgaaat
acaggcggcaacgaagctcgcttcaaagagacaataaaagatagatgtcc
agtcgtttatatgttcatggtagAAGACAATACGATATTGACTACAATAG
TTCAAATTTTATTCCTCCCCA
Run BLAST on NCBI

protein sequence of TCONS_00001187-protein

>TCONS_00001187-protein ID=TCONS_00001187-protein|Name=TCONS_00001187-protein|organism=Clytia hemisphaerica|type=polypeptide|length=295bp
MADYWKSTGKHYCDFCKCWTADNKPSIQFHEKGKNHQANVKKRLAEIKRN
SIEKRKKDEKSQHMFQEMEKAALAAVQKDMNSSDVSIGKADMRNIVKAHS
KTEESGNDDISNKDIYPWQVMAGPQGTTYYYNATSGESTWVMPEIVKNQL
EKKKRTAEDTSTKTVSKPSKSYSSSTSTASKDPYRAQPKKEEPPEEVRDS
HPLLGGWSTVKRYDNTAQEETSEEQNVKEEQPAEKPTETTEAPENSGTTP
AEPVAGKKFKERQLKTSLATESDAPVAFKKRKFGNRNVRRRNDDD
Run BLAST on NCBI

transcript from alignment at sc0000007:781495..790677-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001187 ID=TCONS_00001187|Name=TCONS_00001187|organism=Clytia hemisphaerica|type=transcript|length=9183bp|location=Sequence derived from alignment at sc0000007:781495..790677- (Clytia hemisphaerica)
AAGTATCTGCGAAGCCCTGATGCCATTGCTTTGAAAGTGCCCTGTATCTA CTTCTGCTCCACAATTAAGGTTGTCGATAGTCAGAGAACGATGTTCTCTC GTCAAATCTCCTCCAGAAATTCTTGCAATGTTAGATAAATTGTTTTCCGA CGTCGCCGCCATGTTAACTAGCCTTCTTCAAGAACAGGTCACGTGATGTT AGTTTTAAAATAATGACCAACTAAGCATATGATAATAAGGCAGACTTTAA ACACGCAACTGAAACGGTCAGTTTCTAAGCAATGTTTTGATTTTCTACAT CTACCCGCACCCGTATTCAAATGTTCTAATTTGACCCATATTGAATTTTC GACAGATCAAGATCACATTTTGTGAATTTAGGAAATTTTCTATTAAAACC AAAAAAAATGTAAGTATCTTTTTACTTTATCATATTGACATACTCCAAGG CTATTGCAGGATGATTTGATTCTAGAGCACTTAACAAATCATTGACAAAT CTCTTTAACAACCAGTCAGGGAAATCCCTCAATTGCGGTAGTAAATTTTT ACTGCAATTATTGCAAACGTCACTTTTACAATTTTCATATACCGCAATTG CAGTATATTCAAGAATCAGAATTCAAGATTCAAGGAAAAAACAGGCAATT TTTGTACATAATTGATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNCTTTTTGCCACCGGACAAATACACCGGACAGTCCGGTGCGTCG GCAGGGTCCTCTCATTAAAAAATGGCGTTCGTGTCTTTTCGCACTTTTTT TAGTCTAGACAATGTAGCAAACATAGTAAGTCTAAGCACACTGTGTTTTT AATTAGCTGAAACTTTTTTTTGCGACATTTGACCAAACTGTTACAATGAA AATTATCCAGCGCGCATTTTTTATCTTCTTACCTTCTTCATTTTCAATGA AGCACTCAAAGTTTACTGAAGGTAAGCACATAAGATATTCTTATAATTAA TGATATTCATTGAAACACGCTTCGTTGTGCGCTGCGGGGTGGAGTGCATG ACGTAACTCGCGCGGCAACTAACTCACCTTCTGTTGGAAGATCATATTGG GCTTATTAGCGTTACCACCCTCGAAGCAGCGGGCGCCTTTGTCTTCCAGC AACTTTTTCCGCCATTTTAGATGGCCTTAACAATAGATCCAAAAGGGCGC CATAATCTTGGAAAATAATTTGTTTCGGTCTCCGGCTTTGGGAAGTAGCA ATGTTTATGGTTGTTTTCGATGGAAAATGGTAAGAGACTTAAGGTAGCTT TTGCTGGCTTATAGAATGGCAGGATCCTGGATGGTTTCCCTATCTGTCTT TTTAACACACAGACAAAATATTTTTTCTGTAGATCAGATTCTTTTAATGC GATTTTTTATAGTCGATGTTTGTTTATCTTTGTCGACCAGCACTATATGT AGTCATTATAAGCCTTTGTAGGCTAAACACGAATGAAAACTACCGCAATT GAGGGATTTCCCTGACTGACAGCCATCCTCGTAAGCATGACATAAATAAC AACGCAGCCAGACGAAATGATAAAAACAGTGTCACAGTTATTCATTATGA TCAAGCTGATTGTCCCCTAATGTATCATGCACCCTTAGCGTGTCAGGAAC TCGACTGCTACACCATAGTTGAATTGTCAACCCATTCTCTTTGCAATCAC TTAAATAACAGTTTATATGAATTGCAATAAATACTTGTATTTTTTCTTTA TAACGTGAGTTACTTTATGGAAGTCTGAAACTTCCCAACCTCTTGCGTGT GTAATACCTTAGTTTTCCCTAGTTTTTAACCCTTTTGTTAAATTTTAGTC ACAAGGTTTTATACTGACAGTATAGACCTAACTCTTCATATAAAATTTAT GGTAAAGGCATGTTTGGACTTTGTACCTTATCTATGCTGCACTTAAGCCA AAGTCCCGCAAAGGCAAGACAAAAATCATTTTTTTTAAGTTTGCAAAAAA ACGCCACATAAAAGATCTTTCAAATTCAGTATGTGAACAGAGCAGTAAAA ATACAACTTTTCTATCTTTCCTGCCTTTTTTTTGCAAAGGTTCTACCGGG TGTGCCACAAAAAATTTACACTCTTCGATTTGATATTGCAGGCAGTAGCA GAAAGATTTTTCAAAGATTGTTTCGGAATCATTCAGAGGAAAGCCTAACT TAAAATTTGGTGTATTACTTTTTCATTTTACTTTATTGGTTCAAAAGTTA TGTTCAAAAACCTAAAATGTCAATTTTAAAAAATGTCAAAAAAGGCATAA GACGTTTTACCTAAAGTTTCACATAGTTTTCTAAGAATTCCCTTCATACA TAGCTGTCCCCCAGCCAGCCTTACTAAACTTTTCTGGTCAAGCTAGGGTA AGTAACAAGACCAAGCTACTGTATTATGAAATATTTAATTTATTCAATAG TTGTGAAAATGCATATTCTAGTCTATATACTAAAAGTCTAATGTGAGTGA GCCGTGGGGGGGCCATTATGGATTTTTTTCCAAGTTTCTTTTTAAATCGA GCTCCGAGGGGGAAAACAGTAGAGTTTTTTTTTTGAGGCGGAGTACGTTT CTTTTGAGACACGTCATCGGAAAACATGCCTACGGTTCCTTGCCGATCGG GAAACGTCGCCCGGTTCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTCGCCCGGTTCGG AAGCGTATTTTTGATCGGACCATACTGCTTTCTAACAGTCAAAATAAAGA TGGCGGCAAAAAAACAACTGGTTGCTACTGCTCATTTGCTCTTTTTCTTT GTGTTTTATGCTTTAATGAGTTGAATTGGATCATGATTTTTGTGTAATTG TTACAAGAAATGGACGATGATGAAGTTTATTGTTAATCTTTCCTGGATTT GATGCTTCGTTTGGTTTGGCATGAGAGATGCAATCTCTTCTCTTCTATTN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNGATCATGCTAGGTATATTTGAAAAATTAAACCGCCTCACTTTG TAGACCGACCGACCGCCTCACTTTGTAGACCGACCGACCGCCTCACTTTG TAGACCGGCCGACTCACTTATTAGACCGGCCGCCGACTCACTTATTAGAC CGACCGACTCACTTTTTAGACCGACCGACTCACTTTTTAGACCAACCGAC TCACTTTTTAGACCGGCCGACTCACTTATTAGACCGGCCGACTCACTTAN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNCTCACTTTTTAGACCGACCGACTCACTTTTTAGAC CGACTGACTCACTTTTTAGACCGACCGACTCACTTTTTAGACCGACCGAC TCACTTTTTAGAACAGCCGACTCACTTATTAGACCGGCCGACTCACTTAT TAGACCGACCGACTCACTTATTAGACCGACCGACTCACTTATTAAACCGA CCAACTCACTTATTAGACCGACCGACTCACTTTTTAAACCGACTGACTCA CTTTTTAGACCGACCGACTGACTCACTTTTTAGACCGACCGACTCACTTT TTAGAACGACCGACCGACTCACTTTTTAGAACGACCGACTCACTTTTAAG ACCGACCGACTCACTTTTTAGACCGACCGACTCACTTTTTAGACCGACCG ACCGACTCACTTTTTAGACCGACCGACCGACTCACTTTTTAGACCGACCG ACCGACCGACTCACTTTTTAGACCGCCCGACTCACTTTTTAGAACGCCCG ACCGACTCACTTTTTAGACCGCCCGACTCACTTTTTAGCCCGACCGACCG ACCGACTCACTTTGTAGACCGACCGACTCACTTTTTACACCGACCGACTC ACTTTCTAGGCCGACCGACCGACTCACTTTTTAGACCGACCGACTCACTT TTTAGACCGACCGACTCACTTTTTAGAACGACCGACCGACTCACTTTTTA GAACGACCAACTCACTTTTTAGATCGACCGACTCACTTTTTAGGGTCCAA ATGACGTCACAAAACAATAAATTTGCAATATTTTTAGTTTTCAACCATTT AAAGTAGTAATTTTTCGTTGTCTGGATTTACCAACCAGATCTTTTTACCC TCCCCACCATCCAAAGGGCTTATGATGCGTTCAGCTTATCTACTCCTCGG CGGGTGCGACATAATAAACTTGACATTTTCTTCCACGTGCGTTTAAAACG TGGAAAACTTTTGGTTGTGAATTTGGACGTTTTCTTCCCTGTGCGTTTAA AATGTGGAAAACTTTCAATTTTGTCGTAAACTTGACATTTTCTTCCACGT GCGTTTAAAACGTGGAAATTTTTGCTGTGAATTGATGTGTTCAACAACAT TCTACGCGGCGGGTGCGACGCCGGGTGACGGCTAGTTTGGCTACTATAAG TGTTGTTCCAAGTGTTATGAAAGAAGTTTTTATGTTTCTTTGCTTTAGTG TCAAATATGTCTACAAGGTAAAAGTATTCTGCATGTCTCGCTTAACTTTC TTCTTTTCAAATTCAGGGCAGATTACTGGAAATCAACTGGTAAACATTAT TGTGATTTTTGCAAATGCTGGACGGCAGATAATAAACCTGTAAGTAATAT TGAGACTGGGGTAATATCGGGTCTTCTACACAGGGCTTAAAAATCAGTAA AATAGCCTGGTCCATATTAAGTCAATTAGACAATTAGGGTCAGACGTGTC TGATTATTTTTTTAGCGAAACTGGACATCTACAATGAATGAGTATTTCTC CTTTTCCTCAAACACATATGTACTGAAGTTATATATTGAACAAAGGATCA AGACAAAAATACCATTAGAATACCGCTAGAAATTTCCAATTATGTACTGA AGTTACAATTCTATCGTATTCATTTGAGTACTATTTAAGTTTAATTGAAA ATCTCAAGAAATTTTTAGATATTTCACTTTTCACTAAATCAAACATAGAA GGACATTGCGTTTTGTTGCTTTCATTCTCCTTTTTAGAGTATACAATTTC ATGAAAAAGGTAAAAATCATCAGGCAAATGTGAAGAAAAGACTCGCAGAG GTAATTTTTTTGTGTTCGATTTTCTACATTTTGATAATAACAAACATCTA TTATGCAAATGGTAAATTATTGTTATTAGCAAAATTACCATCTTACATTT TCTTTATTCCCTCATTCTCATGCTTTTCAGATCAAAAGAAACTCAATCGA AAAGCGAAAGAAAGATGAAAAATCCCAACACATGTTCCAAGAGATGGAGA AGGTAACCCACTTTGATTCCCGACAAAATGTTCAAAATTATCTTTCATGA TTTCCTGTAAGTTTGTACCTTGTTTGACCCATTTGATTTCACTCATAAGA AAACATATAATAAGTGAAATATAACATATCTATCTATCTCTACACAAATT CCTTCCTTTATTTTAGGCTGCGTTGGCTGCCGTTCAAAAAGATATGAATA GCTCAGATGTGTCTATTGGTAAAGCTGACATGAGAAATATTGTCAAAGGT GCACACCATTTTATGTCATTAAACTGTGGAAGAAGATGAAAGGATAATGT CAAAATAATTTTAAAATGTTTTGTAAAATTGAAAAATACAAAAGTACCTA GTTTGTAAACTTAAAGTCTTAGAATAAGGAGGCTTTAGAAGCATGAGCAA TCGACGATCAAACTTAAATTTCAAATCGAAATAACAGAAGAGGTGTTTCA TTATTGTACCAATTACTTTCTTTTGAAAAAATAGCTCACTCTAAAACAGA AGAATCGGGAAATGATGATATTAGTAACAAAGATATTTATCCATGGCAAG TGATGGCTGGGCCACAAGGAACAACATATTACTACAATGCAACGAGTGGA GGTATTGTTGACGACTAGTCGTTCCTTCTGAGGTATACCTTTGTATCGTT TGTCTCATCTCTTGGTTTTATTTGTACAAGATTACTCTTTTAAAAAGTAT ACAGCTTAATGATATACCAAGATTTCTTTAGTGGTCTTGTAATCTCTGGG TAACATTATCGTTTTTTTGAAGGGTTTACGGATGATATTTAACACAATTT TTGATATATTTTTTCCTTCAAAGAATCTACTTGGGTGATGCCAGAAATCG TGAAAAACCAATTAGAGAAAAAGAAACGGTTCGTGTCATGTGATTTCTAT AATTCGTTTGTTTCTAAGAATAAGTAATAGTTACCGCACGGTACAGAGCA CAAAAACGGGATCAACTTGAAAAATATCAGCAAACCTTTCTCTCTCCATT TCATTATTTGTGTTTTCTCTCTTCTTTGTTTTTTTTTCACTTTCTGTATT TTGGTGAAATCAACATCAAAACATTCAAATCTTCGAAAATGATTCGAATG GTCATTAAAGTATTAAAACATGACAACTTTTGTGAGTATTGAGAGAAAAA ATAAAAACATTCTTGAGAATAACTTTTGGGATAAGATACAAAAGTAAGTA CAAAATATGATATCTCGCTTGCCAGACCCCTTTTTTGAATGAATTCTTGT ATTTGCACGGTACATTTATGTACGCGTTTTTAGCCAATCAGATTGCTCAT ATTCTACATGTTAACGATAAACTCGAACAACCCCTGGTTGTATAATAGTG TCTAATTGACAAAGAGCGTGCTTGATTTATTGTTCTTTCAGGACTGCCGA GGACACCTCAACGAAGACTGTCAGTAAACCATCGAAGGTAGCTTTTGCAA AGTTTTTTTCTATATATTTTTCATTTGCTTCCCTTTATTCATGTTTTCCT AGAATTATAAATCCGTCATCTGACGTCCATTTACTTTCACTAAGACGATA TTGTCGTCAACTAAATTACGTTTAATTACCATTGATGGGTACAAAATATG TTGACCATAACAACTTTGATAGGTTTTCAACTTACAAAAACCTTGTAAAA ATGCTTGAAATGGATAGGTAACATAATTGAAAATAATTGAGTGTGACTTA CGGAGATTTTGCGCATACTTTCTTCGTCATCCATGCTGGACCCTGTCATC TCGTTGTTATCAAGTTTCTAGCAATCAGCTGATTTTCTCTCCCCTCTCTT CTCTCGAAATAAACACACGCTATAAAAGCTAATTATCAGAAAGTCAGATA AAGAAAAGACAGGGTTTTGAGAGAAGTTCACCTTATAATTTTTTTTTGAG TTAGCTTCCGTCTGTAGCATTATGACGAGAAATGAAAAGAAATGACTCTT ATTTTTGATCCTCTTTTAAAACCTACACTTATTGTCAATTTCCCTTGATT TCTTTACTCTTTAGAAGAGAGTTACCAAGACAACCCGATATCATTGTCAA CTTTTAAACTCTTTTTGATTATCAGTGTTCATAATTCATATGTTTATCCA AAACTAACTGACCATTATCCATAAACGTTTTACATTCAAGCCCAGTGATT GATGTTACATATTCCTTGCAACAAGAAAGGACAGAGTTCGAGAAAAGTTC CTCGGAGAGATTTATTTTGTACGAAAATATTTTGAGAATACACAAAAATG AACTCTCCTTTCCCTTCAGTCATATTCATCAAGTACAAGCACTGCTTCAA AAGATCCCTATCGTGCACAACCCAAGAAAGAAGAACCTCCTGAAGAAGTT CGAGACTCTCATCCTTTGTTAGGTGGATGGTCGACCGTCAAACGATACGA TAACACCGCTCAAGAAGAGACGAGCGAAGAACAAAATGTGAAAGAAGAAC AGCCGTAAGTCTTCCCCTGACTAGAGAGAATTTGTTTAGTTTTTTTAGGA AAAGACCAATTGCCTCGGTCATCAATTACATGGTTTTCTACTCGCAGATC GTAAAACCTGTGTTTTGCTCTGCTTCAAAGGGTTTGAGTTCCTTTTTGAC TTCAATCGTTCTTATGAATGTGAACTTTGAACTTTTGGTTAAGTCAAATG TCAAGGATTAAGTAATGTTGTACAAGATTAAGAAGGAATTGATGTTTACT TACTCAAAATCTAGGGCGGAAAAACCTACAGAGACAACGGAAGCACCCGA AAATAGCGGAACAACGCCTGCAGAACCTGTTGCGGGGAAAAAGTTTAAAG AGAGACAATTGAAAACTAGTCTAGCCACAGAATCCGATGCACCAGTTGCT TTCAAGAAACGGAAATTCGGAAACCGGAATGTTCGTAGGAGGAATGACGA TGACTGATTTTTATGTAGAGATACATTTTTGATAGACTTTGTAAATATTT TGTTTTAAATCCACTTTTTTGTATTTTTGAAGATAGCACTGTTAGCTTCG TTGCCGCCTCGTTAAAATCATCAAATGTAACAATAAATTCTGTTGGTATA CCTCTTGGGAATACCTTGCTAACAACGTCAAAATTTCGACTAAAGTCTTT TGTTGTTCTACTCTTCTCAAGTCGATATTCTTATGACACAGGCTCTCAAC TTTGGCAAGTTATTTTTTTCAAGTCATAAAAAAAATTATTGGAGTGACAA AAGGGATTCAAAAGTATACACGCAGTTGAAATTCTGCATTTCAGAGTTGA AAATGTTGATAAAATATATTGCAAACTCGTGAAAAAATTTTAAAATTTTT TTTGTGCATTAGGAGTAATGTTCAAGCTCTATCAATCATTTTACCTAAAC AATTCAAAGAAATAAAATTACGACGGAATATTGTCAGATTTTTCATTTAT CAATTTTGAAATACAGGCGGCAACGAAGCTCGCTTCAAAGAGACAATAAA AGATAGATGTCCAGTCGTTTATATGTTCATGGTAGAAGACAATACGATAT TGACTACAATAGTTCAAATTTTATTCCTCCCCA

Coding sequence (CDS) from alignment at sc0000007:781495..790677-

>TCONS_00001187 ID=TCONS_00001187|Name=TCONS_00001187|organism=Clytia hemisphaerica|type=CDS|length=8880bp|location=Sequence derived from alignment at sc0000007:781495..790677- (Clytia hemisphaerica)
GGCGGAAAAACCTACAGAGACAACGGAAGCACCCGAAAATAGCGGAACAA
CGCCTGCAGAACCTGTTGCGGGGAAAAAGTTTAAAGAGAGACAATTGAAA
ACTAGTCTAGCCACAGAATCCGATGCACCAGTTGCTTTCAAGAAACGGAA
ATTCGGAAACCGGAATGTTCGTAGGAGGAATGACGATGACTGATCATATT
CATCAAGTACAAGCACTGCTTCAAAAGATCCCTATCGTGCACAACCCAAG
AAAGAAGAACCTCCTGAAGAAGTTCGAGACTCTCATCCTTTGTTAGGTGG
ATGGTCGACCGTCAAACGATACGATAACACCGCTCAAGAAGAGACGAGCG
AAGAACAAAATGTGAAAGAAGAACAGCCGACTGCCGAGGACACCTCAACG
AAGACTGTCAGTAAACCATCGAAGAATCTACTTGGGTGATGCCAGAAATC
GTGAAAAACCAATTAGAGAAAAAGAAACGCTCACTCTAAAACAGAAGAAT
CGGGAAATGATGATATTAGTAACAAAGATATTTATCCATGGCAAGTGATG
GCTGGGCCACAAGGAACAACATATTACTACAATGCAACGAGTGGAGGCTG
CGTTGGCTGCCGTTCAAAAAGATATGAATAGCTCAGATGTGTCTATTGGT
AAAGCTGACATGAGAAATATTGTCAAAGATCAAAAGAAACTCAATCGAAA
AGCGAAAGAAAGATGAAAAATCCCAACACATGTTCCAAGAGATGGAGAAG
AGTATACAATTTCATGAAAAAGGTAAAAATCATCAGGCAAATGTGAAGAA
AAGACTCGCAGAGGGCAGATTACTGGAAATCAACTGGTAAACATTATTGT
GATTTTTGCAAATGCTGGACGGCAGATAATAAACCTATGGCGGAAAAACC
TACAGAGACAACGGAAGCACCCGAAAATAGCGGAACAACGCCTGCAGAAC
CTGTTGCGGGGAAAAAGTTTAAAGAGAGACAATTGAAAACTAGTCTAGCC
ACAGAATCCGATGCACCAGTTGCTTTCAAGAAACGGAAATTCGGAAACCG
GAATGTTCGTAGGAGGAATGACGATGACTGATCATATTCATCAAGTACAA
GCACTGCTTCAAAAGATCCCTATCGTGCACAACCCAAGAAAGAAGAACCT
CCTGAAGAAGTTCGAGACTCTCATCCTTTGTTAGGTGGATGGTCGACCGT
CAAACGATACGATAACACCGCTCAAGAAGAGACGAGCGAAGAACAAAATG
TGAAAGAAGAACAGCCGACTGCCGAGGACACCTCAACGAAGACTGTCAGT
AAACCATCGAAGAATCTACTTGGGTGATGCCAGAAATCGTGAAAAACCAA
TTAGAGAAAAAGAAACGCTCACTCTAAAACAGAAGAATCGGGAAATGATG
ATATTAGTAACAAAGATATTTATCCATGGCAAGTGATGGCTGGGCCACAA
GGAACAACATATTACTACAATGCAACGAGTGGAGGCTGCGTTGGCTGCCG
TTCAAAAAGATATGAATAGCTCAGATGTGTCTATTGGTAAAGCTGACATG
AGAAATATTGTCAAAGATCAAAAGAAACTCAATCGAAAAGCGAAAGAAAG
ATGAAAAATCCCAACACATGTTCCAAGAGATGGAGAAGAGTATACAATTT
CATGAAAAAGGTAAAAATCATCAGGCAAATGTGAAGAAAAGACTCGCAGA
GGGCAGATTACTGGAAATCAACTGGTAAACATTATTGTGATTTTTGCAAA
TGCTGGACGGCAGATAATAAACCTATGGCGGAAAAACCTACAGAGACAAC
GGAAGCACCCGAAAATAGCGGAACAACGCCTGCAGAACCTGTTGCGGGGA
AAAAGTTTAAAGAGAGACAATTGAAAACTAGTCTAGCCACAGAATCCGAT
GCACCAGTTGCTTTCAAGAAACGGAAATTCGGAAACCGGAATGTTCGTAG
GAGGAATGACGATGACTGATCATATTCATCAAGTACAAGCACTGCTTCAA
AAGATCCCTATCGTGCACAACCCAAGAAAGAAGAACCTCCTGAAGAAGTT
CGAGACTCTCATCCTTTGTTAGGTGGATGGTCGACCGTCAAACGATACGA
TAACACCGCTCAAGAAGAGACGAGCGAAGAACAAAATGTGAAAGAAGAAC
AGCCGACTGCCGAGGACACCTCAACGAAGACTGTCAGTAAACCATCGAAG
AATCTACTTGGGTGATGCCAGAAATCGTGAAAAACCAATTAGAGAAAAAG
AAACGCTCACTCTAAAACAGAAGAATCGGGAAATGATGATATTAGTAACA
AAGATATTTATCCATGGCAAGTGATGGCTGGGCCACAAGGAACAACATAT
TACTACAATGCAACGAGTGGAGGCTGCGTTGGCTGCCGTTCAAAAAGATA
TGAATAGCTCAGATGTGTCTATTGGTAAAGCTGACATGAGAAATATTGTC
AAAGATCAAAAGAAACTCAATCGAAAAGCGAAAGAAAGATGAAAAATCCC
AACACATGTTCCAAGAGATGGAGAAGAGTATACAATTTCATGAAAAAGGT
AAAAATCATCAGGCAAATGTGAAGAAAAGACTCGCAGAGGGCAGATTACT
GGAAATCAACTGGTAAACATTATTGTGATTTTTGCAAATGCTGGACGGCA
GATAATAAACCTATGGCGGAAAAACCTACAGAGACAACGGAAGCACCCGA
AAATAGCGGAACAACGCCTGCAGAACCTGTTGCGGGGAAAAAGTTTAAAG
AGAGACAATTGAAAACTAGTCTAGCCACAGAATCCGATGCACCAGTTGCT
TTCAAGAAACGGAAATTCGGAAACCGGAATGTTCGTAGGAGGAATGACGA
TGACTGATCATATTCATCAAGTACAAGCACTGCTTCAAAAGATCCCTATC
GTGCACAACCCAAGAAAGAAGAACCTCCTGAAGAAGTTCGAGACTCTCAT
CCTTTGTTAGGTGGATGGTCGACCGTCAAACGATACGATAACACCGCTCA
AGAAGAGACGAGCGAAGAACAAAATGTGAAAGAAGAACAGCCGACTGCCG
AGGACACCTCAACGAAGACTGTCAGTAAACCATCGAAGAATCTACTTGGG
TGATGCCAGAAATCGTGAAAAACCAATTAGAGAAAAAGAAACGCTCACTC
TAAAACAGAAGAATCGGGAAATGATGATATTAGTAACAAAGATATTTATC
CATGGCAAGTGATGGCTGGGCCACAAGGAACAACATATTACTACAATGCA
ACGAGTGGAGGCTGCGTTGGCTGCCGTTCAAAAAGATATGAATAGCTCAG
ATGTGTCTATTGGTAAAGCTGACATGAGAAATATTGTCAAAGATCAAAAG
AAACTCAATCGAAAAGCGAAAGAAAGATGAAAAATCCCAACACATGTTCC
AAGAGATGGAGAAGAGTATACAATTTCATGAAAAAGGTAAAAATCATCAG
GCAAATGTGAAGAAAAGACTCGCAGAGGGCAGATTACTGGAAATCAACTG
GTAAACATTATTGTGATTTTTGCAAATGCTGGACGGCAGATAATAAACCT
ATGGCGGAAAAACCTACAGAGACAACGGAAGCACCCGAAAATAGCGGAAC
AACGCCTGCAGAACCTGTTGCGGGGAAAAAGTTTAAAGAGAGACAATTGA
AAACTAGTCTAGCCACAGAATCCGATGCACCAGTTGCTTTCAAGAAACGG
AAATTCGGAAACCGGAATGTTCGTAGGAGGAATGACGATGACTGATCATA
TTCATCAAGTACAAGCACTGCTTCAAAAGATCCCTATCGTGCACAACCCA
AGAAAGAAGAACCTCCTGAAGAAGTTCGAGACTCTCATCCTTTGTTAGGT
GGATGGTCGACCGTCAAACGATACGATAACACCGCTCAAGAAGAGACGAG
CGAAGAACAAAATGTGAAAGAAGAACAGCCGACTGCCGAGGACACCTCAA
CGAAGACTGTCAGTAAACCATCGAAGAATCTACTTGGGTGATGCCAGAAA
TCGTGAAAAACCAATTAGAGAAAAAGAAACGCTCACTCTAAAACAGAAGA
ATCGGGAAATGATGATATTAGTAACAAAGATATTTATCCATGGCAAGTGA
TGGCTGGGCCACAAGGAACAACATATTACTACAATGCAACGAGTGGAGGC
TGCGTTGGCTGCCGTTCAAAAAGATATGAATAGCTCAGATGTGTCTATTG
GTAAAGCTGACATGAGAAATATTGTCAAAGATCAAAAGAAACTCAATCGA
AAAGCGAAAGAAAGATGAAAAATCCCAACACATGTTCCAAGAGATGGAGA
AGAGTATACAATTTCATGAAAAAGGTAAAAATCATCAGGCAAATGTGAAG
AAAAGACTCGCAGAGGGCAGATTACTGGAAATCAACTGGTAAACATTATT
GTGATTTTTGCAAATGCTGGACGGCAGATAATAAACCTATGGCGGAAAAA
CCTACAGAGACAACGGAAGCACCCGAAAATAGCGGAACAACGCCTGCAGA
ACCTGTTGCGGGGAAAAAGTTTAAAGAGAGACAATTGAAAACTAGTCTAG
CCACAGAATCCGATGCACCAGTTGCTTTCAAGAAACGGAAATTCGGAAAC
CGGAATGTTCGTAGGAGGAATGACGATGACTGATCATATTCATCAAGTAC
AAGCACTGCTTCAAAAGATCCCTATCGTGCACAACCCAAGAAAGAAGAAC
CTCCTGAAGAAGTTCGAGACTCTCATCCTTTGTTAGGTGGATGGTCGACC
GTCAAACGATACGATAACACCGCTCAAGAAGAGACGAGCGAAGAACAAAA
TGTGAAAGAAGAACAGCCGACTGCCGAGGACACCTCAACGAAGACTGTCA
GTAAACCATCGAAGAATCTACTTGGGTGATGCCAGAAATCGTGAAAAACC
AATTAGAGAAAAAGAAACGCTCACTCTAAAACAGAAGAATCGGGAAATGA
TGATATTAGTAACAAAGATATTTATCCATGGCAAGTGATGGCTGGGCCAC
AAGGAACAACATATTACTACAATGCAACGAGTGGAGGCTGCGTTGGCTGC
CGTTCAAAAAGATATGAATAGCTCAGATGTGTCTATTGGTAAAGCTGACA
TGAGAAATATTGTCAAAGATCAAAAGAAACTCAATCGAAAAGCGAAAGAA
AGATGAAAAATCCCAACACATGTTCCAAGAGATGGAGAAGAGTATACAAT
TTCATGAAAAAGGTAAAAATCATCAGGCAAATGTGAAGAAAAGACTCGCA
GAGGGCAGATTACTGGAAATCAACTGGTAAACATTATTGTGATTTTTGCA
AATGCTGGACGGCAGATAATAAACCTATGGCGGAAAAACCTACAGAGACA
ACGGAAGCACCCGAAAATAGCGGAACAACGCCTGCAGAACCTGTTGCGGG
GAAAAAGTTTAAAGAGAGACAATTGAAAACTAGTCTAGCCACAGAATCCG
ATGCACCAGTTGCTTTCAAGAAACGGAAATTCGGAAACCGGAATGTTCGT
AGGAGGAATGACGATGACTGATCATATTCATCAAGTACAAGCACTGCTTC
AAAAGATCCCTATCGTGCACAACCCAAGAAAGAAGAACCTCCTGAAGAAG
TTCGAGACTCTCATCCTTTGTTAGGTGGATGGTCGACCGTCAAACGATAC
GATAACACCGCTCAAGAAGAGACGAGCGAAGAACAAAATGTGAAAGAAGA
ACAGCCGACTGCCGAGGACACCTCAACGAAGACTGTCAGTAAACCATCGA
AGAATCTACTTGGGTGATGCCAGAAATCGTGAAAAACCAATTAGAGAAAA
AGAAACGCTCACTCTAAAACAGAAGAATCGGGAAATGATGATATTAGTAA
CAAAGATATTTATCCATGGCAAGTGATGGCTGGGCCACAAGGAACAACAT
ATTACTACAATGCAACGAGTGGAGGCTGCGTTGGCTGCCGTTCAAAAAGA
TATGAATAGCTCAGATGTGTCTATTGGTAAAGCTGACATGAGAAATATTG
TCAAAGATCAAAAGAAACTCAATCGAAAAGCGAAAGAAAGATGAAAAATC
CCAACACATGTTCCAAGAGATGGAGAAGAGTATACAATTTCATGAAAAAG
GTAAAAATCATCAGGCAAATGTGAAGAAAAGACTCGCAGAGGGCAGATTA
CTGGAAATCAACTGGTAAACATTATTGTGATTTTTGCAAATGCTGGACGG
CAGATAATAAACCTATGGCGGAAAAACCTACAGAGACAACGGAAGCACCC
GAAAATAGCGGAACAACGCCTGCAGAACCTGTTGCGGGGAAAAAGTTTAA
AGAGAGACAATTGAAAACTAGTCTAGCCACAGAATCCGATGCACCAGTTG
CTTTCAAGAAACGGAAATTCGGAAACCGGAATGTTCGTAGGAGGAATGAC
GATGACTGATCATATTCATCAAGTACAAGCACTGCTTCAAAAGATCCCTA
TCGTGCACAACCCAAGAAAGAAGAACCTCCTGAAGAAGTTCGAGACTCTC
ATCCTTTGTTAGGTGGATGGTCGACCGTCAAACGATACGATAACACCGCT
CAAGAAGAGACGAGCGAAGAACAAAATGTGAAAGAAGAACAGCCGACTGC
CGAGGACACCTCAACGAAGACTGTCAGTAAACCATCGAAGAATCTACTTG
GGTGATGCCAGAAATCGTGAAAAACCAATTAGAGAAAAAGAAACGCTCAC
TCTAAAACAGAAGAATCGGGAAATGATGATATTAGTAACAAAGATATTTA
TCCATGGCAAGTGATGGCTGGGCCACAAGGAACAACATATTACTACAATG
CAACGAGTGGAGGCTGCGTTGGCTGCCGTTCAAAAAGATATGAATAGCTC
AGATGTGTCTATTGGTAAAGCTGACATGAGAAATATTGTCAAAGATCAAA
AGAAACTCAATCGAAAAGCGAAAGAAAGATGAAAAATCCCAACACATGTT
CCAAGAGATGGAGAAGAGTATACAATTTCATGAAAAAGGTAAAAATCATC
AGGCAAATGTGAAGAAAAGACTCGCAGAGGGCAGATTACTGGAAATCAAC
TGGTAAACATTATTGTGATTTTTGCAAATGCTGGACGGCAGATAATAAAC
CTATGGCGGAAAAACCTACAGAGACAACGGAAGCACCCGAAAATAGCGGA
ACAACGCCTGCAGAACCTGTTGCGGGGAAAAAGTTTAAAGAGAGACAATT
GAAAACTAGTCTAGCCACAGAATCCGATGCACCAGTTGCTTTCAAGAAAC
GGAAATTCGGAAACCGGAATGTTCGTAGGAGGAATGACGATGACTGATCA
TATTCATCAAGTACAAGCACTGCTTCAAAAGATCCCTATCGTGCACAACC
CAAGAAAGAAGAACCTCCTGAAGAAGTTCGAGACTCTCATCCTTTGTTAG
GTGGATGGTCGACCGTCAAACGATACGATAACACCGCTCAAGAAGAGACG
AGCGAAGAACAAAATGTGAAAGAAGAACAGCCGACTGCCGAGGACACCTC
AACGAAGACTGTCAGTAAACCATCGAAGAATCTACTTGGGTGATGCCAGA
AATCGTGAAAAACCAATTAGAGAAAAAGAAACGCTCACTCTAAAACAGAA
GAATCGGGAAATGATGATATTAGTAACAAAGATATTTATCCATGGCAAGT
GATGGCTGGGCCACAAGGAACAACATATTACTACAATGCAACGAGTGGAG
GCTGCGTTGGCTGCCGTTCAAAAAGATATGAATAGCTCAGATGTGTCTAT
TGGTAAAGCTGACATGAGAAATATTGTCAAAGATCAAAAGAAACTCAATC
GAAAAGCGAAAGAAAGATGAAAAATCCCAACACATGTTCCAAGAGATGGA
GAAGAGTATACAATTTCATGAAAAAGGTAAAAATCATCAGGCAAATGTGA
AGAAAAGACTCGCAGAGGGCAGATTACTGGAAATCAACTGGTAAACATTA
TTGTGATTTTTGCAAATGCTGGACGGCAGATAATAAACCTATGGCGGAAA
AACCTACAGAGACAACGGAAGCACCCGAAAATAGCGGAACAACGCCTGCA
GAACCTGTTGCGGGGAAAAAGTTTAAAGAGAGACAATTGAAAACTAGTCT
AGCCACAGAATCCGATGCACCAGTTGCTTTCAAGAAACGGAAATTCGGAA
ACCGGAATGTTCGTAGGAGGAATGACGATGACTGATCATATTCATCAAGT
ACAAGCACTGCTTCAAAAGATCCCTATCGTGCACAACCCAAGAAAGAAGA
ACCTCCTGAAGAAGTTCGAGACTCTCATCCTTTGTTAGGTGGATGGTCGA
CCGTCAAACGATACGATAACACCGCTCAAGAAGAGACGAGCGAAGAACAA
AATGTGAAAGAAGAACAGCCGACTGCCGAGGACACCTCAACGAAGACTGT
CAGTAAACCATCGAAGAATCTACTTGGGTGATGCCAGAAATCGTGAAAAA
CCAATTAGAGAAAAAGAAACGCTCACTCTAAAACAGAAGAATCGGGAAAT
GATGATATTAGTAACAAAGATATTTATCCATGGCAAGTGATGGCTGGGCC
ACAAGGAACAACATATTACTACAATGCAACGAGTGGAGGCTGCGTTGGCT
GCCGTTCAAAAAGATATGAATAGCTCAGATGTGTCTATTGGTAAAGCTGA
CATGAGAAATATTGTCAAAGATCAAAAGAAACTCAATCGAAAAGCGAAAG
AAAGATGAAAAATCCCAACACATGTTCCAAGAGATGGAGAAGAGTATACA
ATTTCATGAAAAAGGTAAAAATCATCAGGCAAATGTGAAGAAAAGACTCG
CAGAGGGCAGATTACTGGAAATCAACTGGTAAACATTATTGTGATTTTTG
CAAATGCTGGACGGCAGATAATAAACCTAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000644XLOC_000644Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001187-proteinTCONS_00001187-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001187-exon-sc0000007-1575043694:790269..790677TCONS_00001187-exon-sc0000007-1575043694:790269..790677Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:785689..785761TCONS_00001187-exon-sc0000007-1575043694:785689..785761Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:785228..785290TCONS_00001187-exon-sc0000007-1575043694:785228..785290Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:785026..785097TCONS_00001187-exon-sc0000007-1575043694:785026..785097Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:784780..784861TCONS_00001187-exon-sc0000007-1575043694:784780..784861Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:784427..784543TCONS_00001187-exon-sc0000007-1575043694:784427..784543Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:784150..784204TCONS_00001187-exon-sc0000007-1575043694:784150..784204Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:783591..783636TCONS_00001187-exon-sc0000007-1575043694:783591..783636Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:782574..782758TCONS_00001187-exon-sc0000007-1575043694:782574..782758Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1575043694:781495..782313TCONS_00001187-exon-sc0000007-1575043694:781495..782313Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:790269..790677TCONS_00001187-exon-sc0000007-1510915933:790269..790677Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:785689..785761TCONS_00001187-exon-sc0000007-1510915933:785689..785761Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:785228..785290TCONS_00001187-exon-sc0000007-1510915933:785228..785290Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:785026..785097TCONS_00001187-exon-sc0000007-1510915933:785026..785097Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:784780..784861TCONS_00001187-exon-sc0000007-1510915933:784780..784861Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:784427..784543TCONS_00001187-exon-sc0000007-1510915933:784427..784543Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:784150..784204TCONS_00001187-exon-sc0000007-1510915933:784150..784204Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:783591..783636TCONS_00001187-exon-sc0000007-1510915933:783591..783636Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:782574..782758TCONS_00001187-exon-sc0000007-1510915933:782574..782758Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1510915933:781495..782313TCONS_00001187-exon-sc0000007-1510915933:781495..782313Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:790269..790677TCONS_00001187-exon-sc0000007-1491911889:790269..790677Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:785689..785761TCONS_00001187-exon-sc0000007-1491911889:785689..785761Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:785228..785290TCONS_00001187-exon-sc0000007-1491911889:785228..785290Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:785026..785097TCONS_00001187-exon-sc0000007-1491911889:785026..785097Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:784780..784861TCONS_00001187-exon-sc0000007-1491911889:784780..784861Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:784427..784543TCONS_00001187-exon-sc0000007-1491911889:784427..784543Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:784150..784204TCONS_00001187-exon-sc0000007-1491911889:784150..784204Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:783591..783636TCONS_00001187-exon-sc0000007-1491911889:783591..783636Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:782574..782758TCONS_00001187-exon-sc0000007-1491911889:782574..782758Clytia hemisphaericaexon
TCONS_00001187-exon-sc0000007-1491911889:781495..782313TCONS_00001187-exon-sc0000007-1491911889:781495..782313Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:781495..790677 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.50467 2.97391 3.0743 2.34606 7.8442 5.43739 4.79477 6.47267 3.75485 3.07426 2.39764 3.34525 1.87255 1.90943 2.5761 3.02585 6.31332 3.92661 0 0.357419 2.06161 2.5979 7.49948 5.75788 2.03991 2.39119 2.85478 2.69054 4.46923 3.11507
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003604Matrin/U1-like-C_Znf_C2H2
IPR013085U1-CZ_Znf_C2H2
IPR001202WW_dom
IPR000690Matrin/U1-C_Znf_C2H2
IPR013087Znf_C2H2_type
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005634 nucleus
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0005515 protein binding
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00001187 vs. Swiss-Prot (Human)
Match: WBP4 (WW domain-binding protein 4 OS=Homo sapiens GN=WBP4 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.374e-24
Identity = 63/162 (38.89%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  408 MADYWKSTGKHYCDFCKCWTADNKPSIQFHEKGKNHQANVKKRLAEIKRNSIEKRKKDEKSQHMFQEMEKAALAAVQKDMNSSDV--SIGKADMRNIVKAHSKTEESGNDDISNKDIYP--------WQVMAGPQGTTYYYNATSGESTWVMPEIVKNQLEK 863
            MADYWKS  K +CD+CKCW ADN+PS++FHE+GKNH+ NV KR++EIK+ S++K K++EK+   F  ME AAL A Q+D+    +   I +  +  +      T  S       +            W      +G  YYY+  SG S W  PE  +  L+K
Sbjct:    1 MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKK 162          
The following BLAST results are available for this feature:
BLAST of TCONS_00001187 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
WBP41.374e-2438.89WW domain-binding protein 4 OS=Homo sapiens GN=WBP... [more]
back to top