Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001095 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001095
Unique NameTCONS_00001095
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1204

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001095 ID=TCONS_00001095|Name=TCONS_00001095|organism=Clytia hemisphaerica|type=transcript|length=1204bp
GAGATGATACAATGATTGAGAAGGATCAAGGATGCGATATTGGACCTTTA
AATGGTGTTCAAAGCAAACAGTTGACCCACCATTGGTTTCCATTTTGTCC
TTTGtGCATTCGCGGACAAGACGAGATACGGTAGCAGACGAATACCGGAA
ATGGCCGGGAGGGATTGTTCCGTATACTTTCGGTTTTACTGCAGGTTACA
AAGAGCAGCAAGTTTTCAAGCAAGCCATCAAAGAAATCGAGAAAGTTTCT
TGTGTTCGTTTCGTAAAGAGGACCACTGAACGAGATTATGTTCGAATCAT
ATCAAGCAGAGAAGGATGCTTCTCAACGATTGGTCGTGATGGAGGGCAAC
AAGATTTATCCTTAGGAGATGGTTGCCACACCAAAGGCATTGCACTACAC
GAGACTTTCCACACTTTAGGCTTCTATCATGAGCACGTGAGGAGGGACCG
CGATCACCATGTTTTTGTTGATGTCAGCAATGCGATGGAAGGAGCGAAAa
gacaatttgaaaaatacaagccGGGAGAAGCTCATACTCTCGGACACCCT
TATGATCCGGACAGCATCATGCATTACTCCAACAGAGCCTTTAGTAAGAA
TGGACATAAAACCATCACCTACCGGAAAGACCCTTCAAAGAAGTTGGGAC
AGCGAGTAAAATTGAGCCCTATCGATATCAAACAACTGAATGAGCTTTAC
AGATGCAAAAACAACACCTCGAATGTGAAGAAGCCGAAAAAGACACGAAT
CGAGATAGATACTTGTCGCGATGACCCATGGGTTGGCTTCCAGTGtttgt
tttacagattttctggTGGCTGTTATTTCTACCGAGAGCGCATGCGTCAA
GCTTGTCCGAAAACGTGCGGATTTTGTCGTTCGACGTGTTTTGATACGTC
GCAATATTGCAATTACTTCGTGTATCATGGTTACTGTACAAGGAGCGAAA
ATGTTCGAAAACGATGTCGTAAAAGTTGTAAGATCTGTCGCATTGCGTAA
TCGTCATAACAATCTCGATATAATTTTTATTGCGACAAACGAACTTGATT
TCCAATCATTGAATATGTCGATACCACTATTGTAAATTTTTCTGTCGATG
AAATTTTGATTGACGATTCCTCTTAAAAACGCGTTTACATTATTGTAAAT
ATGAAGAATTGTTTGAGGTAAATAGCTAATGTGTTGTGTGTATGTAAAAT
TGAC
Run BLAST on NCBI

transcript from alignment at sc0000007:111454..123440-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001095 ID=TCONS_00001095|Name=TCONS_00001095|organism=Clytia hemisphaerica|type=transcript|length=11987bp|location=Sequence derived from alignment at sc0000007:111454..123440- (Clytia hemisphaerica)
GAGATGATACAATGATTGAGAAGGATCAAGGATGCGATATTGGACCTTTA AATGGTGTTCAAAGCAAACAGTTGACCCACCATTGGTTTCCATTTTGTCC TTTGGTAAGGAATTAACTCCATTTCGCTCGCTACCTGTTCGGAAAGCTTG GAACTTATACTCGGATGTTTAGAGAGTTCGGTTTCTAAGCTACGAGCTGC ATTGTCTATCTGAGAAATGCCTGATAACTGTTTAGCTTTTTGATAATACG TAAAAGATCGTGAAATGAAAGACGTGGGGAGGGAGTCAAAGATTGCTTGA CACTTTATCTCCCATCGGATATTAAATACTTGTTACATTGGCTACTACCT TTGTCAATCTCATTTTCTCACGCCCACCCAGTCTAATGATGAAGTTTTTG ATTTTCGCGTGGGCGTTCCTTTTCCAGCGCGTTCATTATTTAGTTTAGTG CTAATGGGAGTAATTACTTGATTTGTCAACCGATCGACTGAACGACGGAT GAACAATTTGAGATTGGCTTTAGAGGAGTCTCATTCGCGACAAAACAGGA AATCAAGTCTTCATTTTCAAACGACATTCCTTACAAATTGGCGCCTGACG AAGGACGAAGCAAAAGTAGACAACATCTCGTGTTTTGATACAATAACCTT ATGCATATGCTTCTTTTGATGAAAATTAATTAAAATCATTAAGGTTGATG GCTTTTTTGACATTTATTTAATTGCGTGTGTTTGGCAACATAATCACAAG TGAAGTTATTTTTGAATAAGGTTAAGCAGAAATATAAACAAACAAAAGCC GCCATCTTTAAATAAACATTTTCCGCCGCTCCTCAAAATACTGCCAATCA CCTTTCACCAGAACTATAACTATCTATACAAATTAGACAGAACCAGTACT GGAATCATACCAGCTTTAACCTTGGTAAACAATTGCTGAATATTACAAAA AATTTCCATAAATATATTTGTGGTCATTTCATTTCTGAAGTGCTCCGAAG TGGGTTCTCGTCCTTGGGGTTGTCACACGCATACTTTTTCTCACGCCAAT AATTATGATGGTATGATGGTGGTCGAACTTTTCCATATTGCACCATGTTT GTAGGCGTACTTTGGTGTAAAGATAGTCATTATGTAATGAGAAGGTTCAG TGTAGGTCATTCATTTGTACAATTTGGTTTTTTGTCTACAGAAGAAGCGC TTTATTGATTGTTTTTATACCCTTGGAAACGAAGAATTCGAAAAATGCAA GAAAAACATGGAAAACATGGGAGTCTATCGCTCGGCCGATCCCTTTGTTA ATCGTATAAATTTTTTAGCCGGACTTCGTATGCTTGGTTAGTGTCATTTG GAACAAGATTGAAGGTTCAAGTGAAAATAATTCTTACTGTAAAGTTATGC GTTTGATCATGAATCCGTAAGGAGTGTTATTTTGAGGTTTTCTGAGTGGT AAAATAAAGAAATGACTTCCTCCATAAAAAAATTATTTCAGCAATTAGGT GAAATCTTTTCGGAATTTATTATCAGTTACCATTTTCTAATCATACTCCT AAGTACAGTAGGATGTGTTTTCTTCAAAACAAAGAAATATTACTGGCCAA CATTTTGCACATCATTTGAATTCCACAATTGGTGAGCAGTGCATCGGAAG GAAAGATTAACACAAAAAAATTCCACTAAAAGTACTTTTAACGGCTTTGA TACTTTCCGGATAAATTGCTATGGAAACCTTCCGAAAAATACATTGGTCT AACATTTTTCAGTAGAAAAATATTCTCAAAAGGAACTTGATCTTCGGAAT CACAAGCCCGCCGTTTTCTTCGCATTTTATACCTTCAATACATATTTCTA TAATTTTGTGAGAATTTTTGAACTATTGCATACTGTGTATATCCATGATT CTTTGAAGACATCAGCTTAAATAAAAAATCTTCAAAATCCAAATTATATT ATGGTCCATTAATTGCGAATTTTTTTCTTCATATAGTAAGAAAACGTTCT ATTTTGAATGTTGTTCTATTTTTGTAGACTTTAAATATGGAATAATGGGC TCGGCTGATGAGAGTAATAATTCGTGTCGCCTCTTTCTTGTATTGGACCA AATTGGTTGGTTTAATGTATCTTTATAAAGATTGACTATTGACATAATGT AATCTATTTGCAACGAGATAATTTTTCTCAATTGCACCGAAATTGTTCCT TTACGAATTTGAATCACGGCTGCTAAACATTTAAACCGCAAGAAAAGCTC ACTATGGACACTAGCAGAGTACCGACTAGCCTGGCTGCTTTTATCCAAAG TAAAACCTTTCCCATAATAAATGAAGAGAGTTGATAGTCAAAAACCCCCC CCCCCCCTATATGCAAATGTGAAGAAATTATGTTGAGGATGTGAGTTTTC ACTCAAGCTTTGGAAAAAGAAATGTCTTGCGATTGCTATGTTACAACCGG ATACTATTTTCTAGAGCCTTCGTGTAAGAAACAGTGGGCCGATCACTGTC TGTATTCTTATCCTCGACTGGTATGGCGAATTTTGATGAGAAAATCAGAA AAAATCTTTTCACTGATTTTCGCAAGACTCTCACACAAGGACTTAGTAGC CTTTAGGGAGTCCTTGTACAGCAAAGTAAAGAAAAAAGAACTTCCCTTTC ATATTCTCTCCACAGACATTCCGCTGTTTCTTGTTTGTGAGAGACTCACG CGTGAAGTAGACCACGTGAGTTTAATGAGAGGAAAACATAGCGAGTGAAA GGATGTTTCATTGATTGCGATCATACATCACAAAACAAACAAATCTATGG ATTTATAGTTCACTCTCGACCCAACAGTCTTGCACTATCTTGCACTGGAA AAAACTCTGTCATCGCTTGAATGGTTATCATCTGATCGTCATCCATGGAC TATGTTTGTTCTTAATTCTTTTGGAGAATAGACGAGGAAAATTCAATGAG CGCTATATCATACTTTTTGTCCCAGTTTCTTTCTTTGAAAAATCTCATTT TATAGACTTGGTAGGTTTTTTGTCATATGACGTACCTCTGATGCAAGATT CTCTGTGACGTCAAAGAAGGAAAGCCACGTGATGTGGAAAGAACAACTCT GGTTACTTCCTACATGCCCGTCTGAAACGTTCAAACCATGCCATATCATT CTTGAATGAAGAATTCATAAAACAATATTGAGTGTAAACCCTGCGTTTAT TTTGGATCTCCTTTTGCCCTCAATTTTACGCTTTACTTCATGTATTTTAA CTCCCAAAGAGCTTGTCAGACCCAAAAAAAAATGTGAGGATTTCGAAGCC GGTATAATGCTTTCTCTTCATAGGGCATCCTAAGTATTTTCAATTCATTC CTTGATTTCTTGTTGGTAAAATATCACAATGCGTGTCATACTCATGGCGG AAGGCACGTGAAATTGGGCGCCAATATCAATCAGGAGTGCTTTCTCAAGT ACAGAATGTAATGTGGAACTAGACAAACACAATTTAAGCGTATGTCTTGC GCTGTCTGTTATTTTGACTGGATTTATTCCACTTGTGTAAGAACACGAGA TGATGACTTAACCATAATTTCCACTAACAAACTATTCAACTAAATAAATT GGCAAGAACATTTCATATTTGAGTGATAATGTACCCTAGCTTGATATAAT TTTCGTCCTCAGAAGTTATAGCGCAAAATGCGTGGTCATTTTTAACTACA TAGAAAAATGGCTGGGTGGGCATTTTAGGACTCTATTGACTCCGAGAACT TCCTCATGTGCCTGTTGTTCGAAAGAGGAAGAGATCAAATATATGGTTTT CTTTCCCCTGCTGTGTTTGGAGGGGGCGTATGTTCCTTCTCTTTGTCTAT CATGGTTATTGATTTATCAAGATATTTATTCATTACTATCGATTGCCGAG GTTACCATTTATAAGTTGAAATATCTGAAGGTAGAGCATGTGTTACTTCT CAACTAACTTCCTTTTTTTTCAATGAAAGTGCCTTGGGTAACGTTTTCCC TAATGCCTCTTTTTTTAAATTGAAATTTTTTTCACAGAAGCTTTAACGAA CTAAACTAGAGTCGGTCTGGATAAGAGAAGGCTTCTGAAAGGTTTAAATA GTCTCCTAAGTTTCTAAAATCCTAGAGCTAGGAAGATCCCCTATGGGCAG ACCCTACCCTTTTTAGCAAGTTTACCGACAATATTCTTTGACCAAAACTT TAACCACACAACATTTCATCATGAAGTAGACCTCGTCAGAAGTTTTCAAA GGTCATGCATTCAGACAAACACTTGATCCACTTATCAGGTGTCTTTGATG TTTAAGTCAATTAATCGCCTTATCTTTCGATAAACTAATCGTTATTAATT TCTTCTGTTTGATAACATCTTTTCCCACACGCGACCTTTTCACTTTCTTC CCTCTTGTTGGATGCCAAATAATTGTGCTACAACCTACTACCTCTTGTAT GTCTAGCTCGTAAAACAATTTTTCGCCTGCTGGTTCTGCTAGAATCTACT TAAAGAAAGCAATGAACGGTTCAAATGATTATTAGAATCGGATCTGACAC TGAGTGACATATTTTACATGCCACTCAATTTTCAATTTTCATTTTTTAAA CTTCCGTTACTAATCATCATCTTGCAACAAACTCTTGCCAAAAAAGGTCT TGATTGATTTCAAAAAACTTTTGCAAATTCTTTAAAATGTTCTCGTTTTT TCCAGCAGAAAATGTTTCTGTAGTGCAAACACTTTGTGAATTATCATGTT AAAAATCATCAACCAAGATTACAGAGATGTTATCTTACCAAACCAATTTA ATATTGATCATTTTCGCCAATTAATTAACGTTTTAATTTCCTGTTTTTAT CTGTTAAATTCATTTGCAAGTCACTTTTCACAATACCTTAAAATCTGCTT CCCTGATAACATCAACCTCGGAATGTCCTAAAGAGATTAATATTTTGGCT TAGATTTGTGCAACCAAGCCTCGATACACGTGTTTCAGGCGTAATTGTAT TAACACAGAGTCAAATGATTTTAATTTTTAATGGCTCAAATTTACGTCAA ATAGGAGTCAAACTTTCAGCTTTCAAAATCAGTTTCGGGCTCCCATTCAT AAAATTACGTTACATTTAGCTCCCAGCAAGAGACTTAATTCCATTGAAAT GTGGTTATAAATTCAAAATCAAAAAATTATCTACTTTTTAAAATCCTTAA TTTTTTCCACTCAGAATTCTACCTACCAAGGCAAACAGTTTAAAATCACT TTAAAAGGGAGTAATTCTTTGTATTTTGCAAGGGAATTTATTCGTTGTAT TTTCGAAGGAAAATCATTTTGAAAGTTTTTTTTTTGCAATGGAGATCATT CTTTGTATTTTGCAAGGGAAATCGTTCTTTGTATTTGTAAGGGAAATTAT TCGTTGTATTTTTAAAGGAAAATTATTCTTTGCATTTTGCAAAGAAAATC ATTTTTGTATTTTGCAAGGGGAATCATTATTTGTATTTTGCAAGGAAAAT CATTATTTTTCCTTTTGCAAGGAAATTTAGTCTTTTGTAAGGGAAATCAT TCTTTATTTTTTGCAAGGAAAAATATATTTTGTTCTTTCAAAGGAGAATA TTTCTTGTATTTTTGAGGGAAGCTCATTCCTATATCCACTGGCGTTGTAT TACACAGCTCATTTCATCAAGATTTCCAAATGAAATCCATGGTTGTCTCG CACTTAAATGTGTTATAGGCTAGTAGCGTAGCCAAGAGTGGCGCAAAATT TGTGTAGGAGAGCAGATTTCTATGCCATTGTAATTATCTATTCATGGTAT GAAAAGATAATTATAATGGCATAACAATCTGTTCTCCTAAACAAATTTTG CGCCCCTCTTGGCTACGCTACGATAGGCAACAAACGAGATGATATATTGG TTCCGGATTTGTTCAACATTTTCTTTTTTTTCAATCATTGTTCCACATTC AACAAGCTTTTTCCTCATGAAGTATAAGTGTATAATTTCCAGAAGACCAG AAGATATGTTTCCTGTTGAAGACACCAATGATAGATGGACACTTCAAAAA GTATCCACTTGTAGGTAATAACATCTTTTGGCTTAGAAATCGTTAAAGAT GACCTAAAACATCCTGAAAATCAGCCAGAGAAAAAGCTTTTGAAAACCAG TCATTGTGAAAGAAGTTATTGAATTTCCTTCATCAAAACGTACTGAAAGA GATACTAGAGAAGAAATACTGAAACGCACTACGACGGCACTGAAGTCGCT GCTCCTTTACTCCTTCAGTTGTGAATTTTGGTTTGGTACTTCTTTGGTAC CACGGTCGAGCACAGTTTTAACGGTAACGAAGTCATGTGCTGTCGAATGA ACAAGCCGGAAATGTCTTTGGTGCGTTACGTTCTTTTCTTTTCTTTCATC CATCGCTGGTGAGGAAATTGTGGCCACATGGCTCAAAAATCGAAAAGCTA AAGAAATACACTGAATCCAGTTGATATAATTAGTTTGTTTTGGCACACAA TCATTTTGAATGACACAAACACAGAACTAAAATTTGAACCTAATGTCTTT TCTTGTCTAGTGGTTGTGAAACTATAATTTTTGGGCAATACTCTAATGTT TCTTTAACTCAAGGTCCATCAATATTATAATAGACTTAACTTTATCTGTG TCTTCTTCTTCTTCGTGACAGTCGCGTCATTTCATCGTTAACTGACCCTG TCTTTTAGGGTTCCAGTTGGTCTGTCAATTTTATTCTTGTGGTTTTGAAG ATATAATTTTTTTGGGACTTTAATGTTCGTGGATTCCAAAGTATTTTCAT GCTGTTAGGTCTGTCATTAAATTGACTGGGATTATGTTGATATTCAAGTC GCATTACTGACATCGTAACGTATTTGTGTATTAATGATTCCCCTTTTCTT CATGTTTGTTAGAGATAATATGAAGATATTCCATTTCTGTTGCTCTCCTT TCAAAACATTTTAATGTCTTGAGGAAAACTTGCTTCATTAAGCACTTCCT TTGCTTGAGGCGCTTGACTTTAGTTGCTAACACGACGTGTTGTTTTTGGT TTGACGTTTCCAACGATAAAATATTTAGTGACGTCATACAGGTCAAATAC ATTGAGATTAGCAAAAGTTCTTTTTTTAATAAAACCATCTGGACTCTGTG TCCGATATCCACAACTATTTTATTAAAAAATCCATTAAAAGAATGGAACG GGCAGCCCAGTATAATTCTTTAGGCATTCGTTTTGTTTTCTTAAGGTTTC TTTTTGTTTTCCTCTGGATTAATGTCATTAGAGATGGTTTCCTCTTCTTT ACGTCTCGTCACCACAAACCCAACACTTTACAAGTCTGCTGTTTCAAATT CCAAATCTTTCTTATCCTGAAATCGTCGATAGTAAGAAAAAGTAGGGATT AAGTTCTGCGGTGTAACACTAACTATTCACCAAATTGTCATTGCTCTTGA TGACGCGCTCGCGCATGTCATGTAGAAGATCTTTTCAAGGTCACCTAAAT GAAGTGTGTTTTCTTTTCAAGTCATCATGTTTTCTGACAAAATTTTTCTT TCCCTTTTTTTTTGAAAGTTGTTAAAGGTTTTAAATAAGAAACGTCACTT TGTTGTTGCTCATCACTGGCAAATGTGTGTGTTGATATAAATACATTGGA AGAGTCGGTCACACTCTTATAAAATCTCCGTTACTCAACAAGACATTTTT CGCTGGTCATAAGACTTACTTAAAAAGACGTTTGATAAATTGAGAGAACG ATGTATTTGATTTTTGTACTGATGTTACAATGTTTTTGTTTGACTTCTGG TGGAAAGTTCGTTAAAGAACGAGGTTTGTAAAATTTATGCTATTGTTTTA TAGTGCTTGAAGCACTTGAATCTCATCGAGATTTTGATCATTTTACGTTC GAGAGTCGCAAAAAATGAAGAAAGACATCAAAACGAACGGGAGCATCGTC GTTCCTCTGAATTTTAAAGATCCACCTCTGACAATCCTAACCCGCTATAA TATGGACCAAAATTAAGTAAATGGTTCTTAGGTCAATGAACCCCAATAAA GAGTTGGGTAAACAAATAGGACCATTTTGTGATATGAAAATTTATGAAAC TATGAAAATCTATCACAAATCGCTTGTTGATGTAGTCTTAATTTGTTTAG ATGTTTGTCTCAAACCTTACAACTTTTGAGGGAAAATTATTAAATTTGTT GATCGACGGTACCATCTTAAGTTGTCAATAGAAATTTGAGAATACATGCC TTAGGAAATACGTCGGTTTTTTTTACCGGATGAACTTTGTTCTTTCACTT GCAAATTACAAGTCAAGGCTTAGGGCAGTCTGTTCTCAAAAGTATTTCCG ATATATTGAGCAGTGTGACGTTTTGAAGAGGAGCAACGGATTTCACGTAA TGCGACTGTCTTCTGATAGCGGATGAAAGATGCCCGTTACCACAGGCTTA TTGATGTTGTTGTTGACAGTGTCAAAACCACATGAACTTCCACTGGTCGC ACTATTTTTATGAATATTATGCAAGAAAATGTTTGAGGTTACAACCTATG TTTCTTTTATAAAGTGTTTTATTTATCTCATCCTTAAATTGTGGTTGAGA AGCGCTAAAAACGTCAAAATGTTGACTGCTTGATGTCTTGTTTCATTCTT TTTTTCAGTGCATTCGCGGACAAGACGAGATACGGTAGCAGACGAATACC GGAAATGGCCGGGAGGGATTGTTCCGTATACTTTCGGTTTTACTGCAGGT GAGTGAGCTTCGTGTTGTCTTCACACGAAATCCATGTTCGCAGAAATCGA TTTCATTTGATATTTGAGTACCACTGAGGATTGACTTTTCTAATTTTAGC ATGCCTGGGATATAGTACACTGTAATTGAGTTGCGAAAAATATATTTGTT ATTTGAAACAGGAGAATCGTGTTAGTAAAATATTTGAACCGTATTTGAGC TAATGCCGATAAAGATCATCCTATCCTTATTCTGTTGGTTTCAGGAATTA GAAACAAACGACTAAATTCCGAGTACCTTTTTCTTTGTGAATGATTTCAT TAAGTCCCTTTCTACAGGTTACAAAGAGCAGCAAGTTTTCAAGCAAGCCA TCAAAGAAATCGAGAAAGTTTCTTGTGTTCGTTTCGTAAAGAGGACCACT GAACGAGATTATGTTCGAATCATATCAAGCAGAGAAGGGTAAGAACAAGC TAGCACTAAATCGATGTGCACTTGCAGTCTAATTACCAAGGATTGGGCTA TTCCAGAAATAGTCTGTACCCTATGTCGAAGAGGTGTGACGTCCAGGGTG GTCTGGAAAATCTGGAAAATAAAAAAACCTGGGGAGTCTGGTTTTTGAAC GAAAAAATCCAGGGTGGTCAGTAAAATGAGGTTGGAAATCTAGGGTGGTC AGTGACACGAGGTCGAAAATCCAGGGTGGTCAATTTTTTTTAAATCCTCC TCAACATAGGGGGTACAAATTTCTCCTGGAATAGCTAGGTTACGGCTTAG CGTTATCGGTGCTTCATAATATTTAAGGACTTTCAGTTTTCTAAAACTCT GTCCAAATATAACATTCAGATCTATCGAGTGGTAGCGCCAATTTAGCTTC GATTTCAAGGCTAATGCACTATGTGCAACATAAGCCCTTTATTTATGAAT TTTGTGTTTTTTAACATGACATACCGGTTTTTGTTCTCGAAAACAATCTT TACCTATGATTTGGGTCCAGGTTGAATGATTCGTTTCTATTCAACATCTA TCTTCACTTTTCAGATGCTTCTCAACGATTGGTCGTGATGGAGGGCAACA AGATTTATCCTTAGGAGATGGTTGCCACACCAAAGGCATTGCACTACACG AGACTTTCCACACTTTAGGCTTCTATCATGAGCACGTGAGGAGGGACCGC GATCACCATGTTTTTGTTGATGTCAGCAATGCGATGGAAGGTGTGTCTCT TTATCTTTCTTTTTATTGTTGTTCAACTAAAAGAAGTTGCCTTTTGTTGT AGACTCGATTTTCAACTTTGATATCAATGGGCAACGAGTACGTTTTTCTT CTGATAACGAAAAGATTTGACAGGTGTGAAAACATTAAAAAACTTTATCG TTGCCCTCTTGTTGTAAACGTGATCGCTTGAAATGAAAAACATTAATCCT GTAAACTTTTTAACGAGGTGCGACTCATGTATATTACCTGTCAATCGACG TGCTATCTGCACTTGTTTTCTTTATTGTGTTGATATTTCATAAAATACCG CCCCAAACCGCTAGATCGATATTTTTTCCCCAAAAAATAGCTTNTTTTTC TTCTGATAACGAAAAGATTTAACAGGTGTGAAAACATTAAAAAACTTCAT CGTTGCCCTCTTGTTGTAAACGTGATCGCTTGAAATGAAAAACATTAATC CTGTAAACTTTTTAACGAGGTGCGACTCATGTATATTACCTGTCAATCGA CGTGATATCTGCACTTGTTTTCTTTATTGTGTTGATATTTCATAACATAC GGCCCCAAACCGCTAGATCGATATTTTTTCCCCAAAAAATAGCTTACATC TGTTATAGGAGCGAAAAGACAATTTGAAAAATACAAGCCGGGAGAAGCTC ATACTCTCGGACACCCTTATGATCCGGACAGCATCATGCATTACTCCAAC AGAGCCTTTAGTAAGAATGGACATAAAACCATCACCTACCGGAAAGACCC TTCAAAGAAGTTGGGACAGCGAGTAAAATTGAGCCCTATCGATATCAAAC AACTGAATGAGCTTTACAGGTTTGTAAATCTCCGAAAGATTGAATGAAGG ATTATTGTATTTGAATAATCTAACATCTTCCTTTTTACTACCGGAAACAC GTTTTCTGCTCTTATTTTGGTAAGAAAAATGGCGTAATCATATGCCCATC CAATAATTGAGTTGAATTGCCCATAGAATGTCTTCTCTATCATGTTCTCT TTTTGTGTACAACTTTTTGACAGTGACTTCATTCTACCTTTCTTTCCAGA TGCAAAAACAACACCTCGAATGTGAAGAAGCCGAAAAAGACACGAATCGA GATAGGTAAGAATACGAACAAAATTTTCAACTTGATTCTATCTATTTCTT TCAATGGTCAACGCCCCCTAATCTAGCTCAATCCAATTTTGAACTTAAGC CAAAAAGAAAAGTTGGACCATCTTGCAATAGGTAGAAATTGCTTCTTGCA TGTTTGAAACAGAGATTCCAACCATCAGACCATTCCGTACCCATATTCCG TAATAGATGTGGGCAACTCGCGCTTCACCTAAACCAAATTTTTTTAGTGC AATTATCAGCATGATGAAACATTTAGCTACAATCGTATAGCGCTAAAACC AGCAAAAATTACTAAATAAATAGGCCTATAAATGTGTTTGTGAACTGTTG AAAATTTCATTGAAAACCAAATAGTTTCGTGAAATTTGGGATGATCTACA TCCGAGGAGTCCTGGGTAGAATGAACATGTATTAAAAATGATTATTTTAT AACTTTATTCGAAAGTGTTCCATATTTTCTCGTTTCCATAGATACTTGTC GCGATGACCCATGGGTTGGCTTCCAGTGTTTGTTTTACAGATTTTCTGGT GGCTGTTATTTCTACCGAGAGCGCATGCGTCAAGCTTGTCCGAAAACGTG CGGATTTTGTCGTTCGACGTGTTTTGATACGTCGCAATATTGCAATTACT TCGTGTATCATGGTTACTGTACAAGGAGCGAAAATGTTCGAAAACGATGT CGTAAAAGTTGTAAGATCTGTCGCATTGCGTAATCGTCATAACAATCTCG ATATAATTTTTATTGCGACAAACGAACTTGATTTCCAATCATTGAATATG TCGATACCACTATTGTAAATTTTTCTGTCGATGAAATTTTGATTGACGAT TCCTCTTAAAAACGCGTTTACATTATTGTAAATATGAAGAATTGTTTGAG GTAAATAGCTAATGTGTTGTGTGTATGTAAAATTGAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000613XLOC_000613Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001095-exon-sc0000007-1575043694:123337..123440TCONS_00001095-exon-sc0000007-1575043694:123337..123440Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1575043694:114693..114782TCONS_00001095-exon-sc0000007-1575043694:114693..114782Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1575043694:114253..114373TCONS_00001095-exon-sc0000007-1575043694:114253..114373Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1575043694:113501..113676TCONS_00001095-exon-sc0000007-1575043694:113501..113676Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1575043694:112672..112882TCONS_00001095-exon-sc0000007-1575043694:112672..112882Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1575043694:112386..112441TCONS_00001095-exon-sc0000007-1575043694:112386..112441Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1575043694:111454..111899TCONS_00001095-exon-sc0000007-1575043694:111454..111899Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1510915933:123337..123440TCONS_00001095-exon-sc0000007-1510915933:123337..123440Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1510915933:114693..114782TCONS_00001095-exon-sc0000007-1510915933:114693..114782Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1510915933:114253..114373TCONS_00001095-exon-sc0000007-1510915933:114253..114373Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1510915933:113501..113676TCONS_00001095-exon-sc0000007-1510915933:113501..113676Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1510915933:112672..112882TCONS_00001095-exon-sc0000007-1510915933:112672..112882Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1510915933:112386..112441TCONS_00001095-exon-sc0000007-1510915933:112386..112441Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1510915933:111454..111899TCONS_00001095-exon-sc0000007-1510915933:111454..111899Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1491911889:123337..123440TCONS_00001095-exon-sc0000007-1491911889:123337..123440Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1491911889:114693..114782TCONS_00001095-exon-sc0000007-1491911889:114693..114782Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1491911889:114253..114373TCONS_00001095-exon-sc0000007-1491911889:114253..114373Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1491911889:113501..113676TCONS_00001095-exon-sc0000007-1491911889:113501..113676Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1491911889:112672..112882TCONS_00001095-exon-sc0000007-1491911889:112672..112882Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1491911889:112386..112441TCONS_00001095-exon-sc0000007-1491911889:112386..112441Clytia hemisphaericaexon
TCONS_00001095-exon-sc0000007-1491911889:111454..111899TCONS_00001095-exon-sc0000007-1491911889:111454..111899Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:111454..123440 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.19105 1.46218 0.336595 0 9.96017 8.28929 16.1474 17.6724 21.8597 11.8913 16.9924 26.0085 24.8295 28.2458 12.6362 11.3617 13.4224 12.9366 35.5492 61.0482 25.4882 24.5699 18.3296 21.7544 35.4387 32.1412 6.52744 13.5345 23.8501 27.2997
Blast
BLAST of TCONS_00001095 vs. Swiss-Prot (Human)
Match: TLL2 (Tolloid-like protein 2 OS=Homo sapiens GN=TLL2 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.740e-28
Identity = 88/220 (40.00%), Postives = 120/220 (54.55%), Query Frame = 2
Query:  113 RTRRDTVADEYRKWPGGIVPYTFGFTAGYKEQQVFKQAIKEIEKVSCVRFVKRTTERDYVRIISSREGCFSTIXXXXXX-XXXXXXXXCHTKGIALHETFHTLGFYHEXXXXXXXXXXXXXXSNAMEGAKRQFEKYKPGEAHTLGHPYDPDSIMHYSNRAFSKNGH-KTITYRKDPS---KKLGQRVKLSPIDIKQLNELYRC-------KNNTSNVKKP 736
            R RR T +   R WPGG++PY  G      ++ +FKQA++  EK +CV F++RT E  ++       GC S +GR GG  Q +S+G  C   GI  HE  H +GF+HEH R DRD HV +   N   G +  F K + GE  +LG  YD DSIMHY+   FS+     TI  R+D +     +GQRV+LS  DI Q  +LY+C       ++ T N   P
Sbjct:  146 RVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFSAP 365          
The following BLAST results are available for this feature:
BLAST of TCONS_00001095 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TLL22.740e-2840.00Tolloid-like protein 2 OS=Homo sapiens GN=TLL2 PE=... [more]
back to top