Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001155 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001155
Unique NameTCONS_00001155
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1901

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001155 ID=TCONS_00001155|Name=TCONS_00001155|organism=Clytia hemisphaerica|type=transcript|length=1901bp
CTTCTATTCAAATCTTCATGGATTGAATCATGATTTGAATATTTCGATGA
TTGCTgatagaaatgaaaaaaaagtagcCCATAAAGCCATCATGGATAGA
ATTGCTTTGCAAAGGAGATTTTTGTATTTGAAAAGAATCTTCAAAGTACG
CCATATGGATTTTGAGTTTGCAATCTGGCAAATGATATATTTATTTGTAT
CTCCAAAGaaagtttttcgaaatttttcttaTCATCAAGAAACGAAGAGG
CAATGGGCAAGAGATGATCCAGCTTTCTTGGTATTATTTAGTGGCTGGCT
ATTCTTTGCATCCATAATATTTTCAGTAGCGTTAAAACTGACCTTTTTGG
AATTTGCGAAGCTCTTATTTTGGGTTATATTCATTGATTGCATTGGCTTT
GGTCTGCTTGTTGCTGGTATCTTATCATTCATTGTTAATAAATATTTGAG
ATTTCCTGGAGGTGAGcgtcaaaaagaagaagtgGAATTCGGTTACGCAT
TTGATGTCCATCTAAATGCTTTCTTCCcacttttgattattttacatatC
ATCCAGTTGCTGTACACACCACTTGCCCACGTGTCTCCTTTCCTTGGCAG
ATTTTTTGGTAATTCTTTATGGCTGATTGCTTTCATTTATTATTTCTACA
TAACATTTCTTGGTTACAGTGCATTGCCGTTCTTAAAAGGCACTGTCATC
ATCCTCTGGCCTTTAATTGgagtatttattttttatttgatttcatTGTT
TCATCCTTCATTGACATTAAGTGCAATGATCATCAATTTTTACCACCACA
GAGTTGCTGGTTGATATGTGCTGTTATTTCAATACAACAGTGTCACTTGT
ATTATGTTTATAtacatctttttttttggtagcAAAGTAACATTTTTAGC
AAAACAAGTAACTAAAAATCTTCTCTCTTTTATAGCAAAACAAGTAACTA
AAAGTTTTCTCTATTTAATTATCAGTTCTTGCCCCTTTTGAAATTGATCT
TTTAGCGATCACATCATTTCAAAACGTTTAGACAGTTTTTTTCTATCAAG
ATTTGTCTTTGCGAATGTGAGAGTATAACTTTGTTACTTTTAGTTTacat
tttgttgttttattaGGAGGATAAAGCCTGGATAAGCCTGTTTATTTATT
GTGCTTGTTTTGTATTCTTATGGTTTTTTATTATTAATTAATCTGAATTA
ATCTTTAATATTATATGTAGTAACTACCTTATTCTGGGTGTACAGTTGAT
ATGAATCTAAGACGTTATTACTCTATACTGATGCAAAGTCTATCAAAGAT
TCTTATTAACTTTAAAAGCCTCTAgaattaaaaaatctaaagcttTCTTG
AAGTCTTGAAATAATAATGTCTATTTTAATGTTTAGTGTATTCTTGCTTG
TTGATGTACACTTTTATCAATATTCTTTAAGGGCTCtaaccatagtgaat
ttttcatatttggcACGTACGAAATACAAATATCTGCCTGATGTAGCCCA
CAAAGCTTTGGCacacattttctgttaggccaactatcctCAAATCAGCT
TCtttgtttcaaaatcttgaaaatagtgaatcaaatttttcatcccaaat
tttcattgaaaaaaagtcacaaCTTTTAATACCCATTTTAGAAaactttt
tccgaaaaatttcatatagttcaattctttgcagacaattaaaaaaattc
taaataaaaaaaattaattccccATTGAAACTTAGCACTTTTAATAAAAG
AGGGGAAGATAACATTTAATCGATGTCTTTTAATcattcataacgtcatt
tttgttatTAAATTCTTATTTACTCTTTACAACAGATTTGATTAATTAAC
AATTTATAGGGacagttttttgttaaaagtgtcaaggaaACTAAATTAGA
A
Run BLAST on NCBI

protein sequence of TCONS_00001155-protein

>TCONS_00001155-protein ID=TCONS_00001155-protein|Name=TCONS_00001155-protein|organism=Clytia hemisphaerica|type=polypeptide|length=270bp
FYSNLHGLNHDLNISMIADRNEKKVAHKAIMDRIALQRRFLYLKRIFKVR
HMDFEFAIWQMIYLFVSPKKVFRNFSYHQETKRQWARDDPAFLVLFSGWL
FFASIIFSVALKLTFLEFAKLLFWVIFIDCIGFGLLVAGILSFIVNKYLR
FPGGERQKEEVEFGYAFDVHLNAFFPLLIILHIIQLLYTPLAHVSPFLGR
FFGNSLWLIAFIYYFYITFLGYSALPFLKGTVIILWPLIGVFIFYLISLF
HPSLTLSAMIINFYHHRVAG
Run BLAST on NCBI

transcript from alignment at sc0000007:531148..534362-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001155 ID=TCONS_00001155|Name=TCONS_00001155|organism=Clytia hemisphaerica|type=transcript|length=3215bp|location=Sequence derived from alignment at sc0000007:531148..534362- (Clytia hemisphaerica)
CTTCTATTCAAATCTTCATGGATTGAATCATGGTTAGTATACATAGTTAA ATTTGCTCCTGTAACCATTGTATTAAACCTTTATCATCAATTACAATAGT AAAATTTTAGGTGTACACTGATTTAAAAAGATATAAAGTGAAATCATTTA AATAAAAAATATTTAAGAATCATACAAACATTGTAAATTTTCAATGTGAC TTTGTAAGCCACTAAATTGTACTTACAATAAAAATTTTGTAATTTTTTAC ACCTACTGGTGTTATACTTTAATGATTGAATGCCAAAAACTTAAAAAATG TGAGACATAGAATTTCACCTATTCACCTATATTTCCCTTGTGTAAGCCAC ATTTTTGCCCACTTAACAAACTGTAAGCCACAAATCAGTGCAGCTAATGA AAAATTTAGCCTTTTTTTGCTGGCAATGCTGAAAAGAAAGTATATTTCTA ACTGTTTCCATTTTTGAGAACTCAGCCTTCAAAATTTCTTGTTAGGGTAA GCCACATGACCAGTAAGCCACATTTTTTACCCACACTTCATTTGCTTTAA CTCCCCTTTAAGTAAGCCACAAAAATTCGCCCTTTATGCAATGGGTAGCT AATTTGCTCTGCTTAACCATCAAAGCGATCCTAAGTGTAAGCCACATAAT TTTCACAAGTTATGGTCAATTTAGTGGCTGACAGTAAAAATGTCACAAAA CAAGGGGTTTATTTTTGATTGGGTTCGAATTTCTTATTAAACAATTGCAT GGCAATTTTTTGATTGGGTAAAATAAAAAAATTGATATCCATTGATTCGT TGACAAAATTTTTGGTGCTTTCACAAGTGTTTGCGATTGAACAAAATAAA ACAAAATAAATATTTCCCAGAGAGGGGGTGAATTTTTAGTTTTTCTTCTA TTTCTTTGCCAATCCGGGGAGTCTTCTTTTCACATAAATTCCCATTTCTT GACAGAATCTTTGATTGGTTTGATTTAAAATATATATTTAGAAAAATTCA AAAAATAGAATAAACTGTATAATTTAAAAAAAATATTAGTCTCTTTTTAT GTTTCTTTTTTATTTTATTTAGTATTTTCAACACTTGCTCTCCTTGAGGT CAGATCTCTGATCTTCACAATTATATAATTGTTTTAATGCTTGAGTTTTA ATTTTTCAACATGACATTATGCCTAATATGCTTACATAACCATGATCTTG ACCATCTTCGTTTCCTAAATATTCAAAAATATTTTGATCATTGATTACAC AATTCTAGTTTTTGTCTCTAATGGTAATAATGATACTACAAATATAACAC ATGTATTTTTTAGACCAATAAATTAGTCTTTTGTATTTACTTTTAGATTT GAATATTTCGATGATTGCTGATAGAAATGAAAAAAAAGTAGCCCATAAAG CCATCATGGATAGAATTGCTTTGCAAAGGAGATTTTTGTATTTGAAAAGA ATCTTCAAAGTACGCCATATGGATTTTGAGTTTGCAATCTGGCAAATGAT ATATTTATTTGTATCTCCAAAGAAAGTTTTTCGAAATTTTTCTTATCATC AAGAAACGAAGAGGCAATGGGCAAGAGATGATCCAGCTTTCTTGGTATTA TTTAGTGGCTGGCTATTCTTTGCATCCATAATATTTTCAGTAGCGTTAAA ACTGACCTTTTTGGAATTTGCGAAGCTCTTATTTTGGGTTATATTCATTG ATTGCATTGGCTTTGGTCTGCTTGTTGCTGGTATCTTATCATTCATTGTT AATAAATATTTGAGATTTCCTGGAGGTGAGCGTCAAAAAGAAGAAGTGGA ATTCGGTTACGCATTTGATGTCCATCTAAATGCTTTCTTCCCACTTTTGA TTATTTTACATATCATCCAGTTGCTGTACACACCACTTGCCCACGTGTCT CCTTTCCTTGGCAGATTTTTTGGTAATTCTTTATGGCTGATTGCTTTCAT TTATTATTTCTACATAACATTTCTTGGTTACAGTGCATTGCCGTTCTTAA AAGGCACTGTCATCATCCTCTGGCCTTTAATTGGAGTATTTATTTTTTAT TTGATTTCATTGTTTCATCCTTCATTGACATTAAGTGCAATGATCATCAA TTTTTACCACCACAGAGTTGCTGGTTGATATGTGCTGTTATTTCAATACA ACAGTGTCACTTGTATTATGTTTATATACATCTTTTTTTTTGGTAGCAAA GTAACATTTTTAGCAAAACAAGTAACTAAAAATCTTCTCTCTTTTATAGC AAAACAAGTAACTAAAAGTTTTCTCTATTTAATTATCAGTTCTTGCCCCT TTTGAAATTGATCTTTTAGCGATCACATCATTTCAAAACGTTTAGACAGT TTTTTTCTATCAAGATTTGTCTTTGCGAATGTGAGAGTATAACTTTGTTA CTTTTAGTTTACATTTTGTTGTTTTATTAGGAGGATAAAGCCTGGATAAG CCTGTTTATTTATTGTGCTTGTTTTGTATTCTTATGGTTTTTTATTATTA ATTAATCTGAATTAATCTTTAATATTATATGTAGTAACTACCTTATTCTG GGTGTACAGTTGATATGAATCTAAGACGTTATTACTCTATACTGATGCAA AGTCTATCAAAGATTCTTATTAACTTTAAAAGCCTCTAGAATTAAAAAAT CTAAAGCTTTCTTGAAGTCTTGAAATAATAATGTCTATTTTAATGTTTAG TGTATTCTTGCTTGTTGATGTACACTTTTATCAATATTCTTTAAGGGCTC TAACCATAGTGAATTTTTCATATTTGGCACGTACGAAATACAAATATCTG CCTGATGTAGCCCACAAAGCTTTGGCACACATTTTCTGTTAGGCCAACTA TCCTCAAATCAGCTTCTTTGTTTCAAAATCTTGAAAATAGTGAATCAAAT TTTTCATCCCAAATTTTCATTGAAAAAAAGTCACAACTTTTAATACCCAT TTTAGAAAACTTTTTCCGAAAAATTTCATATAGTTCAATTCTTTGCAGAC AATTAAAAAAATTCTAAATAAAAAAAATTAATTCCCCATTGAAACTTAGC ACTTTTAATAAAAGAGGGGAAGATAACATTTAATCGATGTCTTTTAATCA TTCATAACGTCATTTTTGTTATTAAATTCTTATTTACTCTTTACAACAGA TTTGATTAATTAACAATTTATAGGGACAGTTTTTTGTTAAAAGTGTCAAG GAAACTAAATTAGAA

Coding sequence (CDS) from alignment at sc0000007:531148..534362-

>TCONS_00001155 ID=TCONS_00001155|Name=TCONS_00001155|organism=Clytia hemisphaerica|type=CDS|length=1626bp|location=Sequence derived from alignment at sc0000007:531148..534362- (Clytia hemisphaerica)
ATTTGAATATTTCGATGATTGCTGATAGAAATGAAAAAAAAGTAGCCCAT
AAAGCCATCATGGATAGAATTGCTTTGCAAAGGAGATTTTTGTATTTGAA
AAGAATCTTCAAAGTACGCCATATGGATTTTGAGTTTGCAATCTGGCAAA
TGATATATTTATTTGTATCTCCAAAGAAAGTTTTTCGAAATTTTTCTTAT
CATCAAGAAACGAAGAGGCAATGGGCAAGAGATGATCCAGCTTTCTTGGT
ATTATTTAGTGGCTGGCTATTCTTTGCATCCATAATATTTTCAGTAGCGT
TAAAACTGACCTTTTTGGAATTTGCGAAGCTCTTATTTTGGGTTATATTC
ATTGATTGCATTGGCTTTGGTCTGCTTGTTGCTGGTATCTTATCATTCAT
TGTTAATAAATATTTGAGATTTCCTGGAGGTGAGCGTCAAAAAGAAGAAG
TGGAATTCGGTTACGCATTTGATGTCCATCTAAATGCTTTCTTCCCACTT
TTGATTATTTTACATATCATCCAGTTGCTGTACACACCACTTGCCCACGT
GTCTCCTTTCCTTGGCAGATTTTTTGGTAATTCTTTATGGCTGATTGCTT
TCATTTATTATTTCTACATAACATTTCTTGGTTACAGTGCATTGCCGTTC
TTAAAAGGCACTGTCATCATCCTCTGGCCTTTAATTGGAGTATTTATTTT
TTATTTGATTTCATTGTTTCATCCTTCATTGACATTAAGTGCAATGATCA
TCAATTTTTACCACCACAGAGTTGCTGGTTGATTCTATTCAAATCTTCAT
GGATTGAATCATGATTTGAATATTTCGATGATTGCTGATAGAAATGAAAA
AAAAGTAGCCCATAAAGCCATCATGGATAGAATTGCTTTGCAAAGGAGAT
TTTTGTATTTGAAAAGAATCTTCAAAGTACGCCATATGGATTTTGAGTTT
GCAATCTGGCAAATGATATATTTATTTGTATCTCCAAAGAAAGTTTTTCG
AAATTTTTCTTATCATCAAGAAACGAAGAGGCAATGGGCAAGAGATGATC
CAGCTTTCTTGGTATTATTTAGTGGCTGGCTATTCTTTGCATCCATAATA
TTTTCAGTAGCGTTAAAACTGACCTTTTTGGAATTTGCGAAGCTCTTATT
TTGGGTTATATTCATTGATTGCATTGGCTTTGGTCTGCTTGTTGCTGGTA
TCTTATCATTCATTGTTAATAAATATTTGAGATTTCCTGGAGGTGAGCGT
CAAAAAGAAGAAGTGGAATTCGGTTACGCATTTGATGTCCATCTAAATGC
TTTCTTCCCACTTTTGATTATTTTACATATCATCCAGTTGCTGTACACAC
CACTTGCCCACGTGTCTCCTTTCCTTGGCAGATTTTTTGGTAATTCTTTA
TGGCTGATTGCTTTCATTTATTATTTCTACATAACATTTCTTGGTTACAG
TGCATTGCCGTTCTTAAAAGGCACTGTCATCATCCTCTGGCCTTTAATTG
GAGTATTTATTTTTTATTTGATTTCATTGTTTCATCCTTCATTGACATTA
AGTGCAATGATCATCAATTTTTACCACCACAGAGTTGCTGGTTGATTCTA
TTCAAATCTTCATGGATTGAATCATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000632XLOC_000632Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001155-proteinTCONS_00001155-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001155-exon-sc0000007-1575043694:534331..534362TCONS_00001155-exon-sc0000007-1575043694:534331..534362Clytia hemisphaericaexon
TCONS_00001155-exon-sc0000007-1575043694:531148..533016TCONS_00001155-exon-sc0000007-1575043694:531148..533016Clytia hemisphaericaexon
TCONS_00001155-exon-sc0000007-1510915933:534331..534362TCONS_00001155-exon-sc0000007-1510915933:534331..534362Clytia hemisphaericaexon
TCONS_00001155-exon-sc0000007-1510915933:531148..533016TCONS_00001155-exon-sc0000007-1510915933:531148..533016Clytia hemisphaericaexon
TCONS_00001155-exon-sc0000007-1491911889:534331..534362TCONS_00001155-exon-sc0000007-1491911889:534331..534362Clytia hemisphaericaexon
TCONS_00001155-exon-sc0000007-1491911889:531148..533016TCONS_00001155-exon-sc0000007-1491911889:531148..533016Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:531148..534362 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.59356 2.27189 1.46666 1.32748 0.430557 1.19667 2.65226e-05 0 3.8892 4.60098 5.4737 2.39724 1.86245 1.08294 2.91969 2.5299 4.65396 2.02028 2.91 3.20631 2.99139 2.00076 3.96149 1.82143 2.14368 0 2.50455 2.00469 3.52712 2.70572
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007881UNC-50
Blast
BLAST of TCONS_00001155 vs. Swiss-Prot (Human)
Match: UNC50 (Protein unc-50 homolog OS=Homo sapiens GN=UNC50 PE=1 SV=2)

HSP 1 Score: 224.172 bits (570), Expect = 1.826e-67
Identity = 128/239 (53.56%), Postives = 167/239 (69.87%), Query Frame = 2
Query:  104 ALQRRFLYLKRIFKVRHMDFEFAIWQMIYLFVSPKKVFRNFSYHQETKRQWARDDPAFLVLFSGWLFFASIIFSVALKLTFLEFAKLLFWVIFIDCIGFGLLVAGILSFIVNKYLRFPGGERQKE--EVEFGYAFDVHLNAFFPXXXXXXXXXXXYTPLAHV---SPFLGRFFGNSLWLIAFIYYFYITFLGYSALPFLKGTVIILWPLIGVFIFYLISLFHPSLTLSAMIINFYHHRV 805
            A  +R+ YL+R+F+ R MDFEFA WQM+YLF SP++V+RNF Y ++TK QWARDDPAFLVL S WL  ++I F   L + F E  KLL WV+ IDC+G GLL+A ++ FI NKYL     +RQ    +VE+GYAFDVHLNAF+PLL+ILH IQL +  + HV     F+G   GN+LWL+A  YY Y+TFLGYSALPFLK TVI+L+P   + + Y +SL       +  + +FY +RV
Sbjct:   27 AGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLV----KRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFF--INHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSL-ALGWNFTHTLCSFYKYRV 258          
The following BLAST results are available for this feature:
BLAST of TCONS_00001155 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
UNC501.826e-6753.56Protein unc-50 homolog OS=Homo sapiens GN=UNC50 PE... [more]
back to top