Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001097 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001097
Unique NameTCONS_00001097
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4624

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001097 ID=TCONS_00001097|Name=TCONS_00001097|organism=Clytia hemisphaerica|type=transcript|length=4624bp
TGACAACTCAGTATTATTTCAATCTTGCAAAATCAAGAAACACACACAAC
GCAGCAATATTCTGAACTGGGGACCAGGAATTAGTAACAAGAGAAGCAAA
GAAACTAACTTAACCAGAGAAAATGCAGCTTGTGGTTGAAGAAGACTTGT
GATCTAATATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCAA
TCAGCTGACAATGGAGAGGTTGACAATACTTGGACTGTCATCCCATCCGC
CATCCTCAAATCTGAAGACTCCAAAACCTCAacacaaaaacataaaaaca
acaaaatcaaaactaccaaatatactttactgAGTTTCCTACCAAAGAAC
CTTTTCGAACAATTTCATAGATTTGCCAATGTTTACTTTTTGTTTATTGT
TATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCAA
TGCTCCCgttaatttttgttttggctGTTACTGCAATCAAAGATCTTATA
GAAGACAGACAAAGATACAGTTCAGATAAAATCGTCAACAACAGAATCGC
AGCTGTGTATGACAGTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGA
ATATAGAAGTTGGAGATATCGTCAAATTATATAACAATGATATTCTGCCA
GCAGACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGT
TTCAACTGCTAACCTCGATGGAGAAACCAATCTCAAACAAAAGCAAATTC
CCAAAGGATTTCTAGAGGACGGGCatattttcaaagtgaaagAAGATGTG
ACGTTTCAGGTCAAATGTGAAACCCCTAACAACAACCTTCATAACTTCTA
TGGTTACATAGTGCAATCAAATGGTGGAGAGATAGCTATCGATCGAAACA
ACCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGAATCATTGTATGGC
TTGGTTATCTATGCTGGTCATGATACGaaagccatgttgaataatagTGG
AACACGTTACAAGAGGAGTCGATTGGAGAAAGATATCAATAAAGATGTTT
TAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGGTGCCATTGGT
ACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGTTCATGGG
TTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTCTTGACTT
TCGTCATCATTCTACAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTG
GAGATCGTCAAATTGGGTCAAGTGTACTTCATCAACCACGACATAGGATT
GTATTACCCTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAACATTA
ATGAAGATCTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAACA
CTGACCGAAAATAAAATGGTATTCAAGAAATATTCCATTGCTGGACACTC
TTTTGTCCATCCGGAAGGTCGCGATGACGAAGATACAATGCAGCTTTGTG
AACGCTTGTACAAAGATACTGACAAAGCAAACGGTGATGACCTCATGAGA
ACGTGGGACGAATTCTTCACCGTTTTGACCATCTGCAATACAGTAGTAGT
CTCCTCGCAACCTGAAGTCATCAGTGACACCCTCGAAACATCCGCTGATT
TCACCTTCGCCGAAGATGAGCGTAACGGAACACTAAATGGTACAACCACG
CATAAGAAATTATCTTTACCGACGAACTCTTTGAACGGAAGTGCAAACAT
CAAGCATTTACCGCGTTCTATGACAATGAGTGGACCAGAGGTCACCATCG
ACCCTGCTTCGCCACAAACGGAGAACGGTTTAGTCAGATTGAATGACAGT
GGTGTAGATTTTTTATCGACTGAACGCCGAGTGCGTGTGTTTTCTACAAA
GATTTCTGATCGTTTATCACGAAGTATAGATAGTATAAATAGTTGGTTGA
ACTATGGGCTGGTGCCAACTTATGAATACGAGTCACCTGATGAAGGTGCT
CTTGTCAAAGCTTCAAGTCTTTATAATTATAAACTAGCTAACCGAACGCC
TGAGCAAATCTTTTTCACCACGCCGGACGGTGAGATCAAAGTATATGATA
TTCTTCAGGTGTTGACTTTCGATTCTGCGCGTAAACGAATGTCTATTATC
GTTCGTGATGACGAAGGCCAAATTAAAATGTACTCCAAAGGTGCTGACAC
TACAATTATGAGCCGATTGGCTGATGACCAAGAAGATCTGGTGAAAAACA
CAGACGAGCAACTGGAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGT
ATAGCGAAAAGGGATTTATCAGAGGAAGAATATGAGGGATGGCTTGAACA
ACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACGAAAAACTCGCTC
AATCAGCTGAAACTATCGAGACCAATTTCACATTACTTGGAGCCACAGGT
ATTGACGATCGCTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACG
TCATGCTGGTATCAAACTATGGATTCTTACTGGTGACAAACAGGAAACTG
CAGTGAACATTGGTTTCTCCTGCAAACTTCTTGATCCTGCCATGGAAATC
ATTACATTAAATTCGTCCACAAAGGAACAATGCAAAGAACTTcttcaaca
aatcaaaatgaggcTGGACTCTCAATGGCCCAGTTACACGGTGCTTCCGA
CACATCGTTATTCGACCGATCAAAACTCTCGACCTCCGCTAGCTCTTATC
ATCGATGGGATCACACTGTCGTTCACTTTAGAGAAACCTTTAGACTCGAC
GTTCATCGAGATCGCCAAACGTTGTGAATCAGTCATCTGTTGCCGTGCCA
CACCTCTTCAAAAAGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAA
GTCATGACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCA
AACTGCTGAGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTG
TGATGGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTG
TTGTTATTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGAAtgatttt
atactttttctaCAAAAACGCTATGTTTGTGGCATTATTATTCTGGTATC
AAATATACAACGGATTTTCGGGCTCCAATACAATTGATGACGTTTCACTT
ATTTTATACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGT
GTTTGATCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATTAT
ATCAGTTAGGACAATATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTG
TCCATCATTGATGCTTTCTACCAAAGcctgattttgtttttcattccGTA
TTTTACATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTATAT
TATTCCACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAA
ACACCGAACTGGACGATCATCCATTTTGTGATCATCTTTGGAAGTGTGGT
CATCTCCTTCTTGTATTTCTTCATCTATTCCGCATTCACTGAAGTCAGTT
TGTATTGGGGTATTTTCCACTTGATGGGCCATGCAGAATTCTGGTTGTTG
TTAATCTTCTGTCCTTTCCTTGCTGTACTACCAAGATTGGTTCTTCGTGT
ATTCCAGACGTCTTTTTACCCGTCGGTGCTTCAACGAGTACGTTCTCATT
TGACTGCGTCAGGCGAACTGGCGGACAATAAAATGAAGTCATTCGGCGAT
GAGCCATGCCAAAATAATGATGGTGATAATGGAACCAACCAGACCTCATC
AGCCACTTGAAAATATTGCTTATAAAAGTCTTTCGGAAACTCGGGCTACA
ATAAATtcctttttttacattttttattgCACGATAGAAGATAGAATTTA
TACTTTAGTGGATAGacataaacttaaaaaatgacAAAGTTTCTCAAGCC
CGGGTTTCAAAGACTGGCTCTAATTAGGGATATTGATTATGCACAAATTT
TTAACGATGTAGAATGACCTTTAACATGGTTCCCATCTTCTAAGAACCTC
GAACGAACGACTTGATAATGACAGCCCAACAATCAATGAACCATGTCATT
GTGTTATTTGCATTGAAAGGTAATGAATTTATTACGCATTGTTATTTGGT
CTCAAATATTTATAGAATTGttcatttgaattttaattaatcTATTTTTG
TctacgtcatcatttttttaacaaactgCAAATACATTTCTAGTTTTTCT
AACTTATTATTTTTCCAATCCTTCTGTTCATCattatttagtattttttc
aCGAAGTTTATTTTGTTGTGTTGTATCTGATAGTGTTAGTCTCCAGTATT
TCAATTGATGGCCACAGATAGTTTAGTCGTCTTTCGAGGACTGTACACAC
GGTATGTCATTTGCTTACTCATTTCATCATTGACGTCATAATGAAGCTCT
GGAGCAAATGAGATCAGGCTATCTAAGCTGGATCAATCAAAACTCTTAAA
TCCAAGGGGCGTTTCTTTGGCTCATCAGTCGTATTAATTTGAGAGTACTT
TGGGTTTTTTCCAACCACCGTTCT
Run BLAST on NCBI

protein sequence of TCONS_00001097-protein

>TCONS_00001097-protein ID=TCONS_00001097-protein|Name=TCONS_00001097-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1233bp
MVRKKFNLPGQSSQSADNGEVDNTWTVIPSAILKSEDSKTSTQKHKNNKI
KTTKYTLLSFLPKNLFEQFHRFANVYFLFIVILNWIPAVNAFGKEIAMLP
LIFVLAVTAIKDLIEDRQRYSSDKIVNNRIAAVYDSDTEKFPDKKWSNIE
VGDIVKLYNNDILPADMLLLNSSDENGLCHVSTANLDGETNLKQKQIPKG
FLEDGHIFKVKEDVTFQVKCETPNNNLHNFYGYIVQSNGGEIAIDRNNLL
LRGCVIKNTESLYGLVIYAGHDTKAMLNNSGTRYKRSRLEKDINKDVLGC
VAILFVLCLTGAIGTGYWTSENGLYEDMFMGYVADSPAFEGFLRFLTFVI
ILQVIIPISLYVSVEIVKLGQVYFINHDIGLYYPETAQYPVCRATNINED
LGQIQYIFSDKTGTLTENKMVFKKYSIAGHSFVHPEGRDDEDTMQLCERL
YKDTDKANGDDLMRTWDEFFTVLTICNTVVVSSQPEVISDTLETSADFTF
AEDERNGTLNGTTTHKKLSLPTNSLNGSANIKHLPRSMTMSGPEVTIDPA
SPQTENGLVRLNDSGVDFLSTERRVRVFSTKISDRLSRSIDSINSWLNYG
LVPTYEYESPDEGALVKASSLYNYKLANRTPEQIFFTTPDGEIKVYDILQ
VLTFDSARKRMSIIVRDDEGQIKMYSKGADTTIMSRLADDQEDLVKNTDE
QLEGFAKDGLRTLCIAKRDLSEEEYEGWLEQHKQAEVALTDRDEKLAQSA
ETIETNFTLLGATGIDDRLQEGVPETIASLRHAGIKLWILTGDKQETAVN
IGFSCKLLDPAMEIITLNSSTKEQCKELLQQIKMRLDSQWPSYTVLPTHR
YSTDQNSRPPLALIIDGITLSFTLEKPLDSTFIEIAKRCESVICCRATPL
QKASVVKLVRDNLKVMTLAIGDGANDVSMLQTAEIGVGIAGQEGVQAVMA
SDFVLGRFYFLKRLLLLHGFWCYERISRMILYFFYKNAMFVALLFWYQIY
NGFSGSNTIDDVSLILYNLAFTSLPPIFNGVFDQCLPEKAVFSRPILYQL
GQYGKAYTRPWFWVSIIDAFYQSLILFFIPYFTYLSLPNAGMLVLGILFH
QLAVVTANLHCAIETPNWTIIHFVIIFGSVVISFLYFFIYSAFTEVSLYW
GIFHLMGHAEFWLLLIFCPFLAVLPRLVLRVFQTSFYPSVLQRVRSHLTA
SGELADNKMKSFGDEPCQNNDGDNGTNQTSSAT
Run BLAST on NCBI

transcript from alignment at sc0000007:132939..151170-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001097 ID=TCONS_00001097|Name=TCONS_00001097|organism=Clytia hemisphaerica|type=transcript|length=18232bp|location=Sequence derived from alignment at sc0000007:132939..151170- (Clytia hemisphaerica)
TGACAACTCAGTATTATTTCAATCTTGCAAAATCAAGAAACACACACAAC GCAGCAATATTCTGAACTGGGGACCAGGAAGTATATTCATATTTTTATTG ATTTTCTTGCTCTTCAAACTACAAATGTTTGGACCTTCTGGATTTTCTAT TCTCTTACAGTGTGGGATATTTTAGAAACATCATACCGTCAACTGGTCCA AACCAAGTTGGAGCAGTTGTTACAACTCATCAACTGCTCCAGCTTGCTTG GGATGATTAGTCGCAACATGGGACTGGTTGATATCTGGCCTGTATTTTCA CTTACTGTTAAATCTCTTTGACAACAAATTTGTCTTGATAATTATAACTC CACCAAGTTTTATCAATCATCACGATAACTTTCACTGATAGGGCACCCTT TTTAGCTTTTTTTTGTTTTCATTCAAAATGACTGGACGCTGATTGGAGAA TTAGAGAACGCCCACTGCCTATCGTCAGATGGGATAGACCTTTTTTCAAA GAGGACGTCCTGTTGAATAATTATGTAGTCCAGCCATAAAAACAANACCA TGCATAATTATAGACCTTTTTTCAAAGAGGACGTCCTGTTGAATAATTAT GTAGTCCAGCCATAAAAACAATGATAGAGCCATGCATCATAATTACTGTA TCATGCATATTGTAATAATTCTGCATGGTTTTATCATTGTTTTTCTGCTG GACTACATAATTATTCAACAGGGTGGCCTCTTTGAAAAAAGGTCTATTAA CAAATAAAGAGCGTGTAACTTGCAGCACAGGTGATGTCAAATGCTCCATG GTTTTGCCACTAATTTGGTATTCTTCGTTCCAGACATTCGCGTGTGTTCC ACTACTACAGATTTTTTCATATTTCGATTTAAAAGCCTACTCTGTGCAAA AGAGAAATCATGTATTTTTTAATATGCCGTTCATTAAAACTCAAATCAAA TGAAGGTTCGGTGAAATGGTGGCCGAACTGCAGTCCCATTTGTGTTTTGT TATACTGGAACTCAGTTAGGGTGGTCAGGCCAAAATTTTCCCCTCGAATT TTGAAAACCAAACTAATTTTATTTGANNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNAAATTTCCCTCGTTGCACTCGGGAAATTTCAAAAAATTTC AAAATTGACCTCGGGAAATTTATCCCGAATTTCCCTCATAACCATGAGAT TACTAGTACAAAGCTGAAACCCTTAGCTTTCGAACCATATATGGTAGCCC TGATAAAAATTTCAGCAAAGTGCCGAAAAATCGAAATTTNAAGTTTGGAG TTGTTAAGGATAAGTTATGATGGATGGAATGTTCTAATTTTGATTTTCGA CTTTTTCCACGCAAAAAATCCCGACGAGTGCGCACCCTAACTCAGTTAGA GCAGTTGACGGTAGTTTATGGAAATGAAATTTCTCGAGCTTATGACTACC TAGCAGTTAGTCACACTAGCGTCCTACCGAAATGCGTAGCAAAGATTAAT GCTGCGAAACCGCTATATCGTTTGCCTGACTCTCAAGCAAAAAGAAAGCT TATTAACTTGTGATACGACCCACGGCATGGCCCGAACATTTCGGGCCTGT TCGGACCATGCTCGGGCCACAAAAAAATATTAATCGGCCCGAACATTTTG TTCGGACCATGTTCGGGCCATGTATTTACAAACAAGTCTAGCTATCATGT CTTTAAAGGAACATCATAGGAATAGTAGAATTTAATTTTATTTACCTTTC CTGGTTTATCATCATCCATTGTTAAATATTTNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNTACAAAAAACGATCCAGAAAAATTCTGCTTCGAATA GGAGAAGACCACGAGAAAAGGGAACGGGATAAAGAATAAAAAGAAGACCA TATTATGTAAGTTTCAATCATTCTTTTTAATAATTTTCCTAACTTAATTG GAAAATAGATGATTAACTTTTATATTTGAACAATATATATTTGAATAAAG ATGAAGATTTTTAAATTTGTTTGCTAAAATAAGGAATTTAAAATATAAAT ATTGGGTCCTGAAATTACACACGCGATCGTAGCAAGTTTTCGAAAATCTT GCCCGAACATGGTACGAAACTGCGCGGGCCAGGCGTGGGCCATTTTTAAA AAGTATTTATCAAGAGGCCCGAACATGTGTTCGGACGCTTGCGCAAATAC GCGAAATCACATTTACACGTTTCTTGTTGCAAAGATTGTTCCTTTTGCGG TGTGAAAGCCTACCTGGTGAGAGTAGCATATACGCATTATTTGCTATCTA TGATTCACGGTTATGTTAATTAAATGACTTTGGAGGTTCTGTGAAATGGT GGCTGAATTGCTGTCACATGTTTTGTCAGATACTGTAGTCCCAAGTTAGA GCCGTTGACAATACAACATGAACACTTTTGACTGAAAAATCACTTGTGGT TGTTCTCACGCATGCGTAATACAGGTTAGGAAAATGAATATTCCCTAAAA AAAAATTTCTCAAACTCAGGCTCCAATTTGCGACAGTTTTAAATTTTTCA TTGAATTGTCTTATTTTGAGTGTTTAAAGGATACACTCAAGTTAACGAGT TCTGGAATTCGCATTTTCCAATCCGAAGAGAGAATGTGATATTTCCTTTC CCTAGCTTGTAGAGAGTAATCATTTTAAAAACTTGCGATCTTTTTTTTCT CGATCCATATAATCAATTTAGAAAAACTTGGGGCATTTAATTTCGGGATG CAATTCTGAATGTGCAACTAGAAAGTTAAAAATATTAGTTTTCCACGTGT GGAAATCCCTTTTCACTAACACATTGGTAATACATTTCCAGAATGGGAAA ATAGGTTTCCTGAACTTAACTGATCAACTTTTTTTGAGAGTCACCCAGGC ACAAAAAAATTTTTTTTTATTGAACTGAATATTTCAGACAAGTTTACGCA AAACATAATAGAGTAAATATTATACAGCAAAGACAAACGAAGATTCTTAA ATATTTGTGACATTAATTATAAATATATCAATGATTATTCTCCTTTCTCT TTTCTTTTCATCCGTTGTTTGTTTTCAAAAATGCTTTTGTTTCTTTCATG TGCGTTTGATCGCAGATATTTCATAAAAGAGAAAGATTCGTTCCAAACAT TGTAAATTTAACGCATTTTTATTTTTTTTCTCCAGACAAACAGTGTATTC TTCAGAATTTTTACCTTTGTATATTTTACGCTCGAAAACTTGTATCATTT TAGTCAAAAAAACTACAAAAAGATCTCATTTCTATAAAGAAAATCAACAA ACCAAGCAATAAAACACACTTATTAGTTTTGTTATTTTCCTTTTAAGGCA CTTTTTTATTTTCCTTAAAAAGAAAAATCAAGGGTGTAAGAAAAATCTAC AAATTTAAAAAAAAAATTTTGCGCCCGACCGGGTGAGTTTTTTTTTCGTC ACCTGCATTTTCGGAAACAAGACTTTTTTTCAGGCCTCACTATATTAATA TGTTTTTGGTTGCTACCACGTTAGCTGACATTAATAAGGCACTTTTTTAC AGCCTAACTCAAGTAGGCATGTTCCAACAAATATATATTGAAAGATAACT ATAAGGTGAGACCAATTTGATTAGTTGTTTTACAGGCCCAAGTTATTCTC GCTAAAATTTCTATGATTAAAGTTTAGGAGATTTTATAGGTGAAATTCTT CTTTTGTTTTTATTTTTTTGCGGACCAACCGACCCTCTTTTTTGGATTAC CTGGCCCATAAAACAACAAATTAAATTGGCCTCGCCTTAGGATAAAATAA CAAATTAGATCAAAGAACATCCTATCATTACTCATGTTTTGTATGTGTAT GTGTTGTGTATCACCATCAAAAGCTGAGTTTGTCACATCATTTATGTTGT CAAAAGCAGATTGTTTTGATCATCAAGTTACGCTACCTTAATTCAAAAAG GGGCCTAAGTCCATTTTTATGAAATTTGAGATCTTTAGCTTTTCTCAAGC TCTGGCTCATTTGCTCTATTTTGATGTACATAACAACAAGTAGTTAAAAG GGCTCAAAACATACTGAAGCTCTGATAAAAGTGATGTTTAATTCAAAAGA GGCCTAAGTCCATCATCTTTTTACAATAAAGGGCCTAAGTCCACCAAAAT AAGTTTGTTAAAATTGTAAATAGGCCTAAGTCCAATTGAATTGCAAATGG GCCTAAGTTCATGCATCCTAAAAAGTTTAATTGAGTTTTATTTTTTTTTT TGCTGAGATTGTCTTTTCTTTTTATCTTGAATCTAGGTGTAACAGGGGGG GGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGGGGTCAGTAGTAAAATC TCAGACATAATGATGTTTACTATGGTGGTGGTGGTGTGATGAAAAAAAAA ACAAGTTGGAGCTAAGGTTTTCAGAAAACATTTACTTCAAAGCCTTACCA TCAAAAATGGTTTTCGAATAAAGGAAAAACTTTAATTGTAATTTTTTCAA AATGACTAAAATGGACTTAGGCCCCTTTTGAATTAAGACTCACAGGACTT AGGCCTCTTGAATTTAGGTAGCAAAGAGAACTATGAAAAAAATGGCTAAA ATCAAAGGCTTCTACAGTAATTACAGGGACTCAATCATTGAGACAATTTT TAAAATAAAGCCTAACTTTCACTAAGACTTTATATATTCCTGAAGATATT TTATGTCAAGTTGAGGCTGAGTTTTTGCTAAATCAGGCTTTTTTTGATGG CAGTTTCGTTTTTGTAGGGTACCATTTTTGAAATATTTTTTTTTATGGTG CTTGTATGCGGAAAATTTATAAGGAACAGGTCACAATGTGCTCCCTAAGG GGTGTTACAAGGCCACGATACCCACATGAATTTTGAATAGCTCATTATTA TTTTGAAGATCTTTACATGGGAAAAGGTTGTGAAATAAATTAGATTTTAT TTTCCAACTTAAATGGATTAATAAAAAGAGTTTTTGATTAGATTTTACTT CTTCAGTAACAAGACACCCTTAGGAATTTCTTCATTTAAAATACTGTCTT AGATAGATATTATAAGCTAATCTTATTGATATGTAAGATGGCTTCTAGGT AGATATTGACCAATATTCATTTAATTCTTATGTGTTAAAATCAATATGAA CATATAGGTGTAAATAAATTTTTCTCTTTTTCTTCCCTGTTTCTAAGGAA GGGAAAACAGAAGGAAGAATTTTGTGCTTTGAAGAAAACTTTTCAAAATT TCTCAAATGGTCTAATCACAGTGCTGGGGTGAAAAGTCTTGACTATCTCT CACAAAAAGAAGGAAAATTGAGAACAACCATGTGCTAAATCTATGTTTTA TTGATTTAAAAGAAAAATGTTGTGTGTAGTATTCTAACTTTAAACGAAAA TTTAATGTCTTATTTATGGAGAATTTTGAGATGTGATTCATCTTTAGTAG AATGTACTTTTATCAAAAATGAATTGACTTGCATCAGAATGCCATGTCTC AAATTTTGTTTTTTTAATAATGAATTTATTTCATACCTCCTTCAATGGAT GTGAATTTTAATACTTCATTTCAGATATCCTTTTCCCTTTTAGTTAGTAA CAAGAGAAGCAAAGAAACTAACTTAACCAGAGAAAATGCAGCTTGTGGTT GAAGAAGACTTGTGATCTAATATGGTTCGCAAGAAATTTAACCTCCCTGG TCAAAGCAGCCAATCAGCTGACAATGGAGAGGTTGACAATACTTGGACTG TCATCCCATCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCAACACAA AAACATAAAAACAACAAAATCAAAACTACCAAATATACTTTACTGAGTTT CCTACCAAAGAACCTTTTCGAACAATTTCATAGATTTGCCAATGTTTACT TTTTGTTTATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGT AAAGAGATTGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAAT CAAAGATCTTATAGAAGACAGACAAAGATACAGTTCAGATAAAATCGTCA ACAACAGAATCGCAGCTGTGTATGACAGGTTAGTGACTATTATTTCTTTA CTCCTTAGAAAGCCTTAGTTAAATGGCTATGTTTTTTATAAGGTTAAAGA TATCTTATAGAAAACCAATTTCTATCTATCTATTCTTATTAGTGACACAG AGAAGTTTCCAGACAAGAAATGGTCGAATATAGAAGTTGGAGATATCGTC AAATTATATAACAATGATATTCTGCCAGCAGACATGCTTCTCTTGAACTC AAGTGATGAAAATGGTTTGTGTCATGTTTCAACTGCTAACCTCGATGGAG AAACCAATCTCAAACAAAAGCAAATTCCCAAAGGATTTCTAGAGGTAAAA AACATCATCTGAAATTAATAGGACCTTTGAATTTTTAGAAAAGCTGCGAT GAACAAACCGCCCATTAAGGACTGTGTAAAATTTATTAAAAATGCTACCT TGCTCCTTAGGACGGGCATATTTTCAAAGTGAAAGAAGATGTGACGTTTC AGGTCAAATGTGAAACCCCTAACAACAACCTTCATAACTTCTATGGTTAC ATGTAAGCATTACTCTTAATGTGTTTCATTCTTTGAGAAATTTTTATTAC TTTGCATCCAATAAAATTTCGGGCACTTATCTTTTATCATGGTCAGTTTA TCCTTGCACCGTCAAAAGAGGTCAACCCTCGAAAAATTAGGGACATATGA TTTTACTATACTATAATTATTGAATCATTCCTGATGTGTTTTAGAGTGCA ATCAAATGGTGGAGAGATAGCTATCGATCGAAACAACCTTTTGCTTAGAG GATGTGTTATCAAAAATACTGAATCATTGTATGGCTTGGTTATCTATGCT GGTATGTCAGACGAGAGAAATGAATTTTGAATAAAAGCTTGATAAAGGGG AGTTTTGCTAGCTCAGCTATTTCAGACGGGAAGACTGGGATCTATTTCAG CTATTTGATTCGTCAAAAACAATAATGATCGATTTTCCCACTTTTCCTGG CCAGCCCATGATAAACCGCCCCTGAAATATAGTTTTTTTTTTGTTTTAGT TTGATAACAAAATCCTGATCTCTGCTACTTCTCAATAATAGCAGTTCAAC AGCTCTAAATTACCTGCTAGATGATGTGCTAAATTTATAGTTATAATTAA AATTAATATTTTTTTTCACACACTCTGATCGCCGTCATTTTTCAGGTCAT GATACGAAAGCCATGTTGAATAATAGTGGAACACGTTACAAGAGGAGTCG ATTGGAGAAAGATATCAATAAAGATGTTTTAGGTTGTGTTGCAATCCTAT TCGTTCTATGCTTGACTGGTGCCATTGGTAAGTTCTGAACCTTTTTTTCT CTCATTCAAGTTAATATAGAGTTTTAGTATCCGTAAATAAATTGCGGTAT CGTAGCTTATATGAAGTCTGTTGGAACCTTATTTGTCGTTGCGATGCAGA TGATGTTTACAGGACAGTGAAGCTAGGGTTTTTTCTTTTTGCCGATCGCT TTCTCGGTCACCTTGGTGTAAAGGTCGAAGTAATCGAAGAGGATCAACCC AAAGAAAATACAGAGTTCGAAAAGCGAGAGAATAGATGCTCCCGTCATCA AGCCAACACAACCTCCAAAATTTGCGAATAAATCCTCCCACGTGTACGCA GGTTGCTCTTCAATAATCTCTACCAAGAATGATTGATAGGTGAACGTCAA ATCTAAAAGGTTTGGATGGTTGGAGATATGGTAACTGATATCCACTTTGA AGTCAATTTCAAAACATGGTGGTAATTCGCAACGAGTGTTACAATTTCTT GTTACATTTTGATCTCTTTGTACTTCCTCCAAACATCTTTTTCCAGTTGT AAAGTTAAAGAACTCTTTGGTCTCAAATTGGTGTGTTTCTCGCATATGTT TTTTGTACATGTGAGGAATGGCACCACATTTTGCAAAAACTTCTTCAAGT AGACAACTCTTTTTGCATTTTCTGATAGTGTAGTTACCAGTGAATTTATT TTGTATTGGTGTACCACTTCCTTGGACGCATTCTGTGAAAGGTTCGCCAA GACGTGTCGTGATTCGTTTCTCGAGCAGTATATGGTAGTATCCTTCACTT ACCCAATAAACTGATTCTGTTGCCTCTGGGAATGTTTCTGTTTCAGGGTT AACATACATCTCAGTCCAAAAGCGATCGTATGTCCTATTTGCGAGTACTT TGATTTGCAACAGGTCTAACGGTGTATCTTGGGTTATTTCGCTTTTAAAA GTAAAGCAATTGGTGACATTGTCAACCTCGATATGATGGTTTAATCGTTG AGTATTGAAGCCCCATGTCTCACCACTGAAAGATTCTGCATAGATCAAAG CAGATCCATTGAACATTTCACATTCTGCAAGTCCATGATCGCAATGATGT ATTTCATCCACAACCTTAGGATGAGAATAAATAAATGATCCTTCTTCGAA ACTTTGTCTTGCTTTATGCACACTTATCCAGTCACAGACGGTGATAGCAG GCCTCTCCATGGTTTGTTGCGAGACTATTTTGGTATGGGTGTGGCTTTTG CTACTCATATACGCATCAAGGTGCTGTTTTGAGATGAGAACGGCTGTGAC GAATGAAGCAATGATAAGTATTGACCAAACCACCTTACTGAAGGGTCTTC CAGTGGCTACCCTGTTTGCACCATGGATTGTCAACCCTTCAGCATAGCGC ATCCTCTCTTCGCTGATTTTCTTTTCTATTTCACTCTCCCCTTCGCGTTG AAACATACTGATCTTCTTTTTTGTCACCTTTTGTAGGGGTGTCACTTTAT TCCTGTCCAAGTTAACTGTAAAACCTTTTCCGTTTGTATTATTTCTTTCA ATTTTTTCGGTTGATTTTTTGTCTACTTTTTTGTTAGACAATGCTGAATC AGTTCTTAAGGCGTTCACATCATCCAAATAAAGAACTTCTTCAAAAAGTT CGTTCTCTAAATCCTCATTCAACACACCTCCCTCCTTCTTCACACTCTTC ACATTGTTTTGAAGATCCATTAATTTCCCAATCGTCCTTCTGTTTTCTTG GACTATCATCTCCAGTATTTTCAATCTGTTCATTATGTTTTCCTTTTCTT GGAATTTCGAATCCATTACTTTTAAGATATCTTAATGTTACTTCGACTTG GTGATTTTCTCTCGCCAGAAGAGTTCAACTGTACTATATCGTTTCAATTA TTTCGATTGAAGTTTTAATTAGTTTTTTGAAACATTTCTATTTCTCAAAT ATCATTCTTTTCTGATTCTACGCTTTGAATTTGCGCTTCATTCGAATCTA CATGATACATTTTATAAACACACTGTCTAATTTAATTTGACCAAATAATA TCAAACCCCTTTTTCAATTATCAAAAAAGGCTAACAAACTCTTTGACTGT AGCCGCTCAAACATTCTATTTTTAATAGAAACAACAAGCTCTGGGGTCTG GGGGAGGCACTCGGGCGACATTGGGAACGGGGACGTGTTGCTGGTCAGGG TTCCTTTTTTAGGCATCTGACAGGGTCCAAATTTACTAATTTTCAACATT TGTACCTGACAGGGTCGTCTTTTGGCTATGTTGGACAATTTTCAGGGTGG AGATTTGAAAAATTGTCAATCTTTTGTCTACATTTCGTCATTTTTGCCAC TTTTTAGGGTGAGAATATGAATTCTTTTTCGATTTTCCTTCCGACAGGGT CCCAAATTTACCAAACATCTATATCTGACAGGGTCCACTTTTCAAGCTCC AGCGGCACGTCCCCGTCGTCCGTCAAGGTCAGTGCCCCGGGCTCTGGGGT TTTCATTTATAGAATGTATTTTAAATGATTAAAAACTTGTGTATTGAAAA ATTGCACACAGAGGAATTGTAGTGTTTGCACCTTTGATTGTCTCATTCTT AGGTACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGTTCA TGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTCTTG ACTTTCGTCATCATTCTACAGGTTGGTGCCATCATTATTATGTATTTTTA ACCGGTTACTTTTTCAAAGCGGGCTACACGGCTTTTTGCGCAATGCAATT GGTACTTTTTGCATGACGACGGGCCTACACTGCCCAGAGTTGCCCGTCGT TAGGAAAATTCATTGTGACGTTACTTTTTTCAAAGGAAAATGAACAATGT GTTTTTGTTTTTGTCAGAAAATAAAAAAATGTTTTATCTCTTTTCCCTTG TTTTCCTCGCTTTATTTCGCTATTTTTCCTGGATAAAGCGCTAAAAATCT ATCGAAGCTGAAGGAAACGGTTAACAAATACAATAATGACCGGTTTTTTC GGGCTGTACTGAAAATATTGCCCTCGGTCAACGCAACAACCTCGCAAGCT CGGTCATTACTTGACCTCGGGCAATATTTCTCAGTACAGCCCTCACTAAC CGGTTATTATTGTATTAAAAATGTTTAACTTTGGACTAAATACCTTTCCT CCATTTCATTGATGGTCTTGTGAGGTCTTTTGACAGAGCGAGATATTCGA TCTTTGAAAGTTGTTAGTTTTTCTTAATCCTTTACTAATCGACCCCCTAA CGCACGATGTAGTGTTTTGTCAAACATATTTAATATATTCCTCAATATAA GAAACAGCAAAGTCCGAATATAAACATCTTTCTGATTTTTTAGGAAAAAT CTAAATATTCCTCAATAATATCAAATTACACATCAATCCTTACTTCCCAG CTTTAACTAAGATGCTCAGGCACAGAATTCTGCAAAATTACTTTCAACCT TCTTTCAACCTTCGGATATTTTTCCAGGTTTGGGAACTAATCATTTTCTT CCCTGAATAAACCAAGACCTGGGAAGTGACATTTTAACACCCTGAACTAC CTAGATGCCTGTATTATTTAAACAAAAATGTCTTCGAAGGAATGCTCTGT TTCTTGCAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGT CAAATTGGGTCAAGTGTACTTCATCAACCACGACATAGGATTGTATTACC CTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAACATTAATGAAGAT CTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAACACTGACCGA AAATAAAATGGTATTCAAGAAATATTCCATTGCTGGACACTCTTTTGTCC ATCCGGAAGGTGAGCCTTTGGTTTGTTATCTTAAACTACAGAAAATTAGA GATTTTGAGATGGAAAGGGTAGTGCACGAGCGAAGCGTTTTACAAATTTC AAAGAAATCTGAAAAGACTATCTACAACATGAATCGGTGCCGAACCATTA AATAAATTGTGAACTTTTTTTATTGATATTAAATATTTTTACAGGTCGCG ATGACGAAGATACAATGCAGCTTTGTGAACGCTTGTACAAAGATACTGAC AAAGCAAACGGTGATGACCTCATGAGAACGTGGGACGAATTCTTCACCGT TTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCA GTGACACCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGT AACGGAACACTAAATGGTACAACCACGCATAAGAAATTATCTTTACCGAC GAACTCTTTGAACGGAAGTGCAAACATCAAGCATTTACCGCGTTCTATGA CAATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCCACAAACGGAG AACGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTATCGACTGA ACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCACGAA GTATAGATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTTAT GAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTA TAATTATAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACCACGC CGGACGGTGAGATCAAAGTATATGATATTCTTCAGGTGTTGACTTTCGAT TCTGCGCGTAAACGAATGTCTATTATCGTTCGTGATGACGAAGGCCAAAT TAAAATGTACTCCAAAGGTGCTGACACTACAATTATGAGCCGATTGGCTG ATGACCAAGGTAATTCTTCGAAATTTGTGTTTTGTTTTGTGTACCTCGTA CATCATCTTTAGATATTTGACGGTTGTGTTTCTAAGTACAATTAAGGATT TGAGGATTTAGGATCCTTAGAGTTCACTAAAGCAATCAATCATGTCTTCA AGGACGAAGAAAGATCTTTAGATCAATTTTCAATAAAACTGAAAAAAATA CTAAACTTATTTTTCCGTAGAAGATCTGGTGAAAAACACAGACGAGCAAC TGGAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGG GTGAGCTGTCAGAAGTTTTTTTTTAACTATGCTTTATAAATAGTTACCAT CGTGATGTGAATATGCGGAAACCCTGAGTTTAACAGTTTGATACATTCCC CTTCGCGTTTAGGATTTATCAGAGGAAGAATATGAGGGATGGCTTGAACA ACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACGAAAAACTCGCTC AATCAGCTGAAACTATCGAGACCAATTTCACATTACTTGGAGCCACAGGT ACATTCATTTCTCGTATTTTTTCGACTGTTTCAAACAATAATACTAGAGT GGACAGTGTTTTTAGCCATTTATGTCATTTATTATCTGTAAAAGATTTGC GTGAGCTTTACATTTCCACTCACTCTAAATCTGTTTTCAGGTATTGACGA TCGCTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCTG GTATCAAACTATGGATTCTTACTGGTGACAAACAGGTTTGTTACCTTGCT TCCCTGTTCTATTTCTATGTTTAATCCACTCGTTTGAAATCGATTATAGC TAATCAGTGGAGATTTTTCGTGAAAAGTTCGTCCACAAAAAAAAATTCAT GAGTATTACAATAGCGACAATAGCACTTTCCTATATTATGGTTCCGAAAC TGAATGAAGCCATGTTGTTGGTTCATTCCAGGGGTTGAATCAGGTTATTT CTAACCAAAAGAGAGGCTTCGATATATTTTGAAACAGAACAGAACGCAGA GATGGATAGATGTCTAGGCACGGTCTGGTTACTGCGTGATAACGAAGGTG AAATTTTCTTTTGTTTCACTTTAGGAAACTGCAGTGAACATTGGTTTCTC CTGCAAACTTCTTGATCCTGCCATGGAAATCATTACATTAAATTCGTCCA CAAAGGAACAATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGGAC TCTCAATGGCCCAGTTACACGGTGCTTCCGACACATCGTTATTCGACCGA TCAAAACTCTCGACCTCCGCTAGCTCTTATCATCGATGGGATCACACTGT CGTTCACTTTAGAGAAACCTTTAGACTCGACGTTCATCGAGATCGCCAAA CGTTGTGAATCAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATG ATAAATGACTTCCCTTTTTGTGCTTTTAAAACTTGAATTTAACTTATGAC TGTACAATAAAATTCGTTTTGTAGCTCTATTATAGTTCACTCTGAAGTTG TCTTGTTACGATTAAAGAAAGCCTAATATTATGCTATCTCAAACTTGTTT CATTTGTAGGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAAGTCAT GACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCAAACTG CTGAGGTATGCAAATTTGGATCAAAGCTGTTCACTTGTTGTGTCACTGAA AGTTATGCTTTTATACGCTAAGTACCTAAAGTAAAACTGTATACCCTATT CAAACCTTTGGTTTTCTTTCATACTTTCTTATTAGCTGCTCTTTGATATT AATTAGTTTTGAGTGAATTTTTTTTGATATTGTTAAGCAGGGCAGCCTTG TCTTCATTACCATGACTTTTCTCTTTCCTTGCAGATTGGAGTTGGAATAG CAGGACAAGAAGGGGTGCAAGCTGTGATGGCCAGCGATTTCGTGCTTGGG CGTTTCTATTTCTTGAAGCGTTTGTTGTTATTGCATGGCTTCTGGTGTTA TGAACGAATCTCTAGAATGATTTTATACTTTTTCTACAAAAACGCTGTGA GTAGTATATAATTATTCATGTTTTACTGTTTTCTCCCACGTGCTTTTGAT ATACAAAATATTTTTCTGTTTCCACATTTCGGACGAATAAGTTCTCGCAT GTCATACAATACATAGCTTTAGCCTTTCTTTAAACACAATAAATCTTCTT TTTCAGATGTTTGTGGCATTATTATTCTGGTATCAAATATACAACGGATT TTCGGGCTCCAATACAATTGATGACGTTTCACTTATTTTATACAATTTGG CGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAATGTCTT CCCGAGAAGGCGGTCTTTTCACGACCTATATTATATCAGTTAGGACAATA TGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATCATTGATGCTT TCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTACATATTTGAGT TTACCGAACGCTGGTATGCTGGTGCTTGGTATATTATTCCACCAGTTGGC GGTAGTGACTGCAAACCTTCATTGTGCTATCGAAACACCGAACTGGGTAA GACCACTTTACAGCTTTCAGCATCACCCAAGTGTATAGTTCTCATAAANN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGG GGGGTCCGAATAAGCAGGGGGTAGGATAATTTTCTAAATTCTAATAAGCG GGGGGGTGGAATAAGAGGGGGGGGGTAATTTGAAGACAGAATTGTTTTTA ACTGATATCAATTTCAACAGCAAAAAAAGAAACTTTAACAAATGAACACG TAAAATAACGTAAAATAAGAAGAAATACTAACACAAAGGAAAATTTTNAA TAAGGGGGGGGAGATGGAATAAGAGGGGGGGTAATTTGAAGACAGAATTT TTTTTAACTGATATCAATTTTAACAACAAAAAAGAAACTTTAACAAATGA ACACGTAAAATAACGTAAAATAAGAACCAATACTAACATAAAGGAACATT TCAACAAGTTTAAGGTCTATCTACACTGTAATAAAATATTGAATTATTCG AATTTAGCGGGGTGGGGTCTTAATAAGAGCGGGGGATGGATTTTTTTTCT CTTAGCAATTAGCGGGGGGGCGTTTATTCGGGAGACAAGAGTACATTCTT TCTCGTTTAGACGATCATCCATTTTGTGATCATCTTTGGAAGTGTGGTCA TCTCCTTCTTGTATTTCTTCATCTATTCCGCATTCACTGAAGTCAGTTTG TATTGGGGTATTTTCCACTTGATGGGCCATGCAGAATTCTGGTTGTTGTT AATCTTCTGTCCTTTCCTTGCTGTACTACCAAGGTAGGTCATTGTGTTTT CACCATTCCCTTTGGAAGAAAATTCACATTTATCGCTTCATACATCATAG CCACAGATCAAAGATTTTGAACTAAATTACTAAAGATTTTTTTCTATTTT TTTTCTATTTGGTTGAGTTGCAGGAGGCTTTAGAGGCCTATTCTCGCAAC TATAGACGCTTACTAATGAGCGTCCCGTCAGCACCTCGAACTGACTGCCC AATTCCCCTCACATGGCATGGGTTGACCCGGGCGAAGGAACGTTCACTTG CCAAGTGAACTGCCGTGAGTGGGAATCGAACCCTGGCCTCCTGCACAGAA GCCAAGGTCGACTACCACTATACCACGGCACCTTTATGATTTCCTTTAAC CTTTTCTAAATACCACATTAATTTACTTATCGATGAGAAGTGTTGTTTCT TGTCTAAAAAATCTGGTCAGGAATTTTAATGGACAGAAGTTATGACCAAA GGTGTCTATTCTCGGGCTTCTATAAATGTTTATCTACGGTATATCACACT AGGTTTGAAAGGTTGACATTGAATTTATTGAATTTCCTTCCAGATTGGTT CTTCGTGTATTCCAGACGTCTTTTTACCCGTCGGTGCTTCAACGAGTACG TTCTCATTTGACTGCGTCAGGCGAACTGGCGGACAATAAAATGAAGTCAT TCGGCGATGAGCCATGCCAAAATAATGATGGTGATAATGGAACCAACCAG ACCTCATCAGCCACTTGAAAATATTGCTTATAAAAGTCTTTCGGAAACTC GGGCTACAATAAATTCCTTTTTTTACATTTTTTATTGCACGATAGAAGAT AGAATTTATACTTTAGTGGATAGACATAAACTTAAAAAATGACAAAGTTT CTCAAGCCCGGGTTTCAAAGACTGGCTCTAATTAGGGATATTGATTATGC ACAAATTTTTAACGATGTAGAATGACCTTTAACATGGTTCCCATCTTCTA AGAACCTCGAACGAACGACTTGATAATGACAGCCCAACAATCAATGAACC ATGTCATTGTGTTATTTGCATTGAAAGGTAATGAATTTATTACGCATTGT TATTTGGTCTCAAATATTTATAGAATTGTTCATTTGAATTTTAATTAATC TATTTTTGTCTACGTCATCATTTTTTTAACAAACTGCAAATACATTTCTA GTTTTTCTAACTTATTATTTTTCCAATCCTTCTGTTCATCATTATTTAGT ATTTTTTCACGAAGTTTATTTTGTTGTGTTGTATCTGATAGTGTTAGTCT CCAGTATTTCAATTGATGGCCACAGATAGTTTAGTCGTCTTTCGAGGACT GTACACACGGTATGTCATTTGCTTACTCATTTCATCATTGACGTCATAAT GAAGCTCTGGAGCAAATGAGATCAGGCTATCTAAGCTGGATCAATCAAAA CTCTTAAATCCAAGGGGCGTTTCTTTGGCTCATCAGTCGTATTAATTTGA GAGTACTTTGGGTTTTTTCCAACCACCGTTCT

Coding sequence (CDS) from alignment at sc0000007:132939..151170-

>TCONS_00001097 ID=TCONS_00001097|Name=TCONS_00001097|organism=Clytia hemisphaerica|type=CDS|length=62934bp|location=Sequence derived from alignment at sc0000007:132939..151170- (Clytia hemisphaerica)
ATTGGTTCTTCGTGTATTCCAGACGTCTTTTTACCCGTCGGTGCTTCAAC
GAGTACGTTCTCATTTGACTGCGTCAGGCGAACTGGCGGACAATAAAATG
AAGTCATTCGGCGATGAGCCATGCCAAAATAATGATGGTGATAATGGAAC
CAACCAGACCTCATCAGCCACTTGAACGATCATCCATTTTGTGATCATCT
TTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTTCATCTATTCCGCATTC
ACTGAAGTCAGTTTGTATTGGGGTATTTTCCACTTGATGGGCCATGCAGA
ATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTTGCTGTACTACCAAGAT
GTTTGTGGCATTATTATTCTGGTATCAAATATACAACGGATTTTCGGGCT
CCAATACAATTGATGACGTTTCACTTATTTTATACAATTTGGCGTTCACT
TCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAATGTCTTCCCGAGAA
GGCGGTCTTTTCACGACCTATATTATATCAGTTAGGACAATATGGTAAAG
CGTACACACGCCCCTGGTTTTGGGTGTCCATCATTGATGCTTTCTACCAA
AGCCTGATTTTGTTTTTCATTCCGTATTTTACATATTTGAGTTTACCGAA
CGCTGGTATGCTGGTGCTTGGTATATTATTCCACCAGTTGGCGGTAGTGA
CTGCAAACCTTCATTGTGCTATCGAAACACCGAACTGGATTGGAGTTGGA
ATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGGCCAGCGATTTCGTGCT
TGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTATTGCATGGCTTCTGGT
GTTATGAACGAATCTCTAGAATGATTTTATACTTTTTCTACAAAAACGCT
GCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAAGTCATGACACTCGC
TATCGGTGATGGCGCAAATGACGTCAGTATGCTGCAAACTGCTGAGGAAA
CTGCAGTGAACATTGGTTTCTCCTGCAAACTTCTTGATCCTGCCATGGAA
ATCATTACATTAAATTCGTCCACAAAGGAACAATGCAAAGAACTTCTTCA
ACAAATCAAAATGAGGCTGGACTCTCAATGGCCCAGTTACACGGTGCTTC
CGACACATCGTTATTCGACCGATCAAAACTCTCGACCTCCGCTAGCTCTT
ATCATCGATGGGATCACACTGTCGTTCACTTTAGAGAAACCTTTAGACTC
GACGTTCATCGAGATCGCCAAACGTTGTGAATCAGTCATCTGTTGCCGTG
CCACACCTCTTCAAAAAGTATTGACGATCGCTTACAAGAAGGTGTCCCAG
AAACCATTGCAAGTTTACGTCATGCTGGTATCAAACTATGGATTCTTACT
GGTGACAAACAGGATTTATCAGAGGAAGAATATGAGGGATGGCTTGAACA
ACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACGAAAAACTCGCTC
AATCAGCTGAAACTATCGAGACCAATTTCACATTACTTGGAGCCACAGAA
GATCTGGTGAAAAACACAGACGAGCAACTGGAAGGTTTTGCAAAAGATGG
TCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCGATGACGAAGATACAAT
GCAGCTTTGTGAACGCTTGTACAAAGATACTGACAAAGCAAACGGTGATG
ACCTCATGAGAACGTGGGACGAATTCTTCACCGTTTTGACCATCTGCAAT
ACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCAGTGACACCCTCGAAAC
ATCCGCTGATTTCACCTTCGCCGAAGATGAGCGTAACGGAACACTAAATG
GTACAACCACGCATAAGAAATTATCTTTACCGACGAACTCTTTGAACGGA
AGTGCAAACATCAAGCATTTACCGCGTTCTATGACAATGAGTGGACCAGA
GGTCACCATCGACCCTGCTTCGCCACAAACGGAGAACGGTTTAGTCAGAT
TGAATGACAGTGGTGTAGATTTTTTATCGACTGAACGCCGAGTGCGTGTG
TTTTCTACAAAGATTTCTGATCGTTTATCACGAAGTATAGATAGTATAAA
TAGTTGGTTGAACTATGGGCTGGTGCCAACTTATGAATACGAGTCACCTG
ATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTATAATTATAAACTAGCT
AACCGAACGCCTGAGCAAATCTTTTTCACCACGCCGGACGGTGAGATCAA
AGTATATGATATTCTTCAGGTGTTGACTTTCGATTCTGCGCGTAAACGAA
TGTCTATTATCGTTCGTGATGACGAAGGCCAAATTAAAATGTACTCCAAA
GGTGCTGACACTACAATTATGAGCCGATTGGCTGATGACCAAGGTTATTA
TCCCTATCTCGTTGTATGTTTCGGTGGAGATCGTCAAATTGGGTCAAGTG
TACTTCATCAACCACGACATAGGATTGTATTACCCTGAAACTGCTCAATA
TCCAGTATGTAGGGCCACCAACATTAATGAAGATCTTGGTCAAATCCAAT
ACATCTTCTCCGATAAGACGGGAACACTGACCGAAAATAAAATGGTATTC
AAGAAATATTCCATTGCTGGACACTCTTTTGTCCATCCGGAAGGTACTGG
ATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGTTCATGGGTTATG
TTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTCTTGACTTTCGTC
ATCATTCTACAGGTCATGATACGAAAGCCATGTTGAATAATAGTGGAACA
CGTTACAAGAGGAGTCGATTGGAGAAAGATATCAATAAAGATGTTTTAGG
TTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGGTGCCATTGAGTGCA
ATCAAATGGTGGAGAGATAGCTATCGATCGAAACAACCTTTTGCTTAGAG
GATGTGTTATCAAAAATACTGAATCATTGTATGGCTTGGTTATCTATGCT
GGACGGGCATATTTTCAAAGTGAAAGAAGATGTGACGTTTCAGGTCAAAT
GTGAAACCCCTAACAACAACCTTCATAACTTCTATGGTTACATTGACACA
GAGAAGTTTCCAGACAAGAAATGGTCGAATATAGAAGTTGGAGATATCGT
CAAATTATATAACAATGATATTCTGCCAGCAGACATGCTTCTCTTGAACT
CAAGTGATGAAAATGGTTTGTGTCATGTTTCAACTGCTAACCTCGATGGA
GAAACCAATCTCAAACAAAAGCAAATTCCCAAAGGATTTCTAGAGATGGT
TCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCAATCAGCTGACAATG
GAGAGGTTGACAATACTTGGACTGTCATCCCATCCGCCATCCTCAAATCT
GAAGACTCCAAAACCTCAACACAAAAACATAAAAACAACAAAATCAAAAC
TACCAAATATACTTTACTGAGTTTCCTACCAAAGAACCTTTTCGAACAAT
TTCATAGATTTGCCAATGTTTACTTTTTGTTTATTGTTATTTTGAATTGG
ATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCAATGCTCCCGTTAAT
TTTTGTTTTGGCTGTTACTGCAATCAAAGATCTTATAGAAGACAGACAAA
GATACAGTTCAGATAAAATCGTCAACAACAGAATCGCAGCTGTGTATGAC
AGATTGGTTCTTCGTGTATTCCAGACGTCTTTTTACCCGTCGGTGCTTCA
ACGAGTACGTTCTCATTTGACTGCGTCAGGCGAACTGGCGGACAATAAAA
TGAAGTCATTCGGCGATGAGCCATGCCAAAATAATGATGGTGATAATGGA
ACCAACCAGACCTCATCAGCCACTTGAACGATCATCCATTTTGTGATCAT
CTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTTCATCTATTCCGCAT
TCACTGAAGTCAGTTTGTATTGGGGTATTTTCCACTTGATGGGCCATGCA
GAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTTGCTGTACTACCAAG
ATGTTTGTGGCATTATTATTCTGGTATCAAATATACAACGGATTTTCGGG
CTCCAATACAATTGATGACGTTTCACTTATTTTATACAATTTGGCGTTCA
CTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAATGTCTTCCCGAG
AAGGCGGTCTTTTCACGACCTATATTATATCAGTTAGGACAATATGGTAA
AGCGTACACACGCCCCTGGTTTTGGGTGTCCATCATTGATGCTTTCTACC
AAAGCCTGATTTTGTTTTTCATTCCGTATTTTACATATTTGAGTTTACCG
AACGCTGGTATGCTGGTGCTTGGTATATTATTCCACCAGTTGGCGGTAGT
GACTGCAAACCTTCATTGTGCTATCGAAACACCGAACTGGATTGGAGTTG
GAATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGGCCAGCGATTTCGTG
CTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTATTGCATGGCTTCTG
GTGTTATGAACGAATCTCTAGAATGATTTTATACTTTTTCTACAAAAACG
CTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAAGTCATGACACTC
GCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCAAACTGCTGAGGA
AACTGCAGTGAACATTGGTTTCTCCTGCAAACTTCTTGATCCTGCCATGG
AAATCATTACATTAAATTCGTCCACAAAGGAACAATGCAAAGAACTTCTT
CAACAAATCAAAATGAGGCTGGACTCTCAATGGCCCAGTTACACGGTGCT
TCCGACACATCGTTATTCGACCGATCAAAACTCTCGACCTCCGCTAGCTC
TTATCATCGATGGGATCACACTGTCGTTCACTTTAGAGAAACCTTTAGAC
TCGACGTTCATCGAGATCGCCAAACGTTGTGAATCAGTCATCTGTTGCCG
TGCCACACCTCTTCAAAAAGTATTGACGATCGCTTACAAGAAGGTGTCCC
AGAAACCATTGCAAGTTTACGTCATGCTGGTATCAAACTATGGATTCTTA
CTGGTGACAAACAGGATTTATCAGAGGAAGAATATGAGGGATGGCTTGAA
CAACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACGAAAAACTCGC
TCAATCAGCTGAAACTATCGAGACCAATTTCACATTACTTGGAGCCACAG
AAGATCTGGTGAAAAACACAGACGAGCAACTGGAAGGTTTTGCAAAAGAT
GGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCGATGACGAAGATACA
ATGCAGCTTTGTGAACGCTTGTACAAAGATACTGACAAAGCAAACGGTGA
TGACCTCATGAGAACGTGGGACGAATTCTTCACCGTTTTGACCATCTGCA
ATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCAGTGACACCCTCGAA
ACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGTAACGGAACACTAAA
TGGTACAACCACGCATAAGAAATTATCTTTACCGACGAACTCTTTGAACG
GAAGTGCAAACATCAAGCATTTACCGCGTTCTATGACAATGAGTGGACCA
GAGGTCACCATCGACCCTGCTTCGCCACAAACGGAGAACGGTTTAGTCAG
ATTGAATGACAGTGGTGTAGATTTTTTATCGACTGAACGCCGAGTGCGTG
TGTTTTCTACAAAGATTTCTGATCGTTTATCACGAAGTATAGATAGTATA
AATAGTTGGTTGAACTATGGGCTGGTGCCAACTTATGAATACGAGTCACC
TGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTATAATTATAAACTAG
CTAACCGAACGCCTGAGCAAATCTTTTTCACCACGCCGGACGGTGAGATC
AAAGTATATGATATTCTTCAGGTGTTGACTTTCGATTCTGCGCGTAAACG
AATGTCTATTATCGTTCGTGATGACGAAGGCCAAATTAAAATGTACTCCA
AAGGTGCTGACACTACAATTATGAGCCGATTGGCTGATGACCAAGGTTAT
TATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGTCAAATTGGGTCAAG
TGTACTTCATCAACCACGACATAGGATTGTATTACCCTGAAACTGCTCAA
TATCCAGTATGTAGGGCCACCAACATTAATGAAGATCTTGGTCAAATCCA
ATACATCTTCTCCGATAAGACGGGAACACTGACCGAAAATAAAATGGTAT
TCAAGAAATATTCCATTGCTGGACACTCTTTTGTCCATCCGGAAGGTACT
GGATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGTTCATGGGTTA
TGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTCTTGACTTTCG
TCATCATTCTACAGGTCATGATACGAAAGCCATGTTGAATAATAGTGGAA
CACGTTACAAGAGGAGTCGATTGGAGAAAGATATCAATAAAGATGTTTTA
GGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGGTGCCATTGAGTG
CAATCAAATGGTGGAGAGATAGCTATCGATCGAAACAACCTTTTGCTTAG
AGGATGTGTTATCAAAAATACTGAATCATTGTATGGCTTGGTTATCTATG
CTGGACGGGCATATTTTCAAAGTGAAAGAAGATGTGACGTTTCAGGTCAA
ATGTGAAACCCCTAACAACAACCTTCATAACTTCTATGGTTACATTGACA
CAGAGAAGTTTCCAGACAAGAAATGGTCGAATATAGAAGTTGGAGATATC
GTCAAATTATATAACAATGATATTCTGCCAGCAGACATGCTTCTCTTGAA
CTCAAGTGATGAAAATGGTTTGTGTCATGTTTCAACTGCTAACCTCGATG
GAGAAACCAATCTCAAACAAAAGCAAATTCCCAAAGGATTTCTAGAGATG
GTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCAATCAGCTGACAA
TGGAGAGGTTGACAATACTTGGACTGTCATCCCATCCGCCATCCTCAAAT
CTGAAGACTCCAAAACCTCAACACAAAAACATAAAAACAACAAAATCAAA
ACTACCAAATATACTTTACTGAGTTTCCTACCAAAGAACCTTTTCGAACA
ATTTCATAGATTTGCCAATGTTTACTTTTTGTTTATTGTTATTTTGAATT
GGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCAATGCTCCCGTTA
ATTTTTGTTTTGGCTGTTACTGCAATCAAAGATCTTATAGAAGACAGACA
AAGATACAGTTCAGATAAAATCGTCAACAACAGAATCGCAGCTGTGTATG
ACAGATTGGTTCTTCGTGTATTCCAGACGTCTTTTTACCCGTCGGTGCTT
CAACGAGTACGTTCTCATTTGACTGCGTCAGGCGAACTGGCGGACAATAA
AATGAAGTCATTCGGCGATGAGCCATGCCAAAATAATGATGGTGATAATG
GAACCAACCAGACCTCATCAGCCACTTGAACGATCATCCATTTTGTGATC
ATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTTCATCTATTCCGC
ATTCACTGAAGTCAGTTTGTATTGGGGTATTTTCCACTTGATGGGCCATG
CAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTTGCTGTACTACCA
AGATGTTTGTGGCATTATTATTCTGGTATCAAATATACAACGGATTTTCG
GGCTCCAATACAATTGATGACGTTTCACTTATTTTATACAATTTGGCGTT
CACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAATGTCTTCCCG
AGAAGGCGGTCTTTTCACGACCTATATTATATCAGTTAGGACAATATGGT
AAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATCATTGATGCTTTCTA
CCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTACATATTTGAGTTTAC
CGAACGCTGGTATGCTGGTGCTTGGTATATTATTCCACCAGTTGGCGGTA
GTGACTGCAAACCTTCATTGTGCTATCGAAACACCGAACTGGATTGGAGT
TGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGGCCAGCGATTTCG
TGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTATTGCATGGCTTC
TGGTGTTATGAACGAATCTCTAGAATGATTTTATACTTTTTCTACAAAAA
CGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAAGTCATGACAC
TCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCAAACTGCTGAG
GAAACTGCAGTGAACATTGGTTTCTCCTGCAAACTTCTTGATCCTGCCAT
GGAAATCATTACATTAAATTCGTCCACAAAGGAACAATGCAAAGAACTTC
TTCAACAAATCAAAATGAGGCTGGACTCTCAATGGCCCAGTTACACGGTG
CTTCCGACACATCGTTATTCGACCGATCAAAACTCTCGACCTCCGCTAGC
TCTTATCATCGATGGGATCACACTGTCGTTCACTTTAGAGAAACCTTTAG
ACTCGACGTTCATCGAGATCGCCAAACGTTGTGAATCAGTCATCTGTTGC
CGTGCCACACCTCTTCAAAAAGTATTGACGATCGCTTACAAGAAGGTGTC
CCAGAAACCATTGCAAGTTTACGTCATGCTGGTATCAAACTATGGATTCT
TACTGGTGACAAACAGGATTTATCAGAGGAAGAATATGAGGGATGGCTTG
AACAACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACGAAAAACTC
GCTCAATCAGCTGAAACTATCGAGACCAATTTCACATTACTTGGAGCCAC
AGAAGATCTGGTGAAAAACACAGACGAGCAACTGGAAGGTTTTGCAAAAG
ATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCGATGACGAAGATA
CAATGCAGCTTTGTGAACGCTTGTACAAAGATACTGACAAAGCAAACGGT
GATGACCTCATGAGAACGTGGGACGAATTCTTCACCGTTTTGACCATCTG
CAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCAGTGACACCCTCG
AAACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGTAACGGAACACTA
AATGGTACAACCACGCATAAGAAATTATCTTTACCGACGAACTCTTTGAA
CGGAAGTGCAAACATCAAGCATTTACCGCGTTCTATGACAATGAGTGGAC
CAGAGGTCACCATCGACCCTGCTTCGCCACAAACGGAGAACGGTTTAGTC
AGATTGAATGACAGTGGTGTAGATTTTTTATCGACTGAACGCCGAGTGCG
TGTGTTTTCTACAAAGATTTCTGATCGTTTATCACGAAGTATAGATAGTA
TAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTTATGAATACGAGTCA
CCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTATAATTATAAACT
AGCTAACCGAACGCCTGAGCAAATCTTTTTCACCACGCCGGACGGTGAGA
TCAAAGTATATGATATTCTTCAGGTGTTGACTTTCGATTCTGCGCGTAAA
CGAATGTCTATTATCGTTCGTGATGACGAAGGCCAAATTAAAATGTACTC
CAAAGGTGCTGACACTACAATTATGAGCCGATTGGCTGATGACCAAGGTT
ATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGTCAAATTGGGTCA
AGTGTACTTCATCAACCACGACATAGGATTGTATTACCCTGAAACTGCTC
AATATCCAGTATGTAGGGCCACCAACATTAATGAAGATCTTGGTCAAATC
CAATACATCTTCTCCGATAAGACGGGAACACTGACCGAAAATAAAATGGT
ATTCAAGAAATATTCCATTGCTGGACACTCTTTTGTCCATCCGGAAGGTA
CTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGTTCATGGGT
TATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTCTTGACTTT
CGTCATCATTCTACAGGTCATGATACGAAAGCCATGTTGAATAATAGTGG
AACACGTTACAAGAGGAGTCGATTGGAGAAAGATATCAATAAAGATGTTT
TAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGGTGCCATTGAG
TGCAATCAAATGGTGGAGAGATAGCTATCGATCGAAACAACCTTTTGCTT
AGAGGATGTGTTATCAAAAATACTGAATCATTGTATGGCTTGGTTATCTA
TGCTGGACGGGCATATTTTCAAAGTGAAAGAAGATGTGACGTTTCAGGTC
AAATGTGAAACCCCTAACAACAACCTTCATAACTTCTATGGTTACATTGA
CACAGAGAAGTTTCCAGACAAGAAATGGTCGAATATAGAAGTTGGAGATA
TCGTCAAATTATATAACAATGATATTCTGCCAGCAGACATGCTTCTCTTG
AACTCAAGTGATGAAAATGGTTTGTGTCATGTTTCAACTGCTAACCTCGA
TGGAGAAACCAATCTCAAACAAAAGCAAATTCCCAAAGGATTTCTAGAGA
TGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCAATCAGCTGAC
AATGGAGAGGTTGACAATACTTGGACTGTCATCCCATCCGCCATCCTCAA
ATCTGAAGACTCCAAAACCTCAACACAAAAACATAAAAACAACAAAATCA
AAACTACCAAATATACTTTACTGAGTTTCCTACCAAAGAACCTTTTCGAA
CAATTTCATAGATTTGCCAATGTTTACTTTTTGTTTATTGTTATTTTGAA
TTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCAATGCTCCCGT
TAATTTTTGTTTTGGCTGTTACTGCAATCAAAGATCTTATAGAAGACAGA
CAAAGATACAGTTCAGATAAAATCGTCAACAACAGAATCGCAGCTGTGTA
TGACAGATTGGTTCTTCGTGTATTCCAGACGTCTTTTTACCCGTCGGTGC
TTCAACGAGTACGTTCTCATTTGACTGCGTCAGGCGAACTGGCGGACAAT
AAAATGAAGTCATTCGGCGATGAGCCATGCCAAAATAATGATGGTGATAA
TGGAACCAACCAGACCTCATCAGCCACTTGAACGATCATCCATTTTGTGA
TCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTTCATCTATTCC
GCATTCACTGAAGTCAGTTTGTATTGGGGTATTTTCCACTTGATGGGCCA
TGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTTGCTGTACTAC
CAAGATGTTTGTGGCATTATTATTCTGGTATCAAATATACAACGGATTTT
CGGGCTCCAATACAATTGATGACGTTTCACTTATTTTATACAATTTGGCG
TTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAATGTCTTCC
CGAGAAGGCGGTCTTTTCACGACCTATATTATATCAGTTAGGACAATATG
GTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATCATTGATGCTTTC
TACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTACATATTTGAGTTT
ACCGAACGCTGGTATGCTGGTGCTTGGTATATTATTCCACCAGTTGGCGG
TAGTGACTGCAAACCTTCATTGTGCTATCGAAACACCGAACTGGATTGGA
GTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGGCCAGCGATTT
CGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTATTGCATGGCT
TCTGGTGTTATGAACGAATCTCTAGAATGATTTTATACTTTTTCTACAAA
AACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAAGTCATGAC
ACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCAAACTGCTG
AGGAAACTGCAGTGAACATTGGTTTCTCCTGCAAACTTCTTGATCCTGCC
ATGGAAATCATTACATTAAATTCGTCCACAAAGGAACAATGCAAAGAACT
TCTTCAACAAATCAAAATGAGGCTGGACTCTCAATGGCCCAGTTACACGG
TGCTTCCGACACATCGTTATTCGACCGATCAAAACTCTCGACCTCCGCTA
GCTCTTATCATCGATGGGATCACACTGTCGTTCACTTTAGAGAAACCTTT
AGACTCGACGTTCATCGAGATCGCCAAACGTTGTGAATCAGTCATCTGTT
GCCGTGCCACACCTCTTCAAAAAGTATTGACGATCGCTTACAAGAAGGTG
TCCCAGAAACCATTGCAAGTTTACGTCATGCTGGTATCAAACTATGGATT
CTTACTGGTGACAAACAGGATTTATCAGAGGAAGAATATGAGGGATGGCT
TGAACAACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACGAAAAAC
TCGCTCAATCAGCTGAAACTATCGAGACCAATTTCACATTACTTGGAGCC
ACAGAAGATCTGGTGAAAAACACAGACGAGCAACTGGAAGGTTTTGCAAA
AGATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCGATGACGAAGA
TACAATGCAGCTTTGTGAACGCTTGTACAAAGATACTGACAAAGCAAACG
GTGATGACCTCATGAGAACGTGGGACGAATTCTTCACCGTTTTGACCATC
TGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCAGTGACACCCT
CGAAACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGTAACGGAACAC
TAAATGGTACAACCACGCATAAGAAATTATCTTTACCGACGAACTCTTTG
AACGGAAGTGCAAACATCAAGCATTTACCGCGTTCTATGACAATGAGTGG
ACCAGAGGTCACCATCGACCCTGCTTCGCCACAAACGGAGAACGGTTTAG
TCAGATTGAATGACAGTGGTGTAGATTTTTTATCGACTGAACGCCGAGTG
CGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCACGAAGTATAGATAG
TATAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTTATGAATACGAGT
CACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTATAATTATAAA
CTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACCACGCCGGACGGTGA
GATCAAAGTATATGATATTCTTCAGGTGTTGACTTTCGATTCTGCGCGTA
AACGAATGTCTATTATCGTTCGTGATGACGAAGGCCAAATTAAAATGTAC
TCCAAAGGTGCTGACACTACAATTATGAGCCGATTGGCTGATGACCAAGG
TTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGTCAAATTGGGT
CAAGTGTACTTCATCAACCACGACATAGGATTGTATTACCCTGAAACTGC
TCAATATCCAGTATGTAGGGCCACCAACATTAATGAAGATCTTGGTCAAA
TCCAATACATCTTCTCCGATAAGACGGGAACACTGACCGAAAATAAAATG
GTATTCAAGAAATATTCCATTGCTGGACACTCTTTTGTCCATCCGGAAGG
TACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGTTCATGG
GTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTCTTGACT
TTCGTCATCATTCTACAGGTCATGATACGAAAGCCATGTTGAATAATAGT
GGAACACGTTACAAGAGGAGTCGATTGGAGAAAGATATCAATAAAGATGT
TTTAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGGTGCCATTG
AGTGCAATCAAATGGTGGAGAGATAGCTATCGATCGAAACAACCTTTTGC
TTAGAGGATGTGTTATCAAAAATACTGAATCATTGTATGGCTTGGTTATC
TATGCTGGACGGGCATATTTTCAAAGTGAAAGAAGATGTGACGTTTCAGG
TCAAATGTGAAACCCCTAACAACAACCTTCATAACTTCTATGGTTACATT
GACACAGAGAAGTTTCCAGACAAGAAATGGTCGAATATAGAAGTTGGAGA
TATCGTCAAATTATATAACAATGATATTCTGCCAGCAGACATGCTTCTCT
TGAACTCAAGTGATGAAAATGGTTTGTGTCATGTTTCAACTGCTAACCTC
GATGGAGAAACCAATCTCAAACAAAAGCAAATTCCCAAAGGATTTCTAGA
GATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCAATCAGCTG
ACAATGGAGAGGTTGACAATACTTGGACTGTCATCCCATCCGCCATCCTC
AAATCTGAAGACTCCAAAACCTCAACACAAAAACATAAAAACAACAAAAT
CAAAACTACCAAATATACTTTACTGAGTTTCCTACCAAAGAACCTTTTCG
AACAATTTCATAGATTTGCCAATGTTTACTTTTTGTTTATTGTTATTTTG
AATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCAATGCTCCC
GTTAATTTTTGTTTTGGCTGTTACTGCAATCAAAGATCTTATAGAAGACA
GACAAAGATACAGTTCAGATAAAATCGTCAACAACAGAATCGCAGCTGTG
TATGACAGATTGGTTCTTCGTGTATTCCAGACGTCTTTTTACCCGTCGGT
GCTTCAACGAGTACGTTCTCATTTGACTGCGTCAGGCGAACTGGCGGACA
ATAAAATGAAGTCATTCGGCGATGAGCCATGCCAAAATAATGATGGTGAT
AATGGAACCAACCAGACCTCATCAGCCACTTGAACGATCATCCATTTTGT
GATCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTTCATCTATT
CCGCATTCACTGAAGTCAGTTTGTATTGGGGTATTTTCCACTTGATGGGC
CATGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTTGCTGTACT
ACCAAGATGTTTGTGGCATTATTATTCTGGTATCAAATATACAACGGATT
TTCGGGCTCCAATACAATTGATGACGTTTCACTTATTTTATACAATTTGG
CGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAATGTCTT
CCCGAGAAGGCGGTCTTTTCACGACCTATATTATATCAGTTAGGACAATA
TGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATCATTGATGCTT
TCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTACATATTTGAGT
TTACCGAACGCTGGTATGCTGGTGCTTGGTATATTATTCCACCAGTTGGC
GGTAGTGACTGCAAACCTTCATTGTGCTATCGAAACACCGAACTGGATTG
GAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGGCCAGCGAT
TTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTATTGCATGG
CTTCTGGTGTTATGAACGAATCTCTAGAATGATTTTATACTTTTTCTACA
AAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAAGTCATG
ACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCAAACTGC
TGAGGAAACTGCAGTGAACATTGGTTTCTCCTGCAAACTTCTTGATCCTG
CCATGGAAATCATTACATTAAATTCGTCCACAAAGGAACAATGCAAAGAA
CTTCTTCAACAAATCAAAATGAGGCTGGACTCTCAATGGCCCAGTTACAC
GGTGCTTCCGACACATCGTTATTCGACCGATCAAAACTCTCGACCTCCGC
TAGCTCTTATCATCGATGGGATCACACTGTCGTTCACTTTAGAGAAACCT
TTAGACTCGACGTTCATCGAGATCGCCAAACGTTGTGAATCAGTCATCTG
TTGCCGTGCCACACCTCTTCAAAAAGTATTGACGATCGCTTACAAGAAGG
TGTCCCAGAAACCATTGCAAGTTTACGTCATGCTGGTATCAAACTATGGA
TTCTTACTGGTGACAAACAGGATTTATCAGAGGAAGAATATGAGGGATGG
CTTGAACAACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACGAAAA
ACTCGCTCAATCAGCTGAAACTATCGAGACCAATTTCACATTACTTGGAG
CCACAGAAGATCTGGTGAAAAACACAGACGAGCAACTGGAAGGTTTTGCA
AAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCGATGACGAA
GATACAATGCAGCTTTGTGAACGCTTGTACAAAGATACTGACAAAGCAAA
CGGTGATGACCTCATGAGAACGTGGGACGAATTCTTCACCGTTTTGACCA
TCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCAGTGACACC
CTCGAAACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGTAACGGAAC
ACTAAATGGTACAACCACGCATAAGAAATTATCTTTACCGACGAACTCTT
TGAACGGAAGTGCAAACATCAAGCATTTACCGCGTTCTATGACAATGAGT
GGACCAGAGGTCACCATCGACCCTGCTTCGCCACAAACGGAGAACGGTTT
AGTCAGATTGAATGACAGTGGTGTAGATTTTTTATCGACTGAACGCCGAG
TGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCACGAAGTATAGAT
AGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTTATGAATACGA
GTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTATAATTATA
AACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACCACGCCGGACGGT
GAGATCAAAGTATATGATATTCTTCAGGTGTTGACTTTCGATTCTGCGCG
TAAACGAATGTCTATTATCGTTCGTGATGACGAAGGCCAAATTAAAATGT
ACTCCAAAGGTGCTGACACTACAATTATGAGCCGATTGGCTGATGACCAA
GGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGTCAAATTGG
GTCAAGTGTACTTCATCAACCACGACATAGGATTGTATTACCCTGAAACT
GCTCAATATCCAGTATGTAGGGCCACCAACATTAATGAAGATCTTGGTCA
AATCCAATACATCTTCTCCGATAAGACGGGAACACTGACCGAAAATAAAA
TGGTATTCAAGAAATATTCCATTGCTGGACACTCTTTTGTCCATCCGGAA
GGTACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGTTCAT
GGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTCTTGA
CTTTCGTCATCATTCTACAGGTCATGATACGAAAGCCATGTTGAATAATA
GTGGAACACGTTACAAGAGGAGTCGATTGGAGAAAGATATCAATAAAGAT
GTTTTAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGGTGCCAT
TGAGTGCAATCAAATGGTGGAGAGATAGCTATCGATCGAAACAACCTTTT
GCTTAGAGGATGTGTTATCAAAAATACTGAATCATTGTATGGCTTGGTTA
TCTATGCTGGACGGGCATATTTTCAAAGTGAAAGAAGATGTGACGTTTCA
GGTCAAATGTGAAACCCCTAACAACAACCTTCATAACTTCTATGGTTACA
TTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGAATATAGAAGTTGGA
GATATCGTCAAATTATATAACAATGATATTCTGCCAGCAGACATGCTTCT
CTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGTTTCAACTGCTAACC
TCGATGGAGAAACCAATCTCAAACAAAAGCAAATTCCCAAAGGATTTCTA
GAGATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCAATCAGC
TGACAATGGAGAGGTTGACAATACTTGGACTGTCATCCCATCCGCCATCC
TCAAATCTGAAGACTCCAAAACCTCAACACAAAAACATAAAAACAACAAA
ATCAAAACTACCAAATATACTTTACTGAGTTTCCTACCAAAGAACCTTTT
CGAACAATTTCATAGATTTGCCAATGTTTACTTTTTGTTTATTGTTATTT
TGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCAATGCTC
CCGTTAATTTTTGTTTTGGCTGTTACTGCAATCAAAGATCTTATAGAAGA
CAGACAAAGATACAGTTCAGATAAAATCGTCAACAACAGAATCGCAGCTG
TGTATGACAGATTGGTTCTTCGTGTATTCCAGACGTCTTTTTACCCGTCG
GTGCTTCAACGAGTACGTTCTCATTTGACTGCGTCAGGCGAACTGGCGGA
CAATAAAATGAAGTCATTCGGCGATGAGCCATGCCAAAATAATGATGGTG
ATAATGGAACCAACCAGACCTCATCAGCCACTTGAACGATCATCCATTTT
GTGATCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTTCATCTA
TTCCGCATTCACTGAAGTCAGTTTGTATTGGGGTATTTTCCACTTGATGG
GCCATGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTTGCTGTA
CTACCAAGATGTTTGTGGCATTATTATTCTGGTATCAAATATACAACGGA
TTTTCGGGCTCCAATACAATTGATGACGTTTCACTTATTTTATACAATTT
GGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAATGTC
TTCCCGAGAAGGCGGTCTTTTCACGACCTATATTATATCAGTTAGGACAA
TATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATCATTGATGC
TTTCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTACATATTTGA
GTTTACCGAACGCTGGTATGCTGGTGCTTGGTATATTATTCCACCAGTTG
GCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAAACACCGAACTGGAT
TGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGGCCAGCG
ATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTATTGCAT
GGCTTCTGGTGTTATGAACGAATCTCTAGAATGATTTTATACTTTTTCTA
CAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAAGTCA
TGACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCAAACT
GCTGAGGAAACTGCAGTGAACATTGGTTTCTCCTGCAAACTTCTTGATCC
TGCCATGGAAATCATTACATTAAATTCGTCCACAAAGGAACAATGCAAAG
AACTTCTTCAACAAATCAAAATGAGGCTGGACTCTCAATGGCCCAGTTAC
ACGGTGCTTCCGACACATCGTTATTCGACCGATCAAAACTCTCGACCTCC
GCTAGCTCTTATCATCGATGGGATCACACTGTCGTTCACTTTAGAGAAAC
CTTTAGACTCGACGTTCATCGAGATCGCCAAACGTTGTGAATCAGTCATC
TGTTGCCGTGCCACACCTCTTCAAAAAGTATTGACGATCGCTTACAAGAA
GGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCTGGTATCAAACTATG
GATTCTTACTGGTGACAAACAGGATTTATCAGAGGAAGAATATGAGGGAT
GGCTTGAACAACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACGAA
AAACTCGCTCAATCAGCTGAAACTATCGAGACCAATTTCACATTACTTGG
AGCCACAGAAGATCTGGTGAAAAACACAGACGAGCAACTGGAAGGTTTTG
CAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCGATGACG
AAGATACAATGCAGCTTTGTGAACGCTTGTACAAAGATACTGACAAAGCA
AACGGTGATGACCTCATGAGAACGTGGGACGAATTCTTCACCGTTTTGAC
CATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCAGTGACA
CCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGTAACGGA
ACACTAAATGGTACAACCACGCATAAGAAATTATCTTTACCGACGAACTC
TTTGAACGGAAGTGCAAACATCAAGCATTTACCGCGTTCTATGACAATGA
GTGGACCAGAGGTCACCATCGACCCTGCTTCGCCACAAACGGAGAACGGT
TTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTATCGACTGAACGCCG
AGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCACGAAGTATAG
ATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTTATGAATAC
GAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTATAATTA
TAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACCACGCCGGACG
GTGAGATCAAAGTATATGATATTCTTCAGGTGTTGACTTTCGATTCTGCG
CGTAAACGAATGTCTATTATCGTTCGTGATGACGAAGGCCAAATTAAAAT
GTACTCCAAAGGTGCTGACACTACAATTATGAGCCGATTGGCTGATGACC
AAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGTCAAATT
GGGTCAAGTGTACTTCATCAACCACGACATAGGATTGTATTACCCTGAAA
CTGCTCAATATCCAGTATGTAGGGCCACCAACATTAATGAAGATCTTGGT
CAAATCCAATACATCTTCTCCGATAAGACGGGAACACTGACCGAAAATAA
AATGGTATTCAAGAAATATTCCATTGCTGGACACTCTTTTGTCCATCCGG
AAGGTACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGTTC
ATGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTCTT
GACTTTCGTCATCATTCTACAGGTCATGATACGAAAGCCATGTTGAATAA
TAGTGGAACACGTTACAAGAGGAGTCGATTGGAGAAAGATATCAATAAAG
ATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGGTGCC
ATTGAGTGCAATCAAATGGTGGAGAGATAGCTATCGATCGAAACAACCTT
TTGCTTAGAGGATGTGTTATCAAAAATACTGAATCATTGTATGGCTTGGT
TATCTATGCTGGACGGGCATATTTTCAAAGTGAAAGAAGATGTGACGTTT
CAGGTCAAATGTGAAACCCCTAACAACAACCTTCATAACTTCTATGGTTA
CATTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGAATATAGAAGTTG
GAGATATCGTCAAATTATATAACAATGATATTCTGCCAGCAGACATGCTT
CTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGTTTCAACTGCTAA
CCTCGATGGAGAAACCAATCTCAAACAAAAGCAAATTCCCAAAGGATTTC
TAGAGATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCAATCA
GCTGACAATGGAGAGGTTGACAATACTTGGACTGTCATCCCATCCGCCAT
CCTCAAATCTGAAGACTCCAAAACCTCAACACAAAAACATAAAAACAACA
AAATCAAAACTACCAAATATACTTTACTGAGTTTCCTACCAAAGAACCTT
TTCGAACAATTTCATAGATTTGCCAATGTTTACTTTTTGTTTATTGTTAT
TTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCAATGC
TCCCGTTAATTTTTGTTTTGGCTGTTACTGCAATCAAAGATCTTATAGAA
GACAGACAAAGATACAGTTCAGATAAAATCGTCAACAACAGAATCGCAGC
TGTGTATGACAGATTGGTTCTTCGTGTATTCCAGACGTCTTTTTACCCGT
CGGTGCTTCAACGAGTACGTTCTCATTTGACTGCGTCAGGCGAACTGGCG
GACAATAAAATGAAGTCATTCGGCGATGAGCCATGCCAAAATAATGATGG
TGATAATGGAACCAACCAGACCTCATCAGCCACTTGAACGATCATCCATT
TTGTGATCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTTCATC
TATTCCGCATTCACTGAAGTCAGTTTGTATTGGGGTATTTTCCACTTGAT
GGGCCATGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTTGCTG
TACTACCAAGATGTTTGTGGCATTATTATTCTGGTATCAAATATACAACG
GATTTTCGGGCTCCAATACAATTGATGACGTTTCACTTATTTTATACAAT
TTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAATG
TCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATTATATCAGTTAGGAC
AATATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATCATTGAT
GCTTTCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTACATATTT
GAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTATATTATTCCACCAGT
TGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAAACACCGAACTGG
ATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGGCCAG
CGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTATTGC
ATGGCTTCTGGTGTTATGAACGAATCTCTAGAATGATTTTATACTTTTTC
TACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAAGT
CATGACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCAAA
CTGCTGAGGAAACTGCAGTGAACATTGGTTTCTCCTGCAAACTTCTTGAT
CCTGCCATGGAAATCATTACATTAAATTCGTCCACAAAGGAACAATGCAA
AGAACTTCTTCAACAAATCAAAATGAGGCTGGACTCTCAATGGCCCAGTT
ACACGGTGCTTCCGACACATCGTTATTCGACCGATCAAAACTCTCGACCT
CCGCTAGCTCTTATCATCGATGGGATCACACTGTCGTTCACTTTAGAGAA
ACCTTTAGACTCGACGTTCATCGAGATCGCCAAACGTTGTGAATCAGTCA
TCTGTTGCCGTGCCACACCTCTTCAAAAAGTATTGACGATCGCTTACAAG
AAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCTGGTATCAAACTA
TGGATTCTTACTGGTGACAAACAGGATTTATCAGAGGAAGAATATGAGGG
ATGGCTTGAACAACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGACG
AAAAACTCGCTCAATCAGCTGAAACTATCGAGACCAATTTCACATTACTT
GGAGCCACAGAAGATCTGGTGAAAAACACAGACGAGCAACTGGAAGGTTT
TGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCGATGA
CGAAGATACAATGCAGCTTTGTGAACGCTTGTACAAAGATACTGACAAAG
CAAACGGTGATGACCTCATGAGAACGTGGGACGAATTCTTCACCGTTTTG
ACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCAGTGA
CACCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGTAACG
GAACACTAAATGGTACAACCACGCATAAGAAATTATCTTTACCGACGAAC
TCTTTGAACGGAAGTGCAAACATCAAGCATTTACCGCGTTCTATGACAAT
GAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCCACAAACGGAGAACG
GTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTATCGACTGAACGC
CGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCACGAAGTAT
AGATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTTATGAAT
ACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTATAAT
TATAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACCACGCCGGA
CGGTGAGATCAAAGTATATGATATTCTTCAGGTGTTGACTTTCGATTCTG
CGCGTAAACGAATGTCTATTATCGTTCGTGATGACGAAGGCCAAATTAAA
ATGTACTCCAAAGGTGCTGACACTACAATTATGAGCCGATTGGCTGATGA
CCAAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGTCAAA
TTGGGTCAAGTGTACTTCATCAACCACGACATAGGATTGTATTACCCTGA
AACTGCTCAATATCCAGTATGTAGGGCCACCAACATTAATGAAGATCTTG
GTCAAATCCAATACATCTTCTCCGATAAGACGGGAACACTGACCGAAAAT
AAAATGGTATTCAAGAAATATTCCATTGCTGGACACTCTTTTGTCCATCC
GGAAGGTACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGATATGT
TCATGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTTTC
TTGACTTTCGTCATCATTCTACAGGTCATGATACGAAAGCCATGTTGAAT
AATAGTGGAACACGTTACAAGAGGAGTCGATTGGAGAAAGATATCAATAA
AGATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGGTG
CCATTGAGTGCAATCAAATGGTGGAGAGATAGCTATCGATCGAAACAACC
TTTTGCTTAGAGGATGTGTTATCAAAAATACTGAATCATTGTATGGCTTG
GTTATCTATGCTGGACGGGCATATTTTCAAAGTGAAAGAAGATGTGACGT
TTCAGGTCAAATGTGAAACCCCTAACAACAACCTTCATAACTTCTATGGT
TACATTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGAATATAGAAGT
TGGAGATATCGTCAAATTATATAACAATGATATTCTGCCAGCAGACATGC
TTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGTTTCAACTGCT
AACCTCGATGGAGAAACCAATCTCAAACAAAAGCAAATTCCCAAAGGATT
TCTAGAGATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCAAT
CAGCTGACAATGGAGAGGTTGACAATACTTGGACTGTCATCCCATCCGCC
ATCCTCAAATCTGAAGACTCCAAAACCTCAACACAAAAACATAAAAACAA
CAAAATCAAAACTACCAAATATACTTTACTGAGTTTCCTACCAAAGAACC
TTTTCGAACAATTTCATAGATTTGCCAATGTTTACTTTTTGTTTATTGTT
ATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCAAT
GCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAATCAAAGATCTTATAG
AAGACAGACAAAGATACAGTTCAGATAAAATCGTCAACAACAGAATCGCA
GCTGTGTATGACAGATTGGTTCTTCGTGTATTCCAGACGTCTTTTTACCC
GTCGGTGCTTCAACGAGTACGTTCTCATTTGACTGCGTCAGGCGAACTGG
CGGACAATAAAATGAAGTCATTCGGCGATGAGCCATGCCAAAATAATGAT
GGTGATAATGGAACCAACCAGACCTCATCAGCCACTTGAACGATCATCCA
TTTTGTGATCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTTCA
TCTATTCCGCATTCACTGAAGTCAGTTTGTATTGGGGTATTTTCCACTTG
ATGGGCCATGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTTGC
TGTACTACCAAGATGTTTGTGGCATTATTATTCTGGTATCAAATATACAA
CGGATTTTCGGGCTCCAATACAATTGATGACGTTTCACTTATTTTATACA
ATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATCAA
TGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATTATATCAGTTAGG
ACAATATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATCATTG
ATGCTTTCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTACATAT
TTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTATATTATTCCACCA
GTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAAACACCGAACT
GGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGGCC
AGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTATT
GCATGGCTTCTGGTGTTATGAACGAATCTCTAGAATGATTTTATACTTTT
TCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGAAA
GTCATGACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTGCA
AACTGCTGAGGAAACTGCAGTGAACATTGGTTTCTCCTGCAAACTTCTTG
ATCCTGCCATGGAAATCATTACATTAAATTCGTCCACAAAGGAACAATGC
AAAGAACTTCTTCAACAAATCAAAATGAGGCTGGACTCTCAATGGCCCAG
TTACACGGTGCTTCCGACACATCGTTATTCGACCGATCAAAACTCTCGAC
CTCCGCTAGCTCTTATCATCGATGGGATCACACTGTCGTTCACTTTAGAG
AAACCTTTAGACTCGACGTTCATCGAGATCGCCAAACGTTGTGAATCAGT
CATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATTGACGATCGCTTACA
AGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCTGGTATCAAAC
TATGGATTCTTACTGGTGACAAACAGGATTTATCAGAGGAAGAATATGAG
GGATGGCTTGAACAACACAAACAAGCAGAAGTTGCTTTGACTGATCGAGA
CGAAAAACTCGCTCAATCAGCTGAAACTATCGAGACCAATTTCACATTAC
TTGGAGCCACAGAAGATCTGGTGAAAAACACAGACGAGCAACTGGAAGGT
TTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCGAT
GACGAAGATACAATGCAGCTTTGTGAACGCTTGTACAAAGATACTGACAA
AGCAAACGGTGATGACCTCATGAGAACGTGGGACGAATTCTTCACCGTTT
TGACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCAGT
GACACCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGTAA
CGGAACACTAAATGGTACAACCACGCATAAGAAATTATCTTTACCGACGA
ACTCTTTGAACGGAAGTGCAAACATCAAGCATTTACCGCGTTCTATGACA
ATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCCACAAACGGAGAA
CGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTATCGACTGAAC
GCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCACGAAGT
ATAGATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTTATGA
ATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTATA
ATTATAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACCACGCCG
GACGGTGAGATCAAAGTATATGATATTCTTCAGGTGTTGACTTTCGATTC
TGCGCGTAAACGAATGTCTATTATCGTTCGTGATGACGAAGGCCAAATTA
AAATGTACTCCAAAGGTGCTGACACTACAATTATGAGCCGATTGGCTGAT
GACCAAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGTCA
AATTGGGTCAAGTGTACTTCATCAACCACGACATAGGATTGTATTACCCT
GAAACTGCTCAATATCCAGTATGTAGGGCCACCAACATTAATGAAGATCT
TGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAACACTGACCGAAA
ATAAAATGGTATTCAAGAAATATTCCATTGCTGGACACTCTTTTGTCCAT
CCGGAAGGTACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGATAT
GTTCATGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACGTT
TCTTGACTTTCGTCATCATTCTACAGGTCATGATACGAAAGCCATGTTGA
ATAATAGTGGAACACGTTACAAGAGGAGTCGATTGGAGAAAGATATCAAT
AAAGATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACTGG
TGCCATTGAGTGCAATCAAATGGTGGAGAGATAGCTATCGATCGAAACAA
CCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGAATCATTGTATGGCT
TGGTTATCTATGCTGGACGGGCATATTTTCAAAGTGAAAGAAGATGTGAC
GTTTCAGGTCAAATGTGAAACCCCTAACAACAACCTTCATAACTTCTATG
GTTACATTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGAATATAGAA
GTTGGAGATATCGTCAAATTATATAACAATGATATTCTGCCAGCAGACAT
GCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGTTTCAACTG
CTAACCTCGATGGAGAAACCAATCTCAAACAAAAGCAAATTCCCAAAGGA
TTTCTAGAGATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGCCA
ATCAGCTGACAATGGAGAGGTTGACAATACTTGGACTGTCATCCCATCCG
CCATCCTCAAATCTGAAGACTCCAAAACCTCAACACAAAAACATAAAAAC
AACAAAATCAAAACTACCAAATATACTTTACTGAGTTTCCTACCAAAGAA
CCTTTTCGAACAATTTCATAGATTTGCCAATGTTTACTTTTTGTTTATTG
TTATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTGCA
ATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAATCAAAGATCTTAT
AGAAGACAGACAAAGATACAGTTCAGATAAAATCGTCAACAACAGAATCG
CAGCTGTGTATGACAGATTGGTTCTTCGTGTATTCCAGACGTCTTTTTAC
CCGTCGGTGCTTCAACGAGTACGTTCTCATTTGACTGCGTCAGGCGAACT
GGCGGACAATAAAATGAAGTCATTCGGCGATGAGCCATGCCAAAATAATG
ATGGTGATAATGGAACCAACCAGACCTCATCAGCCACTTGAACGATCATC
CATTTTGTGATCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTCTT
CATCTATTCCGCATTCACTGAAGTCAGTTTGTATTGGGGTATTTTCCACT
TGATGGGCCATGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCCTT
GCTGTACTACCAAGATGTTTGTGGCATTATTATTCTGGTATCAAATATAC
AACGGATTTTCGGGCTCCAATACAATTGATGACGTTTCACTTATTTTATA
CAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGATC
AATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATTATATCAGTTA
GGACAATATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATCAT
TGATGCTTTCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTACAT
ATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTATATTATTCCAC
CAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAAACACCGAA
CTGGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTGATGG
CCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGTTA
TTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGAATGATTTTATACTT
TTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCTGA
AAGTCATGACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGCTG
CAAACTGCTGAGGAAACTGCAGTGAACATTGGTTTCTCCTGCAAACTTCT
TGATCCTGCCATGGAAATCATTACATTAAATTCGTCCACAAAGGAACAAT
GCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGGACTCTCAATGGCCC
AGTTACACGGTGCTTCCGACACATCGTTATTCGACCGATCAAAACTCTCG
ACCTCCGCTAGCTCTTATCATCGATGGGATCACACTGTCGTTCACTTTAG
AGAAACCTTTAGACTCGACGTTCATCGAGATCGCCAAACGTTGTGAATCA
GTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATTGACGATCGCTTA
CAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCTGGTATCAA
ACTATGGATTCTTACTGGTGACAAACAGGATTTATCAGAGGAAGAATATG
AGGGATGGCTTGAACAACACAAACAAGCAGAAGTTGCTTTGACTGATCGA
GACGAAAAACTCGCTCAATCAGCTGAAACTATCGAGACCAATTTCACATT
ACTTGGAGCCACAGAAGATCTGGTGAAAAACACAGACGAGCAACTGGAAG
GTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCGCG
ATGACGAAGATACAATGCAGCTTTGTGAACGCTTGTACAAAGATACTGAC
AAAGCAAACGGTGATGACCTCATGAGAACGTGGGACGAATTCTTCACCGT
TTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCATCA
GTGACACCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAGATGAGCGT
AACGGAACACTAAATGGTACAACCACGCATAAGAAATTATCTTTACCGAC
GAACTCTTTGAACGGAAGTGCAAACATCAAGCATTTACCGCGTTCTATGA
CAATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCCACAAACGGAG
AACGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTATCGACTGA
ACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCACGAA
GTATAGATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTTAT
GAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTTTA
TAATTATAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACCACGC
CGGACGGTGAGATCAAAGTATATGATATTCTTCAGGTGTTGACTTTCGAT
TCTGCGCGTAAACGAATGTCTATTATCGTTCGTGATGACGAAGGCCAAAT
TAAAATGTACTCCAAAGGTGCTGACACTACAATTATGAGCCGATTGGCTG
ATGACCAAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATCGT
CAAATTGGGTCAAGTGTACTTCATCAACCACGACATAGGATTGTATTACC
CTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAACATTAATGAAGAT
CTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAACACTGACCGA
AAATAAAATGGTATTCAAGAAATATTCCATTGCTGGACACTCTTTTGTCC
ATCCGGAAGGTACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAGAT
ATGTTCATGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTACG
TTTCTTGACTTTCGTCATCATTCTACAGGTCATGATACGAAAGCCATGTT
GAATAATAGTGGAACACGTTACAAGAGGAGTCGATTGGAGAAAGATATCA
ATAAAGATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGACT
GGTGCCATTGAGTGCAATCAAATGGTGGAGAGATAGCTATCGATCGAAAC
AACCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGAATCATTGTATGG
CTTGGTTATCTATGCTGGACGGGCATATTTTCAAAGTGAAAGAAGATGTG
ACGTTTCAGGTCAAATGTGAAACCCCTAACAACAACCTTCATAACTTCTA
TGGTTACATTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGAATATAG
AAGTTGGAGATATCGTCAAATTATATAACAATGATATTCTGCCAGCAGAC
ATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGTTTCAAC
TGCTAACCTCGATGGAGAAACCAATCTCAAACAAAAGCAAATTCCCAAAG
GATTTCTAGAGATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCAGC
CAATCAGCTGACAATGGAGAGGTTGACAATACTTGGACTGTCATCCCATC
CGCCATCCTCAAATCTGAAGACTCCAAAACCTCAACACAAAAACATAAAA
ACAACAAAATCAAAACTACCAAATATACTTTACTGAGTTTCCTACCAAAG
AACCTTTTCGAACAATTTCATAGATTTGCCAATGTTTACTTTTTGTTTAT
TGTTATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGATTG
CAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAATCAAAGATCTT
ATAGAAGACAGACAAAGATACAGTTCAGATAAAATCGTCAACAACAGAAT
CGCAGCTGTGTATGACAGATTGGTTCTTCGTGTATTCCAGACGTCTTTTT
ACCCGTCGGTGCTTCAACGAGTACGTTCTCATTTGACTGCGTCAGGCGAA
CTGGCGGACAATAAAATGAAGTCATTCGGCGATGAGCCATGCCAAAATAA
TGATGGTGATAATGGAACCAACCAGACCTCATCAGCCACTTGAACGATCA
TCCATTTTGTGATCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATTTC
TTCATCTATTCCGCATTCACTGAAGTCAGTTTGTATTGGGGTATTTTCCA
CTTGATGGGCCATGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTTCC
TTGCTGTACTACCAAGATGTTTGTGGCATTATTATTCTGGTATCAAATAT
ACAACGGATTTTCGGGCTCCAATACAATTGATGACGTTTCACTTATTTTA
TACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTTGA
TCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATTATATCAGT
TAGGACAATATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCATC
ATTGATGCTTTCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTTAC
ATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTATATTATTCC
ACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAAACACCG
AACTGGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTGAT
GGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTTGT
TATTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGAATGATTTTATAC
TTTTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAACCT
GAAAGTCATGACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTATGC
TGCAAACTGCTGAGGAAACTGCAGTGAACATTGGTTTCTCCTGCAAACTT
CTTGATCCTGCCATGGAAATCATTACATTAAATTCGTCCACAAAGGAACA
ATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGGACTCTCAATGGC
CCAGTTACACGGTGCTTCCGACACATCGTTATTCGACCGATCAAAACTCT
CGACCTCCGCTAGCTCTTATCATCGATGGGATCACACTGTCGTTCACTTT
AGAGAAACCTTTAGACTCGACGTTCATCGAGATCGCCAAACGTTGTGAAT
CAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATTGACGATCGCT
TACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCTGGTATC
AAACTATGGATTCTTACTGGTGACAAACAGGATTTATCAGAGGAAGAATA
TGAGGGATGGCTTGAACAACACAAACAAGCAGAAGTTGCTTTGACTGATC
GAGACGAAAAACTCGCTCAATCAGCTGAAACTATCGAGACCAATTTCACA
TTACTTGGAGCCACAGAAGATCTGGTGAAAAACACAGACGAGCAACTGGA
AGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGTCG
CGATGACGAAGATACAATGCAGCTTTGTGAACGCTTGTACAAAGATACTG
ACAAAGCAAACGGTGATGACCTCATGAGAACGTGGGACGAATTCTTCACC
GTTTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTCAT
CAGTGACACCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAGATGAGC
GTAACGGAACACTAAATGGTACAACCACGCATAAGAAATTATCTTTACCG
ACGAACTCTTTGAACGGAAGTGCAAACATCAAGCATTTACCGCGTTCTAT
GACAATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCCACAAACGG
AGAACGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTATCGACT
GAACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCACG
AAGTATAGATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCAACTT
ATGAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTCTT
TATAATTATAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACCAC
GCCGGACGGTGAGATCAAAGTATATGATATTCTTCAGGTGTTGACTTTCG
ATTCTGCGCGTAAACGAATGTCTATTATCGTTCGTGATGACGAAGGCCAA
ATTAAAATGTACTCCAAAGGTGCTGACACTACAATTATGAGCCGATTGGC
TGATGACCAAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGATC
GTCAAATTGGGTCAAGTGTACTTCATCAACCACGACATAGGATTGTATTA
CCCTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAACATTAATGAAG
ATCTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAACACTGACC
GAAAATAAAATGGTATTCAAGAAATATTCCATTGCTGGACACTCTTTTGT
CCATCCGGAAGGTACTGGATATTGGACGAGCGAGAATGGTCTGTATGAAG
ATATGTTCATGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCCTA
CGTTTCTTGACTTTCGTCATCATTCTACAGGTCATGATACGAAAGCCATG
TTGAATAATAGTGGAACACGTTACAAGAGGAGTCGATTGGAGAAAGATAT
CAATAAAGATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCTATGCTTGA
CTGGTGCCATTGAGTGCAATCAAATGGTGGAGAGATAGCTATCGATCGAA
ACAACCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGAATCATTGTAT
GGCTTGGTTATCTATGCTGGACGGGCATATTTTCAAAGTGAAAGAAGATG
TGACGTTTCAGGTCAAATGTGAAACCCCTAACAACAACCTTCATAACTTC
TATGGTTACATTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGAATAT
AGAAGTTGGAGATATCGTCAAATTATATAACAATGATATTCTGCCAGCAG
ACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGTTTCA
ACTGCTAACCTCGATGGAGAAACCAATCTCAAACAAAAGCAAATTCCCAA
AGGATTTCTAGAGATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAGCA
GCCAATCAGCTGACAATGGAGAGGTTGACAATACTTGGACTGTCATCCCA
TCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCAACACAAAAACATAA
AAACAACAAAATCAAAACTACCAAATATACTTTACTGAGTTTCCTACCAA
AGAACCTTTTCGAACAATTTCATAGATTTGCCAATGTTTACTTTTTGTTT
ATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAGAT
TGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAATCAAAGATC
TTATAGAAGACAGACAAAGATACAGTTCAGATAAAATCGTCAACAACAGA
ATCGCAGCTGTGTATGACAGATTGGTTCTTCGTGTATTCCAGACGTCTTT
TTACCCGTCGGTGCTTCAACGAGTACGTTCTCATTTGACTGCGTCAGGCG
AACTGGCGGACAATAAAATGAAGTCATTCGGCGATGAGCCATGCCAAAAT
AATGATGGTGATAATGGAACCAACCAGACCTCATCAGCCACTTGAACGAT
CATCCATTTTGTGATCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTATT
TCTTCATCTATTCCGCATTCACTGAAGTCAGTTTGTATTGGGGTATTTTC
CACTTGATGGGCCATGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCTTT
CCTTGCTGTACTACCAAGATGTTTGTGGCATTATTATTCTGGTATCAAAT
ATACAACGGATTTTCGGGCTCCAATACAATTGATGACGTTTCACTTATTT
TATACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGTTT
GATCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATTATATCA
GTTAGGACAATATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTCCA
TCATTGATGCTTTCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATTTT
ACATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTATATTATT
CCACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAAACAC
CGAACTGGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTGTG
ATGGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTGTT
GTTATTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGAATGATTTTAT
ACTTTTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACAAC
CTGAAAGTCATGACACTCGCTATCGGTGATGGCGCAAATGACGTCAGTAT
GCTGCAAACTGCTGAGGAAACTGCAGTGAACATTGGTTTCTCCTGCAAAC
TTCTTGATCCTGCCATGGAAATCATTACATTAAATTCGTCCACAAAGGAA
CAATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGGACTCTCAATG
GCCCAGTTACACGGTGCTTCCGACACATCGTTATTCGACCGATCAAAACT
CTCGACCTCCGCTAGCTCTTATCATCGATGGGATCACACTGTCGTTCACT
TTAGAGAAACCTTTAGACTCGACGTTCATCGAGATCGCCAAACGTTGTGA
ATCAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATTGACGATCG
CTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCTGGTA
TCAAACTATGGATTCTTACTGGTGACAAACAGGATTTATCAGAGGAAGAA
TATGAGGGATGGCTTGAACAACACAAACAAGCAGAAGTTGCTTTGACTGA
TCGAGACGAAAAACTCGCTCAATCAGCTGAAACTATCGAGACCAATTTCA
CATTACTTGGAGCCACAGAAGATCTGGTGAAAAACACAGACGAGCAACTG
GAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGGGT
CGCGATGACGAAGATACAATGCAGCTTTGTGAACGCTTGTACAAAGATAC
TGACAAAGCAAACGGTGATGACCTCATGAGAACGTGGGACGAATTCTTCA
CCGTTTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAGTC
ATCAGTGACACCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAGATGA
GCGTAACGGAACACTAAATGGTACAACCACGCATAAGAAATTATCTTTAC
CGACGAACTCTTTGAACGGAAGTGCAAACATCAAGCATTTACCGCGTTCT
ATGACAATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCCACAAAC
GGAGAACGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTATCGA
CTGAACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTATCA
CGAAGTATAGATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCAAC
TTATGAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAGTC
TTTATAATTATAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCACC
ACGCCGGACGGTGAGATCAAAGTATATGATATTCTTCAGGTGTTGACTTT
CGATTCTGCGCGTAAACGAATGTCTATTATCGTTCGTGATGACGAAGGCC
AAATTAAAATGTACTCCAAAGGTGCTGACACTACAATTATGAGCCGATTG
GCTGATGACCAAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGAGA
TCGTCAAATTGGGTCAAGTGTACTTCATCAACCACGACATAGGATTGTAT
TACCCTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAACATTAATGA
AGATCTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAACACTGA
CCGAAAATAAAATGGTATTCAAGAAATATTCCATTGCTGGACACTCTTTT
GTCCATCCGGAAGGTACTGGATATTGGACGAGCGAGAATGGTCTGTATGA
AGATATGTTCATGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTTCC
TACGTTTCTTGACTTTCGTCATCATTCTACAGGTCATGATACGAAAGCCA
TGTTGAATAATAGTGGAACACGTTACAAGAGGAGTCGATTGGAGAAAGAT
ATCAATAAAGATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCTATGCTT
GACTGGTGCCATTGAGTGCAATCAAATGGTGGAGAGATAGCTATCGATCG
AAACAACCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGAATCATTGT
ATGGCTTGGTTATCTATGCTGGACGGGCATATTTTCAAAGTGAAAGAAGA
TGTGACGTTTCAGGTCAAATGTGAAACCCCTAACAACAACCTTCATAACT
TCTATGGTTACATTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGAAT
ATAGAAGTTGGAGATATCGTCAAATTATATAACAATGATATTCTGCCAGC
AGACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGTTT
CAACTGCTAACCTCGATGGAGAAACCAATCTCAAACAAAAGCAAATTCCC
AAAGGATTTCTAGAGATGGTTCGCAAGAAATTTAACCTCCCTGGTCAAAG
CAGCCAATCAGCTGACAATGGAGAGGTTGACAATACTTGGACTGTCATCC
CATCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCAACACAAAAACAT
AAAAACAACAAAATCAAAACTACCAAATATACTTTACTGAGTTTCCTACC
AAAGAACCTTTTCGAACAATTTCATAGATTTGCCAATGTTTACTTTTTGT
TTATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAGAG
ATTGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAATCAAAGA
TCTTATAGAAGACAGACAAAGATACAGTTCAGATAAAATCGTCAACAACA
GAATCGCAGCTGTGTATGACAGATTGGTTCTTCGTGTATTCCAGACGTCT
TTTTACCCGTCGGTGCTTCAACGAGTACGTTCTCATTTGACTGCGTCAGG
CGAACTGGCGGACAATAAAATGAAGTCATTCGGCGATGAGCCATGCCAAA
ATAATGATGGTGATAATGGAACCAACCAGACCTCATCAGCCACTTGAACG
ATCATCCATTTTGTGATCATCTTTGGAAGTGTGGTCATCTCCTTCTTGTA
TTTCTTCATCTATTCCGCATTCACTGAAGTCAGTTTGTATTGGGGTATTT
TCCACTTGATGGGCCATGCAGAATTCTGGTTGTTGTTAATCTTCTGTCCT
TTCCTTGCTGTACTACCAAGATGTTTGTGGCATTATTATTCTGGTATCAA
ATATACAACGGATTTTCGGGCTCCAATACAATTGATGACGTTTCACTTAT
TTTATACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGTGT
TTGATCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATTATAT
CAGTTAGGACAATATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTGTC
CATCATTGATGCTTTCTACCAAAGCCTGATTTTGTTTTTCATTCCGTATT
TTACATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTATATTA
TTCCACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAAAC
ACCGAACTGGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGCTG
TGATGGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTTTG
TTGTTATTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGAATGATTTT
ATACTTTTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGACA
ACCTGAAAGTCATGACACTCGCTATCGGTGATGGCGCAAATGACGTCAGT
ATGCTGCAAACTGCTGAGGAAACTGCAGTGAACATTGGTTTCTCCTGCAA
ACTTCTTGATCCTGCCATGGAAATCATTACATTAAATTCGTCCACAAAGG
AACAATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGGACTCTCAA
TGGCCCAGTTACACGGTGCTTCCGACACATCGTTATTCGACCGATCAAAA
CTCTCGACCTCCGCTAGCTCTTATCATCGATGGGATCACACTGTCGTTCA
CTTTAGAGAAACCTTTAGACTCGACGTTCATCGAGATCGCCAAACGTTGT
GAATCAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATTGACGAT
CGCTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCTGG
TATCAAACTATGGATTCTTACTGGTGACAAACAGGATTTATCAGAGGAAG
AATATGAGGGATGGCTTGAACAACACAAACAAGCAGAAGTTGCTTTGACT
GATCGAGACGAAAAACTCGCTCAATCAGCTGAAACTATCGAGACCAATTT
CACATTACTTGGAGCCACAGAAGATCTGGTGAAAAACACAGACGAGCAAC
TGGAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAAGG
GTCGCGATGACGAAGATACAATGCAGCTTTGTGAACGCTTGTACAAAGAT
ACTGACAAAGCAAACGGTGATGACCTCATGAGAACGTGGGACGAATTCTT
CACCGTTTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGAAG
TCATCAGTGACACCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAGAT
GAGCGTAACGGAACACTAAATGGTACAACCACGCATAAGAAATTATCTTT
ACCGACGAACTCTTTGAACGGAAGTGCAAACATCAAGCATTTACCGCGTT
CTATGACAATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCCACAA
ACGGAGAACGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTATC
GACTGAACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTTAT
CACGAAGTATAGATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGCCA
ACTTATGAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCAAG
TCTTTATAATTATAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTTCA
CCACGCCGGACGGTGAGATCAAAGTATATGATATTCTTCAGGTGTTGACT
TTCGATTCTGCGCGTAAACGAATGTCTATTATCGTTCGTGATGACGAAGG
CCAAATTAAAATGTACTCCAAAGGTGCTGACACTACAATTATGAGCCGAT
TGGCTGATGACCAAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTGGA
GATCGTCAAATTGGGTCAAGTGTACTTCATCAACCACGACATAGGATTGT
ATTACCCTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAACATTAAT
GAAGATCTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAACACT
GACCGAAAATAAAATGGTATTCAAGAAATATTCCATTGCTGGACACTCTT
TTGTCCATCCGGAAGGTACTGGATATTGGACGAGCGAGAATGGTCTGTAT
GAAGATATGTTCATGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGCTT
CCTACGTTTCTTGACTTTCGTCATCATTCTACAGGTCATGATACGAAAGC
CATGTTGAATAATAGTGGAACACGTTACAAGAGGAGTCGATTGGAGAAAG
ATATCAATAAAGATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCTATGC
TTGACTGGTGCCATTGAGTGCAATCAAATGGTGGAGAGATAGCTATCGAT
CGAAACAACCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGAATCATT
GTATGGCTTGGTTATCTATGCTGGACGGGCATATTTTCAAAGTGAAAGAA
GATGTGACGTTTCAGGTCAAATGTGAAACCCCTAACAACAACCTTCATAA
CTTCTATGGTTACATTGACACAGAGAAGTTTCCAGACAAGAAATGGTCGA
ATATAGAAGTTGGAGATATCGTCAAATTATATAACAATGATATTCTGCCA
GCAGACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCATGT
TTCAACTGCTAACCTCGATGGAGAAACCAATCTCAAACAAAAGCAAATTC
CCAAAGGATTTCTAGAGATGGTTCGCAAGAAATTTAACCTCCCTGGTCAA
AGCAGCCAATCAGCTGACAATGGAGAGGTTGACAATACTTGGACTGTCAT
CCCATCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCAACACAAAAAC
ATAAAAACAACAAAATCAAAACTACCAAATATACTTTACTGAGTTTCCTA
CCAAAGAACCTTTTCGAACAATTTCATAGATTTGCCAATGTTTACTTTTT
GTTTATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAAAG
AGATTGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAATCAAA
GATCTTATAGAAGACAGACAAAGATACAGTTCAGATAAAATCGTCAACAA
CAGAATCGCAGCTGTGTATGACAGATTGGTTCTTCGTGTATTCCAGACGT
CTTTTTACCCGTCGGTGCTTCAACGAGTACGTTCTCATTTGACTGCGTCA
GGCGAACTGGCGGACAATAAAATGAAGTCATTCGGCGATGAGCCATGCCA
AAATAATGATGGTGATAATGGAACCAACCAGACCTCATCAGCCACTTGAA
CGATCATCCATTTTGTGATCATCTTTGGAAGTGTGGTCATCTCCTTCTTG
TATTTCTTCATCTATTCCGCATTCACTGAAGTCAGTTTGTATTGGGGTAT
TTTCCACTTGATGGGCCATGCAGAATTCTGGTTGTTGTTAATCTTCTGTC
CTTTCCTTGCTGTACTACCAAGATGTTTGTGGCATTATTATTCTGGTATC
AAATATACAACGGATTTTCGGGCTCCAATACAATTGATGACGTTTCACTT
ATTTTATACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGCGT
GTTTGATCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATTAT
ATCAGTTAGGACAATATGGTAAAGCGTACACACGCCCCTGGTTTTGGGTG
TCCATCATTGATGCTTTCTACCAAAGCCTGATTTTGTTTTTCATTCCGTA
TTTTACATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTATAT
TATTCCACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCGAA
ACACCGAACTGGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAAGC
TGTGATGGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCGTT
TGTTGTTATTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGAATGATT
TTATACTTTTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGTGA
CAACCTGAAAGTCATGACACTCGCTATCGGTGATGGCGCAAATGACGTCA
GTATGCTGCAAACTGCTGAGGAAACTGCAGTGAACATTGGTTTCTCCTGC
AAACTTCTTGATCCTGCCATGGAAATCATTACATTAAATTCGTCCACAAA
GGAACAATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGGACTCTC
AATGGCCCAGTTACACGGTGCTTCCGACACATCGTTATTCGACCGATCAA
AACTCTCGACCTCCGCTAGCTCTTATCATCGATGGGATCACACTGTCGTT
CACTTTAGAGAAACCTTTAGACTCGACGTTCATCGAGATCGCCAAACGTT
GTGAATCAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATTGACG
ATCGCTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATGCT
GGTATCAAACTATGGATTCTTACTGGTGACAAACAGGATTTATCAGAGGA
AGAATATGAGGGATGGCTTGAACAACACAAACAAGCAGAAGTTGCTTTGA
CTGATCGAGACGAAAAACTCGCTCAATCAGCTGAAACTATCGAGACCAAT
TTCACATTACTTGGAGCCACAGAAGATCTGGTGAAAAACACAGACGAGCA
ACTGGAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAAAA
GGGTCGCGATGACGAAGATACAATGCAGCTTTGTGAACGCTTGTACAAAG
ATACTGACAAAGCAAACGGTGATGACCTCATGAGAACGTGGGACGAATTC
TTCACCGTTTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCTGA
AGTCATCAGTGACACCCTCGAAACATCCGCTGATTTCACCTTCGCCGAAG
ATGAGCGTAACGGAACACTAAATGGTACAACCACGCATAAGAAATTATCT
TTACCGACGAACTCTTTGAACGGAAGTGCAAACATCAAGCATTTACCGCG
TTCTATGACAATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCCAC
AAACGGAGAACGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTTTA
TCGACTGAACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGTTT
ATCACGAAGTATAGATAGTATAAATAGTTGGTTGAACTATGGGCTGGTGC
CAACTTATGAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTTCA
AGTCTTTATAATTATAAACTAGCTAACCGAACGCCTGAGCAAATCTTTTT
CACCACGCCGGACGGTGAGATCAAAGTATATGATATTCTTCAGGTGTTGA
CTTTCGATTCTGCGCGTAAACGAATGTCTATTATCGTTCGTGATGACGAA
GGCCAAATTAAAATGTACTCCAAAGGTGCTGACACTACAATTATGAGCCG
ATTGGCTGATGACCAAGGTTATTATCCCTATCTCGTTGTATGTTTCGGTG
GAGATCGTCAAATTGGGTCAAGTGTACTTCATCAACCACGACATAGGATT
GTATTACCCTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAACATTA
ATGAAGATCTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAACA
CTGACCGAAAATAAAATGGTATTCAAGAAATATTCCATTGCTGGACACTC
TTTTGTCCATCCGGAAGGTACTGGATATTGGACGAGCGAGAATGGTCTGT
ATGAAGATATGTTCATGGGTTATGTTGCAGATTCACCAGCTTTTGAAGGC
TTCCTACGTTTCTTGACTTTCGTCATCATTCTACAGGTCATGATACGAAA
GCCATGTTGAATAATAGTGGAACACGTTACAAGAGGAGTCGATTGGAGAA
AGATATCAATAAAGATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCTAT
GCTTGACTGGTGCCATTGAGTGCAATCAAATGGTGGAGAGATAGCTATCG
ATCGAAACAACCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGAATCA
TTGTATGGCTTGGTTATCTATGCTGGACGGGCATATTTTCAAAGTGAAAG
AAGATGTGACGTTTCAGGTCAAATGTGAAACCCCTAACAACAACCTTCAT
AACTTCTATGGTTACATTGACACAGAGAAGTTTCCAGACAAGAAATGGTC
GAATATAGAAGTTGGAGATATCGTCAAATTATATAACAATGATATTCTGC
CAGCAGACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTCAT
GTTTCAACTGCTAACCTCGATGGAGAAACCAATCTCAAACAAAAGCAAAT
TCCCAAAGGATTTCTAGAGATGGTTCGCAAGAAATTTAACCTCCCTGGTC
AAAGCAGCCAATCAGCTGACAATGGAGAGGTTGACAATACTTGGACTGTC
ATCCCATCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCAACACAAAA
ACATAAAAACAACAAAATCAAAACTACCAAATATACTTTACTGAGTTTCC
TACCAAAGAACCTTTTCGAACAATTTCATAGATTTGCCAATGTTTACTTT
TTGTTTATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGTAA
AGAGATTGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAATCA
AAGATCTTATAGAAGACAGACAAAGATACAGTTCAGATAAAATCGTCAAC
AACAGAATCGCAGCTGTGTATGACAGATTGGTTCTTCGTGTATTCCAGAC
GTCTTTTTACCCGTCGGTGCTTCAACGAGTACGTTCTCATTTGACTGCGT
CAGGCGAACTGGCGGACAATAAAATGAAGTCATTCGGCGATGAGCCATGC
CAAAATAATGATGGTGATAATGGAACCAACCAGACCTCATCAGCCACTTG
AACGATCATCCATTTTGTGATCATCTTTGGAAGTGTGGTCATCTCCTTCT
TGTATTTCTTCATCTATTCCGCATTCACTGAAGTCAGTTTGTATTGGGGT
ATTTTCCACTTGATGGGCCATGCAGAATTCTGGTTGTTGTTAATCTTCTG
TCCTTTCCTTGCTGTACTACCAAGATGTTTGTGGCATTATTATTCTGGTA
TCAAATATACAACGGATTTTCGGGCTCCAATACAATTGATGACGTTTCAC
TTATTTTATACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATGGC
GTGTTTGATCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATATT
ATATCAGTTAGGACAATATGGTAAAGCGTACACACGCCCCTGGTTTTGGG
TGTCCATCATTGATGCTTTCTACCAAAGCCTGATTTTGTTTTTCATTCCG
TATTTTACATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGTAT
ATTATTCCACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTATCG
AAACACCGAACTGGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGCAA
GCTGTGATGGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAGCG
TTTGTTGTTATTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGAATGA
TTTTATACTTTTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCCGT
GACAACCTGAAAGTCATGACACTCGCTATCGGTGATGGCGCAAATGACGT
CAGTATGCTGCAAACTGCTGAGGAAACTGCAGTGAACATTGGTTTCTCCT
GCAAACTTCTTGATCCTGCCATGGAAATCATTACATTAAATTCGTCCACA
AAGGAACAATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGGACTC
TCAATGGCCCAGTTACACGGTGCTTCCGACACATCGTTATTCGACCGATC
AAAACTCTCGACCTCCGCTAGCTCTTATCATCGATGGGATCACACTGTCG
TTCACTTTAGAGAAACCTTTAGACTCGACGTTCATCGAGATCGCCAAACG
TTGTGAATCAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATTGA
CGATCGCTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCATG
CTGGTATCAAACTATGGATTCTTACTGGTGACAAACAGGATTTATCAGAG
GAAGAATATGAGGGATGGCTTGAACAACACAAACAAGCAGAAGTTGCTTT
GACTGATCGAGACGAAAAACTCGCTCAATCAGCTGAAACTATCGAGACCA
ATTTCACATTACTTGGAGCCACAGAAGATCTGGTGAAAAACACAGACGAG
CAACTGGAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCGAA
AAGGGTCGCGATGACGAAGATACAATGCAGCTTTGTGAACGCTTGTACAA
AGATACTGACAAAGCAAACGGTGATGACCTCATGAGAACGTGGGACGAAT
TCTTCACCGTTTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCAACCT
GAAGTCATCAGTGACACCCTCGAAACATCCGCTGATTTCACCTTCGCCGA
AGATGAGCGTAACGGAACACTAAATGGTACAACCACGCATAAGAAATTAT
CTTTACCGACGAACTCTTTGAACGGAAGTGCAAACATCAAGCATTTACCG
CGTTCTATGACAATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCGCC
ACAAACGGAGAACGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTTTT
TATCGACTGAACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATCGT
TTATCACGAAGTATAGATAGTATAAATAGTTGGTTGAACTATGGGCTGGT
GCCAACTTATGAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGCTT
CAAGTCTTTATAATTATAAACTAGCTAACCGAACGCCTGAGCAAATCTTT
TTCACCACGCCGGACGGTGAGATCAAAGTATATGATATTCTTCAGGTGTT
GACTTTCGATTCTGCGCGTAAACGAATGTCTATTATCGTTCGTGATGACG
AAGGCCAAATTAAAATGTACTCCAAAGGTGCTGACACTACAATTATGAGC
CGATTGGCTGATGACCAAGGTTATTATCCCTATCTCGTTGTATGTTTCGG
TGGAGATCGTCAAATTGGGTCAAGTGTACTTCATCAACCACGACATAGGA
TTGTATTACCCTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAACAT
TAATGAAGATCTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGGAA
CACTGACCGAAAATAAAATGGTATTCAAGAAATATTCCATTGCTGGACAC
TCTTTTGTCCATCCGGAAGGTACTGGATATTGGACGAGCGAGAATGGTCT
GTATGAAGATATGTTCATGGGTTATGTTGCAGATTCACCAGCTTTTGAAG
GCTTCCTACGTTTCTTGACTTTCGTCATCATTCTACAGGTCATGATACGA
AAGCCATGTTGAATAATAGTGGAACACGTTACAAGAGGAGTCGATTGGAG
AAAGATATCAATAAAGATGTTTTAGGTTGTGTTGCAATCCTATTCGTTCT
ATGCTTGACTGGTGCCATTGAGTGCAATCAAATGGTGGAGAGATAGCTAT
CGATCGAAACAACCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGAAT
CATTGTATGGCTTGGTTATCTATGCTGGACGGGCATATTTTCAAAGTGAA
AGAAGATGTGACGTTTCAGGTCAAATGTGAAACCCCTAACAACAACCTTC
ATAACTTCTATGGTTACATTGACACAGAGAAGTTTCCAGACAAGAAATGG
TCGAATATAGAAGTTGGAGATATCGTCAAATTATATAACAATGATATTCT
GCCAGCAGACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTGTC
ATGTTTCAACTGCTAACCTCGATGGAGAAACCAATCTCAAACAAAAGCAA
ATTCCCAAAGGATTTCTAGAGATGGTTCGCAAGAAATTTAACCTCCCTGG
TCAAAGCAGCCAATCAGCTGACAATGGAGAGGTTGACAATACTTGGACTG
TCATCCCATCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCAACACAA
AAACATAAAAACAACAAAATCAAAACTACCAAATATACTTTACTGAGTTT
CCTACCAAAGAACCTTTTCGAACAATTTCATAGATTTGCCAATGTTTACT
TTTTGTTTATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCATTTGGT
AAAGAGATTGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCAAT
CAAAGATCTTATAGAAGACAGACAAAGATACAGTTCAGATAAAATCGTCA
ACAACAGAATCGCAGCTGTGTATGACAGATTGGTTCTTCGTGTATTCCAG
ACGTCTTTTTACCCGTCGGTGCTTCAACGAGTACGTTCTCATTTGACTGC
GTCAGGCGAACTGGCGGACAATAAAATGAAGTCATTCGGCGATGAGCCAT
GCCAAAATAATGATGGTGATAATGGAACCAACCAGACCTCATCAGCCACT
TGAACGATCATCCATTTTGTGATCATCTTTGGAAGTGTGGTCATCTCCTT
CTTGTATTTCTTCATCTATTCCGCATTCACTGAAGTCAGTTTGTATTGGG
GTATTTTCCACTTGATGGGCCATGCAGAATTCTGGTTGTTGTTAATCTTC
TGTCCTTTCCTTGCTGTACTACCAAGATGTTTGTGGCATTATTATTCTGG
TATCAAATATACAACGGATTTTCGGGCTCCAATACAATTGATGACGTTTC
ACTTATTTTATACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAATG
GCGTGTTTGATCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTATA
TTATATCAGTTAGGACAATATGGTAAAGCGTACACACGCCCCTGGTTTTG
GGTGTCCATCATTGATGCTTTCTACCAAAGCCTGATTTTGTTTTTCATTC
CGTATTTTACATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTGGT
ATATTATTCCACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCTAT
CGAAACACCGAACTGGATTGGAGTTGGAATAGCAGGACAAGAAGGGGTGC
AAGCTGTGATGGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGAAG
CGTTTGTTGTTATTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGAAT
GATTTTATACTTTTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGTCC
GTGACAACCTGAAAGTCATGACACTCGCTATCGGTGATGGCGCAAATGAC
GTCAGTATGCTGCAAACTGCTGAGGAAACTGCAGTGAACATTGGTTTCTC
CTGCAAACTTCTTGATCCTGCCATGGAAATCATTACATTAAATTCGTCCA
CAAAGGAACAATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGGAC
TCTCAATGGCCCAGTTACACGGTGCTTCCGACACATCGTTATTCGACCGA
TCAAAACTCTCGACCTCCGCTAGCTCTTATCATCGATGGGATCACACTGT
CGTTCACTTTAGAGAAACCTTTAGACTCGACGTTCATCGAGATCGCCAAA
CGTTGTGAATCAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTATT
GACGATCGCTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGTCA
TGCTGGTATCAAACTATGGATTCTTACTGGTGACAAACAGGATTTATCAG
AGGAAGAATATGAGGGATGGCTTGAACAACACAAACAAGCAGAAGTTGCT
TTGACTGATCGAGACGAAAAACTCGCTCAATCAGCTGAAACTATCGAGAC
CAATTTCACATTACTTGGAGCCACAGAAGATCTGGTGAAAAACACAGACG
AGCAACTGGAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAGCG
AAAAGGGTCGCGATGACGAAGATACAATGCAGCTTTGTGAACGCTTGTAC
AAAGATACTGACAAAGCAAACGGTGATGACCTCATGAGAACGTGGGACGA
ATTCTTCACCGTTTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCAAC
CTGAAGTCATCAGTGACACCCTCGAAACATCCGCTGATTTCACCTTCGCC
GAAGATGAGCGTAACGGAACACTAAATGGTACAACCACGCATAAGAAATT
ATCTTTACCGACGAACTCTTTGAACGGAAGTGCAAACATCAAGCATTTAC
CGCGTTCTATGACAATGAGTGGACCAGAGGTCACCATCGACCCTGCTTCG
CCACAAACGGAGAACGGTTTAGTCAGATTGAATGACAGTGGTGTAGATTT
TTTATCGACTGAACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGATC
GTTTATCACGAAGTATAGATAGTATAAATAGTTGGTTGAACTATGGGCTG
GTGCCAACTTATGAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAAGC
TTCAAGTCTTTATAATTATAAACTAGCTAACCGAACGCCTGAGCAAATCT
TTTTCACCACGCCGGACGGTGAGATCAAAGTATATGATATTCTTCAGGTG
TTGACTTTCGATTCTGCGCGTAAACGAATGTCTATTATCGTTCGTGATGA
CGAAGGCCAAATTAAAATGTACTCCAAAGGTGCTGACACTACAATTATGA
GCCGATTGGCTGATGACCAAGGTTATTATCCCTATCTCGTTGTATGTTTC
GGTGGAGATCGTCAAATTGGGTCAAGTGTACTTCATCAACCACGACATAG
GATTGTATTACCCTGAAACTGCTCAATATCCAGTATGTAGGGCCACCAAC
ATTAATGAAGATCTTGGTCAAATCCAATACATCTTCTCCGATAAGACGGG
AACACTGACCGAAAATAAAATGGTATTCAAGAAATATTCCATTGCTGGAC
ACTCTTTTGTCCATCCGGAAGGTACTGGATATTGGACGAGCGAGAATGGT
CTGTATGAAGATATGTTCATGGGTTATGTTGCAGATTCACCAGCTTTTGA
AGGCTTCCTACGTTTCTTGACTTTCGTCATCATTCTACAGGTCATGATAC
GAAAGCCATGTTGAATAATAGTGGAACACGTTACAAGAGGAGTCGATTGG
AGAAAGATATCAATAAAGATGTTTTAGGTTGTGTTGCAATCCTATTCGTT
CTATGCTTGACTGGTGCCATTGAGTGCAATCAAATGGTGGAGAGATAGCT
ATCGATCGAAACAACCTTTTGCTTAGAGGATGTGTTATCAAAAATACTGA
ATCATTGTATGGCTTGGTTATCTATGCTGGACGGGCATATTTTCAAAGTG
AAAGAAGATGTGACGTTTCAGGTCAAATGTGAAACCCCTAACAACAACCT
TCATAACTTCTATGGTTACATTGACACAGAGAAGTTTCCAGACAAGAAAT
GGTCGAATATAGAAGTTGGAGATATCGTCAAATTATATAACAATGATATT
CTGCCAGCAGACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTGTG
TCATGTTTCAACTGCTAACCTCGATGGAGAAACCAATCTCAAACAAAAGC
AAATTCCCAAAGGATTTCTAGAGATGGTTCGCAAGAAATTTAACCTCCCT
GGTCAAAGCAGCCAATCAGCTGACAATGGAGAGGTTGACAATACTTGGAC
TGTCATCCCATCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCAACAC
AAAAACATAAAAACAACAAAATCAAAACTACCAAATATACTTTACTGAGT
TTCCTACCAAAGAACCTTTTCGAACAATTTCATAGATTTGCCAATGTTTA
CTTTTTGTTTATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCATTTG
GTAAAGAGATTGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTGCA
ATCAAAGATCTTATAGAAGACAGACAAAGATACAGTTCAGATAAAATCGT
CAACAACAGAATCGCAGCTGTGTATGACAGATTGGTTCTTCGTGTATTCC
AGACGTCTTTTTACCCGTCGGTGCTTCAACGAGTACGTTCTCATTTGACT
GCGTCAGGCGAACTGGCGGACAATAAAATGAAGTCATTCGGCGATGAGCC
ATGCCAAAATAATGATGGTGATAATGGAACCAACCAGACCTCATCAGCCA
CTTGAACGATCATCCATTTTGTGATCATCTTTGGAAGTGTGGTCATCTCC
TTCTTGTATTTCTTCATCTATTCCGCATTCACTGAAGTCAGTTTGTATTG
GGGTATTTTCCACTTGATGGGCCATGCAGAATTCTGGTTGTTGTTAATCT
TCTGTCCTTTCCTTGCTGTACTACCAAGATGTTTGTGGCATTATTATTCT
GGTATCAAATATACAACGGATTTTCGGGCTCCAATACAATTGATGACGTT
TCACTTATTTTATACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTCAA
TGGCGTGTTTGATCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACCTA
TATTATATCAGTTAGGACAATATGGTAAAGCGTACACACGCCCCTGGTTT
TGGGTGTCCATCATTGATGCTTTCTACCAAAGCCTGATTTTGTTTTTCAT
TCCGTATTTTACATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCTTG
GTATATTATTCCACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTGCT
ATCGAAACACCGAACTGGATTGGAGTTGGAATAGCAGGACAAGAAGGGGT
GCAAGCTGTGATGGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTTGA
AGCGTTTGTTGTTATTGCATGGCTTCTGGTGTTATGAACGAATCTCTAGA
ATGATTTTATACTTTTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTGGT
CCGTGACAACCTGAAAGTCATGACACTCGCTATCGGTGATGGCGCAAATG
ACGTCAGTATGCTGCAAACTGCTGAGGAAACTGCAGTGAACATTGGTTTC
TCCTGCAAACTTCTTGATCCTGCCATGGAAATCATTACATTAAATTCGTC
CACAAAGGAACAATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCTGG
ACTCTCAATGGCCCAGTTACACGGTGCTTCCGACACATCGTTATTCGACC
GATCAAAACTCTCGACCTCCGCTAGCTCTTATCATCGATGGGATCACACT
GTCGTTCACTTTAGAGAAACCTTTAGACTCGACGTTCATCGAGATCGCCA
AACGTTGTGAATCAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAGTA
TTGACGATCGCTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTACGT
CATGCTGGTATCAAACTATGGATTCTTACTGGTGACAAACAGGATTTATC
AGAGGAAGAATATGAGGGATGGCTTGAACAACACAAACAAGCAGAAGTTG
CTTTGACTGATCGAGACGAAAAACTCGCTCAATCAGCTGAAACTATCGAG
ACCAATTTCACATTACTTGGAGCCACAGAAGATCTGGTGAAAAACACAGA
CGAGCAACTGGAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTATAG
CGAAAAGGGTCGCGATGACGAAGATACAATGCAGCTTTGTGAACGCTTGT
ACAAAGATACTGACAAAGCAAACGGTGATGACCTCATGAGAACGTGGGAC
GAATTCTTCACCGTTTTGACCATCTGCAATACAGTAGTAGTCTCCTCGCA
ACCTGAAGTCATCAGTGACACCCTCGAAACATCCGCTGATTTCACCTTCG
CCGAAGATGAGCGTAACGGAACACTAAATGGTACAACCACGCATAAGAAA
TTATCTTTACCGACGAACTCTTTGAACGGAAGTGCAAACATCAAGCATTT
ACCGCGTTCTATGACAATGAGTGGACCAGAGGTCACCATCGACCCTGCTT
CGCCACAAACGGAGAACGGTTTAGTCAGATTGAATGACAGTGGTGTAGAT
TTTTTATCGACTGAACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCTGA
TCGTTTATCACGAAGTATAGATAGTATAAATAGTTGGTTGAACTATGGGC
TGGTGCCAACTTATGAATACGAGTCACCTGATGAAGGTGCTCTTGTCAAA
GCTTCAAGTCTTTATAATTATAAACTAGCTAACCGAACGCCTGAGCAAAT
CTTTTTCACCACGCCGGACGGTGAGATCAAAGTATATGATATTCTTCAGG
TGTTGACTTTCGATTCTGCGCGTAAACGAATGTCTATTATCGTTCGTGAT
GACGAAGGCCAAATTAAAATGTACTCCAAAGGTGCTGACACTACAATTAT
GAGCCGATTGGCTGATGACCAAGGTTATTATCCCTATCTCGTTGTATGTT
TCGGTGGAGATCGTCAAATTGGGTCAAGTGTACTTCATCAACCACGACAT
AGGATTGTATTACCCTGAAACTGCTCAATATCCAGTATGTAGGGCCACCA
ACATTAATGAAGATCTTGGTCAAATCCAATACATCTTCTCCGATAAGACG
GGAACACTGACCGAAAATAAAATGGTATTCAAGAAATATTCCATTGCTGG
ACACTCTTTTGTCCATCCGGAAGGTACTGGATATTGGACGAGCGAGAATG
GTCTGTATGAAGATATGTTCATGGGTTATGTTGCAGATTCACCAGCTTTT
GAAGGCTTCCTACGTTTCTTGACTTTCGTCATCATTCTACAGGTCATGAT
ACGAAAGCCATGTTGAATAATAGTGGAACACGTTACAAGAGGAGTCGATT
GGAGAAAGATATCAATAAAGATGTTTTAGGTTGTGTTGCAATCCTATTCG
TTCTATGCTTGACTGGTGCCATTGAGTGCAATCAAATGGTGGAGAGATAG
CTATCGATCGAAACAACCTTTTGCTTAGAGGATGTGTTATCAAAAATACT
GAATCATTGTATGGCTTGGTTATCTATGCTGGACGGGCATATTTTCAAAG
TGAAAGAAGATGTGACGTTTCAGGTCAAATGTGAAACCCCTAACAACAAC
CTTCATAACTTCTATGGTTACATTGACACAGAGAAGTTTCCAGACAAGAA
ATGGTCGAATATAGAAGTTGGAGATATCGTCAAATTATATAACAATGATA
TTCTGCCAGCAGACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTTTG
TGTCATGTTTCAACTGCTAACCTCGATGGAGAAACCAATCTCAAACAAAA
GCAAATTCCCAAAGGATTTCTAGAGATGGTTCGCAAGAAATTTAACCTCC
CTGGTCAAAGCAGCCAATCAGCTGACAATGGAGAGGTTGACAATACTTGG
ACTGTCATCCCATCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCAAC
ACAAAAACATAAAAACAACAAAATCAAAACTACCAAATATACTTTACTGA
GTTTCCTACCAAAGAACCTTTTCGAACAATTTCATAGATTTGCCAATGTT
TACTTTTTGTTTATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCATT
TGGTAAAGAGATTGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTACTG
CAATCAAAGATCTTATAGAAGACAGACAAAGATACAGTTCAGATAAAATC
GTCAACAACAGAATCGCAGCTGTGTATGACAGATTGGTTCTTCGTGTATT
CCAGACGTCTTTTTACCCGTCGGTGCTTCAACGAGTACGTTCTCATTTGA
CTGCGTCAGGCGAACTGGCGGACAATAAAATGAAGTCATTCGGCGATGAG
CCATGCCAAAATAATGATGGTGATAATGGAACCAACCAGACCTCATCAGC
CACTTGAACGATCATCCATTTTGTGATCATCTTTGGAAGTGTGGTCATCT
CCTTCTTGTATTTCTTCATCTATTCCGCATTCACTGAAGTCAGTTTGTAT
TGGGGTATTTTCCACTTGATGGGCCATGCAGAATTCTGGTTGTTGTTAAT
CTTCTGTCCTTTCCTTGCTGTACTACCAAGATGTTTGTGGCATTATTATT
CTGGTATCAAATATACAACGGATTTTCGGGCTCCAATACAATTGATGACG
TTTCACTTATTTTATACAATTTGGCGTTCACTTCTCTTCCGCCCATCTTC
AATGGCGTGTTTGATCAATGTCTTCCCGAGAAGGCGGTCTTTTCACGACC
TATATTATATCAGTTAGGACAATATGGTAAAGCGTACACACGCCCCTGGT
TTTGGGTGTCCATCATTGATGCTTTCTACCAAAGCCTGATTTTGTTTTTC
ATTCCGTATTTTACATATTTGAGTTTACCGAACGCTGGTATGCTGGTGCT
TGGTATATTATTCCACCAGTTGGCGGTAGTGACTGCAAACCTTCATTGTG
CTATCGAAACACCGAACTGGATTGGAGTTGGAATAGCAGGACAAGAAGGG
GTGCAAGCTGTGATGGCCAGCGATTTCGTGCTTGGGCGTTTCTATTTCTT
GAAGCGTTTGTTGTTATTGCATGGCTTCTGGTGTTATGAACGAATCTCTA
GAATGATTTTATACTTTTTCTACAAAAACGCTGCGTCAGTGGTGAAGTTG
GTCCGTGACAACCTGAAAGTCATGACACTCGCTATCGGTGATGGCGCAAA
TGACGTCAGTATGCTGCAAACTGCTGAGGAAACTGCAGTGAACATTGGTT
TCTCCTGCAAACTTCTTGATCCTGCCATGGAAATCATTACATTAAATTCG
TCCACAAAGGAACAATGCAAAGAACTTCTTCAACAAATCAAAATGAGGCT
GGACTCTCAATGGCCCAGTTACACGGTGCTTCCGACACATCGTTATTCGA
CCGATCAAAACTCTCGACCTCCGCTAGCTCTTATCATCGATGGGATCACA
CTGTCGTTCACTTTAGAGAAACCTTTAGACTCGACGTTCATCGAGATCGC
CAAACGTTGTGAATCAGTCATCTGTTGCCGTGCCACACCTCTTCAAAAAG
TATTGACGATCGCTTACAAGAAGGTGTCCCAGAAACCATTGCAAGTTTAC
GTCATGCTGGTATCAAACTATGGATTCTTACTGGTGACAAACAGGATTTA
TCAGAGGAAGAATATGAGGGATGGCTTGAACAACACAAACAAGCAGAAGT
TGCTTTGACTGATCGAGACGAAAAACTCGCTCAATCAGCTGAAACTATCG
AGACCAATTTCACATTACTTGGAGCCACAGAAGATCTGGTGAAAAACACA
GACGAGCAACTGGAAGGTTTTGCAAAAGATGGTCTTCGTACTTTGTGTAT
AGCGAAAAGGGTCGCGATGACGAAGATACAATGCAGCTTTGTGAACGCTT
GTACAAAGATACTGACAAAGCAAACGGTGATGACCTCATGAGAACGTGGG
ACGAATTCTTCACCGTTTTGACCATCTGCAATACAGTAGTAGTCTCCTCG
CAACCTGAAGTCATCAGTGACACCCTCGAAACATCCGCTGATTTCACCTT
CGCCGAAGATGAGCGTAACGGAACACTAAATGGTACAACCACGCATAAGA
AATTATCTTTACCGACGAACTCTTTGAACGGAAGTGCAAACATCAAGCAT
TTACCGCGTTCTATGACAATGAGTGGACCAGAGGTCACCATCGACCCTGC
TTCGCCACAAACGGAGAACGGTTTAGTCAGATTGAATGACAGTGGTGTAG
ATTTTTTATCGACTGAACGCCGAGTGCGTGTGTTTTCTACAAAGATTTCT
GATCGTTTATCACGAAGTATAGATAGTATAAATAGTTGGTTGAACTATGG
GCTGGTGCCAACTTATGAATACGAGTCACCTGATGAAGGTGCTCTTGTCA
AAGCTTCAAGTCTTTATAATTATAAACTAGCTAACCGAACGCCTGAGCAA
ATCTTTTTCACCACGCCGGACGGTGAGATCAAAGTATATGATATTCTTCA
GGTGTTGACTTTCGATTCTGCGCGTAAACGAATGTCTATTATCGTTCGTG
ATGACGAAGGCCAAATTAAAATGTACTCCAAAGGTGCTGACACTACAATT
ATGAGCCGATTGGCTGATGACCAAGGTTATTATCCCTATCTCGTTGTATG
TTTCGGTGGAGATCGTCAAATTGGGTCAAGTGTACTTCATCAACCACGAC
ATAGGATTGTATTACCCTGAAACTGCTCAATATCCAGTATGTAGGGCCAC
CAACATTAATGAAGATCTTGGTCAAATCCAATACATCTTCTCCGATAAGA
CGGGAACACTGACCGAAAATAAAATGGTATTCAAGAAATATTCCATTGCT
GGACACTCTTTTGTCCATCCGGAAGGTACTGGATATTGGACGAGCGAGAA
TGGTCTGTATGAAGATATGTTCATGGGTTATGTTGCAGATTCACCAGCTT
TTGAAGGCTTCCTACGTTTCTTGACTTTCGTCATCATTCTACAGGTCATG
ATACGAAAGCCATGTTGAATAATAGTGGAACACGTTACAAGAGGAGTCGA
TTGGAGAAAGATATCAATAAAGATGTTTTAGGTTGTGTTGCAATCCTATT
CGTTCTATGCTTGACTGGTGCCATTGAGTGCAATCAAATGGTGGAGAGAT
AGCTATCGATCGAAACAACCTTTTGCTTAGAGGATGTGTTATCAAAAATA
CTGAATCATTGTATGGCTTGGTTATCTATGCTGGACGGGCATATTTTCAA
AGTGAAAGAAGATGTGACGTTTCAGGTCAAATGTGAAACCCCTAACAACA
ACCTTCATAACTTCTATGGTTACATTGACACAGAGAAGTTTCCAGACAAG
AAATGGTCGAATATAGAAGTTGGAGATATCGTCAAATTATATAACAATGA
TATTCTGCCAGCAGACATGCTTCTCTTGAACTCAAGTGATGAAAATGGTT
TGTGTCATGTTTCAACTGCTAACCTCGATGGAGAAACCAATCTCAAACAA
AAGCAAATTCCCAAAGGATTTCTAGAGATGGTTCGCAAGAAATTTAACCT
CCCTGGTCAAAGCAGCCAATCAGCTGACAATGGAGAGGTTGACAATACTT
GGACTGTCATCCCATCCGCCATCCTCAAATCTGAAGACTCCAAAACCTCA
ACACAAAAACATAAAAACAACAAAATCAAAACTACCAAATATACTTTACT
GAGTTTCCTACCAAAGAACCTTTTCGAACAATTTCATAGATTTGCCAATG
TTTACTTTTTGTTTATTGTTATTTTGAATTGGATTCCTGCGGTAAATGCA
TTTGGTAAAGAGATTGCAATGCTCCCGTTAATTTTTGTTTTGGCTGTTAC
TGCAATCAAAGATCTTATAGAAGACAGACAAAGATACAGTTCAGATAAAA
TCGTCAACAACAGAATCGCAGCTGTGTATGACAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000615XLOC_000615Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001097-exon-sc0000007-1575043694:151091..151170TCONS_00001097-exon-sc0000007-1575043694:151091..151170Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:144243..144727TCONS_00001097-exon-sc0000007-1575043694:144243..144727Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:143927..144128TCONS_00001097-exon-sc0000007-1575043694:143927..144128Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:143719..143810TCONS_00001097-exon-sc0000007-1575043694:143719..143810Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:143420..143526TCONS_00001097-exon-sc0000007-1575043694:143420..143526Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:142944..143075TCONS_00001097-exon-sc0000007-1575043694:142944..143075Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:140250..140368TCONS_00001097-exon-sc0000007-1575043694:140250..140368Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:139062..139311TCONS_00001097-exon-sc0000007-1575043694:139062..139311Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:138112..138876TCONS_00001097-exon-sc0000007-1575043694:138112..138876Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:137821..137900TCONS_00001097-exon-sc0000007-1575043694:137821..137900Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:137573..137708TCONS_00001097-exon-sc0000007-1575043694:137573..137708Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:137336..137430TCONS_00001097-exon-sc0000007-1575043694:137336..137430Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:136676..136996TCONS_00001097-exon-sc0000007-1575043694:136676..136996Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:136416..136511TCONS_00001097-exon-sc0000007-1575043694:136416..136511Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:136025..136186TCONS_00001097-exon-sc0000007-1575043694:136025..136186Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:135475..135864TCONS_00001097-exon-sc0000007-1575043694:135475..135864Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:134438..134610TCONS_00001097-exon-sc0000007-1575043694:134438..134610Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1575043694:132939..133877TCONS_00001097-exon-sc0000007-1575043694:132939..133877Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:151091..151170TCONS_00001097-exon-sc0000007-1510915933:151091..151170Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:144243..144727TCONS_00001097-exon-sc0000007-1510915933:144243..144727Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:143927..144128TCONS_00001097-exon-sc0000007-1510915933:143927..144128Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:143719..143810TCONS_00001097-exon-sc0000007-1510915933:143719..143810Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:143420..143526TCONS_00001097-exon-sc0000007-1510915933:143420..143526Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:142944..143075TCONS_00001097-exon-sc0000007-1510915933:142944..143075Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:140250..140368TCONS_00001097-exon-sc0000007-1510915933:140250..140368Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:139062..139311TCONS_00001097-exon-sc0000007-1510915933:139062..139311Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:138112..138876TCONS_00001097-exon-sc0000007-1510915933:138112..138876Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:137821..137900TCONS_00001097-exon-sc0000007-1510915933:137821..137900Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:137573..137708TCONS_00001097-exon-sc0000007-1510915933:137573..137708Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:137336..137430TCONS_00001097-exon-sc0000007-1510915933:137336..137430Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:136676..136996TCONS_00001097-exon-sc0000007-1510915933:136676..136996Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:136416..136511TCONS_00001097-exon-sc0000007-1510915933:136416..136511Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:136025..136186TCONS_00001097-exon-sc0000007-1510915933:136025..136186Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:135475..135864TCONS_00001097-exon-sc0000007-1510915933:135475..135864Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:134438..134610TCONS_00001097-exon-sc0000007-1510915933:134438..134610Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1510915933:132939..133877TCONS_00001097-exon-sc0000007-1510915933:132939..133877Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:151091..151170TCONS_00001097-exon-sc0000007-1491911889:151091..151170Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:144243..144727TCONS_00001097-exon-sc0000007-1491911889:144243..144727Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:143927..144128TCONS_00001097-exon-sc0000007-1491911889:143927..144128Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:143719..143810TCONS_00001097-exon-sc0000007-1491911889:143719..143810Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:143420..143526TCONS_00001097-exon-sc0000007-1491911889:143420..143526Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:142944..143075TCONS_00001097-exon-sc0000007-1491911889:142944..143075Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:140250..140368TCONS_00001097-exon-sc0000007-1491911889:140250..140368Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:139062..139311TCONS_00001097-exon-sc0000007-1491911889:139062..139311Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:138112..138876TCONS_00001097-exon-sc0000007-1491911889:138112..138876Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:137821..137900TCONS_00001097-exon-sc0000007-1491911889:137821..137900Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:137573..137708TCONS_00001097-exon-sc0000007-1491911889:137573..137708Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:137336..137430TCONS_00001097-exon-sc0000007-1491911889:137336..137430Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:136676..136996TCONS_00001097-exon-sc0000007-1491911889:136676..136996Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:136416..136511TCONS_00001097-exon-sc0000007-1491911889:136416..136511Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:136025..136186TCONS_00001097-exon-sc0000007-1491911889:136025..136186Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:135475..135864TCONS_00001097-exon-sc0000007-1491911889:135475..135864Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:134438..134610TCONS_00001097-exon-sc0000007-1491911889:134438..134610Clytia hemisphaericaexon
TCONS_00001097-exon-sc0000007-1491911889:132939..133877TCONS_00001097-exon-sc0000007-1491911889:132939..133877Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001097-proteinTCONS_00001097-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:132939..151170 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
32.3599 30.8586 17.1142 16.4409 32.304 23.9514 28.5348 30.2828 29.2193 31.4286 42.9452 35.3323 54.7792 56.811 38.2512 44.4772 19.6958 27.8173 44.3423 43.2993 25.9343 27.8539 24.2134 29.6528 21.8192 24.5243 18.7757 18.6385 40.5013 34.6672
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006539P-type_ATPase_IV
IPR023299ATPase_P-typ_cyto_domN
IPR032630P_typ_ATPase_c
IPR032631P-type_ATPase_N
IPR001757P_typ_ATPase
IPR018303ATPase_P-typ_P_site
IPR008250ATPase_P-typ_transduc_dom_A
IPR023214HAD-like_dom
IPR023298ATPase_P-typ_TM_dom
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0000287magnesium ion binding
GO:0004012phospholipid-translocating ATPase activity
GO:0000166nucleotide binding
Vocabulary: Biological Process
TermDefinition
GO:0015914phospholipid transport
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015914 phospholipid transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005524 ATP binding
molecular_function GO:0000287 magnesium ion binding
molecular_function GO:0000166 nucleotide binding
molecular_function GO:0004012 phospholipid-translocating ATPase activity
Blast
BLAST of TCONS_00001097 vs. Swiss-Prot (Human)
Match: AT10A (Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2)

HSP 1 Score: 558.91 bits (1439), Expect = 3.528e-171
Identity = 333/820 (40.61%), Postives = 455/820 (55.49%), Query Frame = 3
Query: 1560 EFFTVLTICNTVVVSS--QPEV-------ISDTLETSADFTFAEDERNGTLNGTTTHKKLSLPTNSLNGSANIKHLPRS--MTMSGPEVTIDPASPQTENGLVRLNDSGVDFLS----TERRVRVFSTKXXXXXXXXXXXXXXWLNYGLVPTYEYESPDEGALVKASSLYNYKLANRTPEQIFFTTPDGEIKVYDILQVLTFDSARKRMSIIVRDD-EGQIKMYSKGADTTIMSRL---------ADDQEDLVKNTDEQLEGFAKDGLRTLCIAKRDLSEEEYEGWLEQHKQAEVALTDRDEKLAQSAETIETNFTLLGATGIDDRLQEGVPETIASLRHAGIKLWILTGDKQETAVNIGFSCKLLDPAMEIITLNSSTKEQCKELLQQ--------------------IKMRLDSQWPSYTVLPTHRYSTDQNSRPPLALIIDGITLSFTLEKPLDSTFIEIAKRCESVICCRATPLQKASVVKLVRDNLKVMTLAIGDGANDVSMLQTAEIGVGIAGQEGVQAVMASDFVLGRFYFLKRLLLLHGFWCYERISRMILYFFYKNAMFVALLFWYQIYNGFSGSNTIDDVSLILYNLAFTSLPPIFNGVFDQCLPEKAVFSRPILYQLGQYGKAYTRPWFWVSIIDAFYQSLILFFIPYFTYLSLPNAGMLVLGILFHQLAVVTANLHCAIETPNWTIIHFVIIFGSVVISFLYFFIYSA-----FTEVSLYWGIFHLMGHAEFWLLLIFCPFLAVLPRLVLRVFQTSFYPSVLQRVRSHLTASGELADNKMKSF--GDEPCQNNDGDNGTNQTSSAT*K 3863
            +FF  LTICNTVVV+S  QP         +   ++T  DF       +   +G ++   L+   +S    ++    P S  M +   E    P S    NG     D+    L+    +ER +R                            YE ESPDE ALV A+  YN  L  R  +Q+    P      +++L  L FDS RKRMS+++R     +I +Y+KGAD+ +M  L            Q+ +   T   L  +A +GLRTLCIAKR LS+EEY  WL+ H +AE +L + +E L QSA  +ETN  LLGATGI+DRLQ+GVPETI+ LR AG+++W+LTGDKQETAVNI ++CKLLD   E+ITLN++++E C  LL Q                    + MR  S  P  T       ST    RP  +L+IDG +L++ LEK L+  F+ +AK+C SV+CCR+TPLQK+ VVKLVR  LK MTLAIGDGANDVSM+Q A++GVGI+GQEG+QAVMASDF + +F +L+RLL+LHG WCY R++ M+LYFFYKN MFV LLFW+Q + GFS S  ID   LI +NL F+SLPP+  GV D+ +P   + + P LY+ GQ  + Y    FW ++ DA +QSL+ F IPY  Y    N  +   G     +A++T  LH  IET  WT ++++    SV++ F    IY+A     +   + YW +  L+G   F+L  +  P  A+LPRL  R  Q   +P+ LQ  R     S        ++F  G  P      D+GT  +S  T K
Sbjct:  570 DFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDF-LRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERELR----------------------------YEAESPDEAALVYAARAYNCVLVERLHDQVSVELPHLGRLTFELLHTLGFDSVRKRMSVVIRHPLTDEINVYTKGADSVVMDLLQPCSSVDARGRHQKKIRSKTQNYLNVYAAEGLRTLCIAKRVLSKEEYACWLQSHLEAESSLENSEELLFQSAIRLETNLHLLGATGIEDRLQDGVPETISKLRQAGLQIWVLTGDKQETAVNIAYACKLLDHDEEVITLNATSQEACAALLDQCLCYVQSRGLQRAPEKTKGKVSMRFSSLCPPST-------STASGRRP--SLVIDGRSLAYALEKNLEDKFLFLAKQCRSVLCCRSTPLQKSMVVKLVRSKLKAMTLAIGDGANDVSMIQVADVGVGISGQEGMQAVMASDFAVPKFRYLERLLILHGHWCYSRLANMVLYFFYKNTMFVGLLFWFQFFCGFSASTMIDQWYLIFFNLLFSSLPPLVTGVLDRDVPANVLLTNPQLYKSGQNMEEYRPRTFWFNMADAAFQSLVCFSIPYLAYYD-SNVDLFTWGTPIVTIALLTFLLHLGIETKTWTWLNWITCGFSVLLFFTVALIYNASCATCYPPSNPYWTMQALLGDPVFYLTCLMTPVAALLPRLFFRSLQGRVFPTQLQLARQLTRKSPRRCSAPKETFAQGRLP-----KDSGTEHSSGRTVK 1345          

HSP 2 Score: 435.647 bits (1119), Expect = 3.232e-127
Identity = 214/402 (53.23%), Postives = 284/402 (70.65%), Query Frame = 3
Query:  273 KTSTQKHKNNKIKTTKYTLLSFLPKNLFEQFHRFANVYFLFIVILNWIPAVNAFGKEIAMLPLIFVLAVTAIKDLIEDRQRYSSDKIVNNRIAAVYDSDTEKFPDKKWSNIEVGDIVKLYNNDILPADMLLLNSSDENGLCHVSTANLDGETNLKQKQIPKGFLEDGHIFKVKEDVTFQ--VKCETPNNNLHNFYGYIVQSNGGEIAIDRNNLLLRGCVIKNTESLYGLVIYAGHDTKAMLNNSGTRYKRSRLEKDINKDVLGCVAILFVLCLTGAIGTGYWTSENGLYEDMFMGYVAD----SPAFEGFLRFLTFVIILQVIIPISLYVSVEIVKLGQVYFINHDIGLYYPETAQYPVCRATNINEDLGQIQYIFSDKTGTLTENKMVFKKYSIAGHSFVH 1460
            +   Q   +N++KTTKYTLLSFLPKNLFEQFHR ANVYF+FI +LN++PAVNAF   +A+ P++F+LA+TA +DL ED  R+ SD  +N+    V+  + +K+ ++ W  I VGD V+L  N+I PAD+LLL+SSD +GLCH+ TANLDGETNLK++Q+ +GF E    F     +TF   ++CE PNN+L  F G I+  NG +  + + NLLLRGC ++NT+++ G+VIYAGH+TKA+LNNSG RYKRS+LE+ +N DVL CV +L  + L  A+G G W       + +F    +D    SP       FLT +I+LQV+IPISLYVS+EIVK  QVYFIN D+ LY  ET     CRA NI EDLGQIQYIFSDKTGTLTENKMVF++ +++G  + H
Sbjct:   53 RGCAQHLADNRLKTTKYTLLSFLPKNLFEQFHRPANVYFVFIALLNFVPAVNAFQPGLALAPVLFILAITAFRDLWEDYSRHRSDHKINHLGCLVFSREEKKYVNRFWKEIHVGDFVRLRCNEIFPADILLLSSSDPDGLCHIETANLDGETNLKRRQVVRGFSELVSEFN---PLTFTSVIECEKPNNDLSRFRGCIIHDNGKKAGLYKENLLLRGCTLRNTDAVVGIVIYAGHETKALLNNSGPRYKRSKLERQMNCDVLWCVLLLVCMSLFSAVGHGLWIWRYQEKKSLFYVPKSDGSSLSPVTAAVYSFLTMIIVLQVLIPISLYVSIEIVKACQVYFINQDMQLYDEETDSQLQCRALNITEDLGQIQYIFSDKTGTLTENKMVFRRCTVSGVEYSH 451          
The following BLAST results are available for this feature:
BLAST of TCONS_00001097 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
AT10A3.528e-17140.61Probable phospholipid-transporting ATPase VA OS=Ho... [more]
back to top