Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001097-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001097-protein
Unique NameTCONS_00001097-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1233

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001097-protein ID=TCONS_00001097-protein|Name=TCONS_00001097-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1233bp
MVRKKFNLPGQSSQSADNGEVDNTWTVIPSAILKSEDSKTSTQKHKNNKI
KTTKYTLLSFLPKNLFEQFHRFANVYFLFIVILNWIPAVNAFGKEIAMLP
LIFVLAVTAIKDLIEDRQRYSSDKIVNNRIAAVYDSDTEKFPDKKWSNIE
VGDIVKLYNNDILPADMLLLNSSDENGLCHVSTANLDGETNLKQKQIPKG
FLEDGHIFKVKEDVTFQVKCETPNNNLHNFYGYIVQSNGGEIAIDRNNLL
LRGCVIKNTESLYGLVIYAGHDTKAMLNNSGTRYKRSRLEKDINKDVLGC
VAILFVLCLTGAIGTGYWTSENGLYEDMFMGYVADSPAFEGFLRFLTFVI
ILQVIIPISLYVSVEIVKLGQVYFINHDIGLYYPETAQYPVCRATNINED
LGQIQYIFSDKTGTLTENKMVFKKYSIAGHSFVHPEGRDDEDTMQLCERL
YKDTDKANGDDLMRTWDEFFTVLTICNTVVVSSQPEVISDTLETSADFTF
AEDERNGTLNGTTTHKKLSLPTNSLNGSANIKHLPRSMTMSGPEVTIDPA
SPQTENGLVRLNDSGVDFLSTERRVRVFSTKISDRLSRSIDSINSWLNYG
LVPTYEYESPDEGALVKASSLYNYKLANRTPEQIFFTTPDGEIKVYDILQ
VLTFDSARKRMSIIVRDDEGQIKMYSKGADTTIMSRLADDQEDLVKNTDE
QLEGFAKDGLRTLCIAKRDLSEEEYEGWLEQHKQAEVALTDRDEKLAQSA
ETIETNFTLLGATGIDDRLQEGVPETIASLRHAGIKLWILTGDKQETAVN
IGFSCKLLDPAMEIITLNSSTKEQCKELLQQIKMRLDSQWPSYTVLPTHR
YSTDQNSRPPLALIIDGITLSFTLEKPLDSTFIEIAKRCESVICCRATPL
QKASVVKLVRDNLKVMTLAIGDGANDVSMLQTAEIGVGIAGQEGVQAVMA
SDFVLGRFYFLKRLLLLHGFWCYERISRMILYFFYKNAMFVALLFWYQIY
NGFSGSNTIDDVSLILYNLAFTSLPPIFNGVFDQCLPEKAVFSRPILYQL
GQYGKAYTRPWFWVSIIDAFYQSLILFFIPYFTYLSLPNAGMLVLGILFH
QLAVVTANLHCAIETPNWTIIHFVIIFGSVVISFLYFFIYSAFTEVSLYW
GIFHLMGHAEFWLLLIFCPFLAVLPRLVLRVFQTSFYPSVLQRVRSHLTA
SGELADNKMKSFGDEPCQNNDGDNGTNQTSSAT
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000615XLOC_000615Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001097TCONS_00001097Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR006539P-type_ATPase_IV
IPR023299ATPase_P-typ_cyto_domN
IPR032630P_typ_ATPase_c
IPR032631P-type_ATPase_N
IPR001757P_typ_ATPase
IPR018303ATPase_P-typ_P_site
IPR008250ATPase_P-typ_transduc_dom_A
IPR023214HAD-like_dom
IPR023298ATPase_P-typ_TM_dom
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0000287magnesium ion binding
GO:0004012phospholipid-translocating ATPase activity
GO:0000166nucleotide binding
Vocabulary: Biological Process
TermDefinition
GO:0015914phospholipid transport
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015914 phospholipid transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005524 ATP binding
molecular_function GO:0000287 magnesium ion binding
molecular_function GO:0000166 nucleotide binding
molecular_function GO:0004012 phospholipid-translocating ATPase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 920..939
score: 45.21
coord: 408..422
score: 65.13
NoneNo IPR availableGENE3D2.70.150.10coord: 85..280
e-value: 1.9E-40
score: 137.4
NoneNo IPR availableGENE3D1.20.1110.10coord: 756..1197
e-value: 9.2E-49
score: 165.8
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 608..686
e-value: 2.6E-8
score: 33.7
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 144..366
e-value: 6.4E-7
score: 29.0
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 391..973
e-value: 0.0
score: 308.4
NoneNo IPR availableSFLDSFLDG00002C1.7:_P-type_atpase_likecoord: 391..973
e-value: 0.0
score: 308.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1210..1233
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
IPR006539P-type ATPase, subfamily IVTIGRFAMTIGR01652TIGR01652coord: 46..486
e-value: 1.0E-134
score: 448.5
coord: 604..1195
e-value: 1.8E-207
score: 689.5
IPR023299P-type ATPase, cytoplasmic domain NGENE3D3.40.1110.10coord: 385..755
e-value: 3.0E-62
score: 209.4
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILY81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 608..720
coord: 753..765
IPR032630P-type ATPase, C-terminalPFAMPF16212PhoLip_ATPase_Ccoord: 948..1189
e-value: 6.3E-69
score: 232.4
IPR032631P-type ATPase, N-terminalPFAMPF16209PhoLip_ATPase_Ncoord: 39..95
e-value: 1.6E-24
score: 85.4
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 881..1003
e-value: 7.3E-31
score: 105.1
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 410..416
IPR008250P-type ATPase, A domainSUPERFAMILY81653Calcium ATPase, transduction domain Acoord: 140..201
coord: 238..275
IPR023214HAD-like domainSUPERFAMILY56784HAD-likecoord: 767..966
coord: 403..419
IPR023298P-type ATPase, transmembrane domainSUPERFAMILY81665Calcium ATPase, transmembrane domain Mcoord: 969..1188
coord: 280..402
coord: 33..132

Blast
BLAST of TCONS_00001097-protein vs. Swiss-Prot (Human)
Match: AT10A (Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2)

HSP 1 Score: 561.607 bits (1446), Expect = 1.218e-176
Identity = 332/807 (41.14%), Postives = 455/807 (56.38%), Query Frame = 0
Query:  468 EFFTVLTICNTVVVSSQPEVISDTLETSADFTFAEDERNGTLNGTTTHKKLSLPTNSLNGSANIKHLPRSMTMSGPEVTIDPASPQTENGLVRLNDSGVDFLSTERRVRVFSTKISDRLSRSIDSINSWLNYGLVP----TYEYESPDEGALVKASSLYNYKLANRTPEQIFFTTPDGEIKVYDILQVLTFDSARKRMSIIVRDD-EGQIKMYSKGADTTIMSRL---------ADDQEDLVKNTDEQLEGFAKDGLRTLCIAKRDLSEEEYEGWLEQHKQAEVALTDRDEKLAQSAETIETNFTLLGATGIDDRLQEGVPETIASLRHAGIKLWILTGDKQETAVNIGFSCKLLDPAMEIITLNSSTKEQCKELLQQ--------------------IKMRLDSQWPSYTVLPTHRYSTDQNSRPPLALIIDGITLSFTLEKPLDSTFIEIAKRCESVICCRATPLQKASVVKLVRDNLKVMTLAIGDGANDVSMLQTAEIGVGIAGQEGVQAVMASDFVLGRFYFLKRLLLLHGFWCYERISRMILYFFYKNAMFVALLFWYQIYNGFSGSNTIDDVSLILYNLAFTSLPPIFNGVFDQCLPEKAVFSRPILYQLGQYGKAYTRPWFWVSIIDAFYQSLILFFIPYFTYLSLPNAGMLVLGILFHQLAVVTANLHCAIETPNWTIIHFVIIFGSVVISFLYFFIYSA-----FTEVSLYWGIFHLMGHAEFWLLLIFCPFLAVLPRLVLRVFQTSFYPSVLQRVRSHLTASGELADNKMKSF--GDEPCQNNDGDNGTNQTSSAT 1233
            +FF  LTICNTVVV+S      D   T     F   E    +       +   P+   +G ++I  L  + +      +  P++P ++  L+RL          ER  +  S   S+  S   D+  S L           YE ESPDE ALV A+  YN  L  R  +Q+    P      +++L  L FDS RKRMS+++R     +I +Y+KGAD+ +M  L            Q+ +   T   L  +A +GLRTLCIAKR LS+EEY  WL+ H +AE +L + +E L QSA  +ETN  LLGATGI+DRLQ+GVPETI+ LR AG+++W+LTGDKQETAVNI ++CKLLD   E+ITLN++++E C  LL Q                    + MR  S  P  T       ST    RP  +L+IDG +L++ LEK L+  F+ +AK+C SV+CCR+TPLQK+ VVKLVR  LK MTLAIGDGANDVSM+Q A++GVGI+GQEG+QAVMASDF + +F +L+RLL+LHG WCY R++ M+LYFFYKN MFV LLFW+Q + GFS S  ID   LI +NL F+SLPP+  GV D+ +P   + + P LY+ GQ  + Y    FW ++ DA +QSL+ F IPY  Y    N  +   G     +A++T  LH  IET  WT ++++    SV++ F    IY+A     +   + YW +  L+G   F+L  +  P  A+LPRL  R  Q   +P+ LQ  R     S        ++F  G  P      D+GT  +S  T
Sbjct:  570 DFFIALTICNTVVVTS-----PDQPRTKVRVRF---ELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSF-PSTPSSDGMLLRLE---------ERLGQPTSAIASNGYSSQADNWASELAQEQESERELRYEAESPDEAALVYAARAYNCVLVERLHDQVSVELPHLGRLTFELLHTLGFDSVRKRMSVVIRHPLTDEINVYTKGADSVVMDLLQPCSSVDARGRHQKKIRSKTQNYLNVYAAEGLRTLCIAKRVLSKEEYACWLQSHLEAESSLENSEELLFQSAIRLETNLHLLGATGIEDRLQDGVPETISKLRQAGLQIWVLTGDKQETAVNIAYACKLLDHDEEVITLNATSQEACAALLDQCLCYVQSRGLQRAPEKTKGKVSMRFSSLCPPST-------STASGRRP--SLVIDGRSLAYALEKNLEDKFLFLAKQCRSVLCCRSTPLQKSMVVKLVRSKLKAMTLAIGDGANDVSMIQVADVGVGISGQEGMQAVMASDFAVPKFRYLERLLILHGHWCYSRLANMVLYFFYKNTMFVGLLFWFQFFCGFSASTMIDQWYLIFFNLLFSSLPPLVTGVLDRDVPANVLLTNPQLYKSGQNMEEYRPRTFWFNMADAAFQSLVCFSIPYLAYYD-SNVDLFTWGTPIVTIALLTFLLHLGIETKTWTWLNWITCGFSVLLFFTVALIYNASCATCYPPSNPYWTMQALLGDPVFYLTCLMTPVAALLPRLFFRSLQGRVFPTQLQLARQLTRKSPRRCSAPKETFAQGRLP-----KDSGTEHSSGRT 1343          

HSP 2 Score: 436.032 bits (1120), Expect = 1.515e-130
Identity = 214/402 (53.23%), Postives = 284/402 (70.65%), Query Frame = 0
Query:   39 KTSTQKHKNNKIKTTKYTLLSFLPKNLFEQFHRFANVYFLFIVILNWIPAVNAFGKEIAMLPLIFVLAVTAIKDLIEDRQRYSSDKIVNNRIAAVYDSDTEKFPDKKWSNIEVGDIVKLYNNDILPADMLLLNSSDENGLCHVSTANLDGETNLKQKQIPKGFLEDGHIFKVKEDVTFQ--VKCETPNNNLHNFYGYIVQSNGGEIAIDRNNLLLRGCVIKNTESLYGLVIYAGHDTKAMLNNSGTRYKRSRLEKDINKDVLGCVAILFVLCLTGAIGTGYWTSENGLYEDMFMGYVAD----SPAFEGFLRFLTFVIILQVIIPISLYVSVEIVKLGQVYFINHDIGLYYPETAQYPVCRATNINEDLGQIQYIFSDKTGTLTENKMVFKKYSIAGHSFVH 434
            +   Q   +N++KTTKYTLLSFLPKNLFEQFHR ANVYF+FI +LN++PAVNAF   +A+ P++F+LA+TA +DL ED  R+ SD  +N+    V+  + +K+ ++ W  I VGD V+L  N+I PAD+LLL+SSD +GLCH+ TANLDGETNLK++Q+ +GF E    F     +TF   ++CE PNN+L  F G I+  NG +  + + NLLLRGC ++NT+++ G+VIYAGH+TKA+LNNSG RYKRS+LE+ +N DVL CV +L  + L  A+G G W       + +F    +D    SP       FLT +I+LQV+IPISLYVS+EIVK  QVYFIN D+ LY  ET     CRA NI EDLGQIQYIFSDKTGTLTENKMVF++ +++G  + H
Sbjct:   53 RGCAQHLADNRLKTTKYTLLSFLPKNLFEQFHRPANVYFVFIALLNFVPAVNAFQPGLALAPVLFILAITAFRDLWEDYSRHRSDHKINHLGCLVFSREEKKYVNRFWKEIHVGDFVRLRCNEIFPADILLLSSSDPDGLCHIETANLDGETNLKRRQVVRGFSELVSEFN---PLTFTSVIECEKPNNDLSRFRGCIIHDNGKKAGLYKENLLLRGCTLRNTDAVVGIVIYAGHETKALLNNSGPRYKRSKLERQMNCDVLWCVLLLVCMSLFSAVGHGLWIWRYQEKKSLFYVPKSDGSSLSPVTAAVYSFLTMIIVLQVLIPISLYVSIEIVKACQVYFINQDMQLYDEETDSQLQCRALNITEDLGQIQYIFSDKTGTLTENKMVFRRCTVSGVEYSH 451          
The following BLAST results are available for this feature:
BLAST of TCONS_00001097-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
AT10A1.218e-17641.14Probable phospholipid-transporting ATPase VA OS=Ho... [more]
back to top