Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001094 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001094
Unique NameTCONS_00001094
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1489

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001094 ID=TCONS_00001094|Name=TCONS_00001094|organism=Clytia hemisphaerica|type=transcript|length=1489bp
TTGTCATTGCTCTTGATGACGCGCTCGCGCATGTCATGTAGAAGATCTTT
TCAAGGTCACCTAAATGAAGtgtgttttcttttcaagtcatcatgttttc
tgacaaaatttttctttccctttttttttgaaagttgttaaaggttttaa
ataAGAAACGTCACTTTGTTGTTGCTCATCACTGGCAAATGTGTGTGTTG
ATATAAATACATTGGAAGAGTCGGTCACACTCTTATAAAATCTCCGTTAC
TCAACAAGACATTTTTCGCTGGTCATAAGACTTACTTAAAAAGACGTTTG
ATAAATTGAGAGAACGATGTATTTGATTTTTGTACTGATgttacaatgtt
tttgtttgacttCTGGTGGAAAGTTCGTTAAAGAACGAGtGCATTCGCGG
ACAAGACGAGATACGGTAGCAGACGAATACCGGAAATGGCCGGGAGGGAT
TGTTCCGTATACTTTCGGTTTTACTGCAGGTTACAAAGAGCAGCAAGTTT
TCAAGCAAGCCATCAAAGAAATCGAGAAAGTTTCTTGTGTTCGTTTCGTA
AAGAGGACCACTGAACGAGATTATGTTCGAATCATATCAAGCAGAGAAGG
ATGCTTCTCAACGATTGGTCGTGATGGAGGGCAACAAGATTTATCCTTAG
GAGATGGTTGCCACACCAAAGGCATTGCACTACACGAGACTTTCCACACT
TTAGGCTTCTATCATGAGCACGTGAGGAGGGACCGCGATCACCATGTTTT
TGTTGATGTCAGCAATGCGATGGAAGGAGCGAAAagacaatttgaaaaat
acaagccGGGAGAAGCTCATACTCTCGGACACCCTTATGATCCGGACAGC
ATCATGCATTACTCCAACAGAGCCTTTAGTAAGAATGGACATAAAACCAT
CACCTACCGGAAAGACCCTTCAAAGAAGTTGGGACAGCGAGTAAAATTGA
GCCCTATCGATATCAAACAACTGAATGAGCTTTACAGATGCAAAAACAAC
ACCTCGAATGTGAAGAAGCCGAAAAAGACACGAATCGAGATAGATACTTG
TCGCGATGACCCATGGGTTGGCTTCCAGTGtttgttttacagattttctg
gTGGCTGTTATTTCTACCGAGAGCGCATGCGTCAAGCTTGTCCGAAAACG
TGCGGATTTTGTCGTTCGACGTGTTTTGATACGTCGCAATATTGCAATTA
CTTCGTGTATCATGGTTACTGTACAAGGAGCGAAAATGTTCGAAAACGAT
GTCGTAAAAGTTGTAAGATCTGTCGCATTGCGTAATCGTCATAACAATCT
CGATATAATTTTTATTGCGACAAACGAACTTGATTTCCAATCATTGAATA
TGTCGATACCACTATTGTAAATTTTTCTGTCGATGAAATTTTGATTGACG
ATTCCTCTTAAAAACGCGTTTACATTATTGTAAATATGAAGAATTGTTTG
AGGTAAATAGCTAATGTGTTGTGTGTATGTAAAATTGAC
Run BLAST on NCBI

protein sequence of TCONS_00001094-protein

>TCONS_00001094-protein ID=TCONS_00001094-protein|Name=TCONS_00001094-protein|organism=Clytia hemisphaerica|type=polypeptide|length=322bp
MYLIFVLMLQCFCLTSGGKFVKERVHSRTRRDTVADEYRKWPGGIVPYTF
GFTAGYKEQQVFKQAIKEIEKVSCVRFVKRTTERDYVRIISSREGCFSTI
GRDGGQQDLSLGDGCHTKGIALHETFHTLGFYHEHVRRDRDHHVFVDVSN
AMEGAKRQFEKYKPGEAHTLGHPYDPDSIMHYSNRAFSKNGHKTITYRKD
PSKKLGQRVKLSPIDIKQLNELYRCKNNTSNVKKPKKTRIEIDTCRDDPW
VGFQCLFYRFSGGCYFYRERMRQACPKTCGFCRSTCFDTSQYCNYFVYHG
YCTRSENVRKRCRKSCKICRIA
Run BLAST on NCBI

transcript from alignment at sc0000007:111454..116006-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001094 ID=TCONS_00001094|Name=TCONS_00001094|organism=Clytia hemisphaerica|type=transcript|length=4553bp|location=Sequence derived from alignment at sc0000007:111454..116006- (Clytia hemisphaerica)
TTGTCATTGCTCTTGATGACGCGCTCGCGCATGTCATGTAGAAGATCTTT TCAAGGTCACCTAAATGAAGTGTGTTTTCTTTTCAAGTCATCATGTTTTC TGACAAAATTTTTCTTTCCCTTTTTTTTTGAAAGTTGTTAAAGGTTTTAA ATAAGAAACGTCACTTTGTTGTTGCTCATCACTGGCAAATGTGTGTGTTG ATATAAATACATTGGAAGAGTCGGTCACACTCTTATAAAATCTCCGTTAC TCAACAAGACATTTTTCGCTGGTCATAAGACTTACTTAAAAAGACGTTTG ATAAATTGAGAGAACGATGTATTTGATTTTTGTACTGATGTTACAATGTT TTTGTTTGACTTCTGGTGGAAAGTTCGTTAAAGAACGAGGTTTGTAAAAT TTATGCTATTGTTTTATAGTGCTTGAAGCACTTGAATCTCATCGAGATTT TGATCATTTTACGTTCGAGAGTCGCAAAAAATGAAGAAAGACATCAAAAC GAACGGGAGCATCGTCGTTCCTCTGAATTTTAAAGATCCACCTCTGACAA TCCTAACCCGCTATAATATGGACCAAAATTAAGTAAATGGTTCTTAGGTC AATGAACCCCAATAAAGAGTTGGGTAAACAAATAGGACCATTTTGTGATA TGAAAATTTATGAAACTATGAAAATCTATCACAAATCGCTTGTTGATGTA GTCTTAATTTGTTTAGATGTTTGTCTCAAACCTTACAACTTTTGAGGGAA AATTATTAAATTTGTTGATCGACGGTACCATCTTAAGTTGTCAATAGAAA TTTGAGAATACATGCCTTAGGAAATACGTCGGTTTTTTTTACCGGATGAA CTTTGTTCTTTCACTTGCAAATTACAAGTCAAGGCTTAGGGCAGTCTGTT CTCAAAAGTATTTCCGATATATTGAGCAGTGTGACGTTTTGAAGAGGAGC AACGGATTTCACGTAATGCGACTGTCTTCTGATAGCGGATGAAAGATGCC CGTTACCACAGGCTTATTGATGTTGTTGTTGACAGTGTCAAAACCACATG AACTTCCACTGGTCGCACTATTTTTATGAATATTATGCAAGAAAATGTTT GAGGTTACAACCTATGTTTCTTTTATAAAGTGTTTTATTTATCTCATCCT TAAATTGTGGTTGAGAAGCGCTAAAAACGTCAAAATGTTGACTGCTTGAT GTCTTGTTTCATTCTTTTTTTCAGTGCATTCGCGGACAAGACGAGATACG GTAGCAGACGAATACCGGAAATGGCCGGGAGGGATTGTTCCGTATACTTT CGGTTTTACTGCAGGTGAGTGAGCTTCGTGTTGTCTTCACACGAAATCCA TGTTCGCAGAAATCGATTTCATTTGATATTTGAGTACCACTGAGGATTGA CTTTTCTAATTTTAGCATGCCTGGGATATAGTACACTGTAATTGAGTTGC GAAAAATATATTTGTTATTTGAAACAGGAGAATCGTGTTAGTAAAATATT TGAACCGTATTTGAGCTAATGCCGATAAAGATCATCCTATCCTTATTCTG TTGGTTTCAGGAATTAGAAACAAACGACTAAATTCCGAGTACCTTTTTCT TTGTGAATGATTTCATTAAGTCCCTTTCTACAGGTTACAAAGAGCAGCAA GTTTTCAAGCAAGCCATCAAAGAAATCGAGAAAGTTTCTTGTGTTCGTTT CGTAAAGAGGACCACTGAACGAGATTATGTTCGAATCATATCAAGCAGAG AAGGGTAAGAACAAGCTAGCACTAAATCGATGTGCACTTGCAGTCTAATT ACCAAGGATTGGGCTATTCCAGAAATAGTCTGTACCCTATGTCGAAGAGG TGTGACGTCCAGGGTGGTCTGGAAAATCTGGAAAATAAAAAAACCTGGGG AGTCTGGTTTTTGAACGAAAAAATCCAGGGTGGTCAGTAAAATGAGGTTG GAAATCTAGGGTGGTCAGTGACACGAGGTCGAAAATCCAGGGTGGTCAAT TTTTTTTAAATCCTCCTCAACATAGGGGGTACAAATTTCTCCTGGAATAG CTAGGTTACGGCTTAGCGTTATCGGTGCTTCATAATATTTAAGGACTTTC AGTTTTCTAAAACTCTGTCCAAATATAACATTCAGATCTATCGAGTGGTA GCGCCAATTTAGCTTCGATTTCAAGGCTAATGCACTATGTGCAACATAAG CCCTTTATTTATGAATTTTGTGTTTTTTAACATGACATACCGGTTTTTGT TCTCGAAAACAATCTTTACCTATGATTTGGGTCCAGGTTGAATGATTCGT TTCTATTCAACATCTATCTTCACTTTTCAGATGCTTCTCAACGATTGGTC GTGATGGAGGGCAACAAGATTTATCCTTAGGAGATGGTTGCCACACCAAA GGCATTGCACTACACGAGACTTTCCACACTTTAGGCTTCTATCATGAGCA CGTGAGGAGGGACCGCGATCACCATGTTTTTGTTGATGTCAGCAATGCGA TGGAAGGTGTGTCTCTTTATCTTTCTTTTTATTGTTGTTCAACTAAAAGA AGTTGCCTTTTGTTGTAGACTCGATTTTCAACTTTGATATCAATGGGCAA CGAGTACGTTTTTCTTCTGATAACGAAAAGATTTGACAGGTGTGAAAACA TTAAAAAACTTTATCGTTGCCCTCTTGTTGTAAACGTGATCGCTTGAAAT GAAAAACATTAATCCTGTAAACTTTTTAACGAGGTGCGACTCATGTATAT TACCTGTCAATCGACGTGCTATCTGCACTTGTTTTCTTTATTGTGTTGAT ATTTCATAAAATACCGCCCCAAACCGCTAGATCGATATTTTTTCCCCAAA AAATAGCTTNTTTTTCTTCTGATAACGAAAAGATTTAACAGGTGTGAAAA CATTAAAAAACTTCATCGTTGCCCTCTTGTTGTAAACGTGATCGCTTGAA ATGAAAAACATTAATCCTGTAAACTTTTTAACGAGGTGCGACTCATGTAT ATTACCTGTCAATCGACGTGATATCTGCACTTGTTTTCTTTATTGTGTTG ATATTTCATAACATACGGCCCCAAACCGCTAGATCGATATTTTTTCCCCA AAAAATAGCTTACATCTGTTATAGGAGCGAAAAGACAATTTGAAAAATAC AAGCCGGGAGAAGCTCATACTCTCGGACACCCTTATGATCCGGACAGCAT CATGCATTACTCCAACAGAGCCTTTAGTAAGAATGGACATAAAACCATCA CCTACCGGAAAGACCCTTCAAAGAAGTTGGGACAGCGAGTAAAATTGAGC CCTATCGATATCAAACAACTGAATGAGCTTTACAGGTTTGTAAATCTCCG AAAGATTGAATGAAGGATTATTGTATTTGAATAATCTAACATCTTCCTTT TTACTACCGGAAACACGTTTTCTGCTCTTATTTTGGTAAGAAAAATGGCG TAATCATATGCCCATCCAATAATTGAGTTGAATTGCCCATAGAATGTCTT CTCTATCATGTTCTCTTTTTGTGTACAACTTTTTGACAGTGACTTCATTC TACCTTTCTTTCCAGATGCAAAAACAACACCTCGAATGTGAAGAAGCCGA AAAAGACACGAATCGAGATAGGTAAGAATACGAACAAAATTTTCAACTTG ATTCTATCTATTTCTTTCAATGGTCAACGCCCCCTAATCTAGCTCAATCC AATTTTGAACTTAAGCCAAAAAGAAAAGTTGGACCATCTTGCAATAGGTA GAAATTGCTTCTTGCATGTTTGAAACAGAGATTCCAACCATCAGACCATT CCGTACCCATATTCCGTAATAGATGTGGGCAACTCGCGCTTCACCTAAAC CAAATTTTTTTAGTGCAATTATCAGCATGATGAAACATTTAGCTACAATC GTATAGCGCTAAAACCAGCAAAAATTACTAAATAAATAGGCCTATAAATG TGTTTGTGAACTGTTGAAAATTTCATTGAAAACCAAATAGTTTCGTGAAA TTTGGGATGATCTACATCCGAGGAGTCCTGGGTAGAATGAACATGTATTA AAAATGATTATTTTATAACTTTATTCGAAAGTGTTCCATATTTTCTCGTT TCCATAGATACTTGTCGCGATGACCCATGGGTTGGCTTCCAGTGTTTGTT TTACAGATTTTCTGGTGGCTGTTATTTCTACCGAGAGCGCATGCGTCAAG CTTGTCCGAAAACGTGCGGATTTTGTCGTTCGACGTGTTTTGATACGTCG CAATATTGCAATTACTTCGTGTATCATGGTTACTGTACAAGGAGCGAAAA TGTTCGAAAACGATGTCGTAAAAGTTGTAAGATCTGTCGCATTGCGTAAT CGTCATAACAATCTCGATATAATTTTTATTGCGACAAACGAACTTGATTT CCAATCATTGAATATGTCGATACCACTATTGTAAATTTTTCTGTCGATGA AATTTTGATTGACGATTCCTCTTAAAAACGCGTTTACATTATTGTAAATA TGAAGAATTGTTTGAGGTAAATAGCTAATGTGTTGTGTGTATGTAAAATT GAC

Coding sequence (CDS) from alignment at sc0000007:111454..116006-

>TCONS_00001094 ID=TCONS_00001094|Name=TCONS_00001094|organism=Clytia hemisphaerica|type=CDS|length=6783bp|location=Sequence derived from alignment at sc0000007:111454..116006- (Clytia hemisphaerica)
ATACTTGTCGCGATGACCCATGGGTTGGCTTCCAGTGTTTGTTTTACAGA
TTTTCTGGTGGCTGTTATTTCTACCGAGAGCGCATGCGTCAAGCTTGTCC
GAAAACGTGCGGATTTTGTCGTTCGACGTGTTTTGATACGTCGCAATATT
GCAATTACTTCGTGTATCATGGTTACTGTACAAGGAGCGAAAATGTTCGA
AAACGATGTCGTAAAAGTTGTAAGATCTGTCGCATTGCGTAAATGCAAAA
ACAACACCTCGAATGTGAAGAAGCCGAAAAAGACACGAATCGAGATAGGA
GCGAAAAGACAATTTGAAAAATACAAGCCGGGAGAAGCTCATACTCTCGG
ACACCCTTATGATCCGGACAGCATCATGCATTACTCCAACAGAGCCTTTA
GTAAGAATGGACATAAAACCATCACCTACCGGAAAGACCCTTCAAAGAAG
TTGGGACAGCGAGTAAAATTGAGCCCTATCGATATCAAACAACTGAATGA
GCTTTACAGATGCTTCTCAACGATTGGTCGTGATGGAGGGCAACAAGATT
TATCCTTAGGAGATGGTTGCCACACCAAAGGCATTGCACTACACGAGACT
TTCCACACTTTAGGCTTCTATCATGAGCACGTGAGGAGGGACCGCGATCA
CCATGTTTTTGTTGATGTCAGCAATGCGATGGAAGGTTACAAAGAGCAGC
AAGTTTTCAAGCAAGCCATCAAAGAAATCGAGAAAGTTTCTTGTGTTCGT
TTCGTAAAGAGGACCACTGAACGAGATTATGTTCGAATCATATCAAGCAG
AGAAGGTGCATTCGCGGACAAGACGAGATACGGTAGCAGACGAATACCGG
AAATGGCCGGGAGGGATTGTTCCGTATACTTTCGGTTTTACTGCAGATGT
ATTTGATTTTTGTACTGATGTTACAATGTTTTTGTTTGACTTCTGGTGGA
AAGTTCGTTAAAGAACGAGATACTTGTCGCGATGACCCATGGGTTGGCTT
CCAGTGTTTGTTTTACAGATTTTCTGGTGGCTGTTATTTCTACCGAGAGC
GCATGCGTCAAGCTTGTCCGAAAACGTGCGGATTTTGTCGTTCGACGTGT
TTTGATACGTCGCAATATTGCAATTACTTCGTGTATCATGGTTACTGTAC
AAGGAGCGAAAATGTTCGAAAACGATGTCGTAAAAGTTGTAAGATCTGTC
GCATTGCGTAAATGCAAAAACAACACCTCGAATGTGAAGAAGCCGAAAAA
GACACGAATCGAGATAGGAGCGAAAAGACAATTTGAAAAATACAAGCCGG
GAGAAGCTCATACTCTCGGACACCCTTATGATCCGGACAGCATCATGCAT
TACTCCAACAGAGCCTTTAGTAAGAATGGACATAAAACCATCACCTACCG
GAAAGACCCTTCAAAGAAGTTGGGACAGCGAGTAAAATTGAGCCCTATCG
ATATCAAACAACTGAATGAGCTTTACAGATGCTTCTCAACGATTGGTCGT
GATGGAGGGCAACAAGATTTATCCTTAGGAGATGGTTGCCACACCAAAGG
CATTGCACTACACGAGACTTTCCACACTTTAGGCTTCTATCATGAGCACG
TGAGGAGGGACCGCGATCACCATGTTTTTGTTGATGTCAGCAATGCGATG
GAAGGTTACAAAGAGCAGCAAGTTTTCAAGCAAGCCATCAAAGAAATCGA
GAAAGTTTCTTGTGTTCGTTTCGTAAAGAGGACCACTGAACGAGATTATG
TTCGAATCATATCAAGCAGAGAAGGTGCATTCGCGGACAAGACGAGATAC
GGTAGCAGACGAATACCGGAAATGGCCGGGAGGGATTGTTCCGTATACTT
TCGGTTTTACTGCAGATGTATTTGATTTTTGTACTGATGTTACAATGTTT
TTGTTTGACTTCTGGTGGAAAGTTCGTTAAAGAACGAGATACTTGTCGCG
ATGACCCATGGGTTGGCTTCCAGTGTTTGTTTTACAGATTTTCTGGTGGC
TGTTATTTCTACCGAGAGCGCATGCGTCAAGCTTGTCCGAAAACGTGCGG
ATTTTGTCGTTCGACGTGTTTTGATACGTCGCAATATTGCAATTACTTCG
TGTATCATGGTTACTGTACAAGGAGCGAAAATGTTCGAAAACGATGTCGT
AAAAGTTGTAAGATCTGTCGCATTGCGTAAATGCAAAAACAACACCTCGA
ATGTGAAGAAGCCGAAAAAGACACGAATCGAGATAGGAGCGAAAAGACAA
TTTGAAAAATACAAGCCGGGAGAAGCTCATACTCTCGGACACCCTTATGA
TCCGGACAGCATCATGCATTACTCCAACAGAGCCTTTAGTAAGAATGGAC
ATAAAACCATCACCTACCGGAAAGACCCTTCAAAGAAGTTGGGACAGCGA
GTAAAATTGAGCCCTATCGATATCAAACAACTGAATGAGCTTTACAGATG
CTTCTCAACGATTGGTCGTGATGGAGGGCAACAAGATTTATCCTTAGGAG
ATGGTTGCCACACCAAAGGCATTGCACTACACGAGACTTTCCACACTTTA
GGCTTCTATCATGAGCACGTGAGGAGGGACCGCGATCACCATGTTTTTGT
TGATGTCAGCAATGCGATGGAAGGTTACAAAGAGCAGCAAGTTTTCAAGC
AAGCCATCAAAGAAATCGAGAAAGTTTCTTGTGTTCGTTTCGTAAAGAGG
ACCACTGAACGAGATTATGTTCGAATCATATCAAGCAGAGAAGGTGCATT
CGCGGACAAGACGAGATACGGTAGCAGACGAATACCGGAAATGGCCGGGA
GGGATTGTTCCGTATACTTTCGGTTTTACTGCAGATGTATTTGATTTTTG
TACTGATGTTACAATGTTTTTGTTTGACTTCTGGTGGAAAGTTCGTTAAA
GAACGAGATACTTGTCGCGATGACCCATGGGTTGGCTTCCAGTGTTTGTT
TTACAGATTTTCTGGTGGCTGTTATTTCTACCGAGAGCGCATGCGTCAAG
CTTGTCCGAAAACGTGCGGATTTTGTCGTTCGACGTGTTTTGATACGTCG
CAATATTGCAATTACTTCGTGTATCATGGTTACTGTACAAGGAGCGAAAA
TGTTCGAAAACGATGTCGTAAAAGTTGTAAGATCTGTCGCATTGCGTAAA
TGCAAAAACAACACCTCGAATGTGAAGAAGCCGAAAAAGACACGAATCGA
GATAGGAGCGAAAAGACAATTTGAAAAATACAAGCCGGGAGAAGCTCATA
CTCTCGGACACCCTTATGATCCGGACAGCATCATGCATTACTCCAACAGA
GCCTTTAGTAAGAATGGACATAAAACCATCACCTACCGGAAAGACCCTTC
AAAGAAGTTGGGACAGCGAGTAAAATTGAGCCCTATCGATATCAAACAAC
TGAATGAGCTTTACAGATGCTTCTCAACGATTGGTCGTGATGGAGGGCAA
CAAGATTTATCCTTAGGAGATGGTTGCCACACCAAAGGCATTGCACTACA
CGAGACTTTCCACACTTTAGGCTTCTATCATGAGCACGTGAGGAGGGACC
GCGATCACCATGTTTTTGTTGATGTCAGCAATGCGATGGAAGGTTACAAA
GAGCAGCAAGTTTTCAAGCAAGCCATCAAAGAAATCGAGAAAGTTTCTTG
TGTTCGTTTCGTAAAGAGGACCACTGAACGAGATTATGTTCGAATCATAT
CAAGCAGAGAAGGTGCATTCGCGGACAAGACGAGATACGGTAGCAGACGA
ATACCGGAAATGGCCGGGAGGGATTGTTCCGTATACTTTCGGTTTTACTG
CAGATGTATTTGATTTTTGTACTGATGTTACAATGTTTTTGTTTGACTTC
TGGTGGAAAGTTCGTTAAAGAACGAGATACTTGTCGCGATGACCCATGGG
TTGGCTTCCAGTGTTTGTTTTACAGATTTTCTGGTGGCTGTTATTTCTAC
CGAGAGCGCATGCGTCAAGCTTGTCCGAAAACGTGCGGATTTTGTCGTTC
GACGTGTTTTGATACGTCGCAATATTGCAATTACTTCGTGTATCATGGTT
ACTGTACAAGGAGCGAAAATGTTCGAAAACGATGTCGTAAAAGTTGTAAG
ATCTGTCGCATTGCGTAAATGCAAAAACAACACCTCGAATGTGAAGAAGC
CGAAAAAGACACGAATCGAGATAGGAGCGAAAAGACAATTTGAAAAATAC
AAGCCGGGAGAAGCTCATACTCTCGGACACCCTTATGATCCGGACAGCAT
CATGCATTACTCCAACAGAGCCTTTAGTAAGAATGGACATAAAACCATCA
CCTACCGGAAAGACCCTTCAAAGAAGTTGGGACAGCGAGTAAAATTGAGC
CCTATCGATATCAAACAACTGAATGAGCTTTACAGATGCTTCTCAACGAT
TGGTCGTGATGGAGGGCAACAAGATTTATCCTTAGGAGATGGTTGCCACA
CCAAAGGCATTGCACTACACGAGACTTTCCACACTTTAGGCTTCTATCAT
GAGCACGTGAGGAGGGACCGCGATCACCATGTTTTTGTTGATGTCAGCAA
TGCGATGGAAGGTTACAAAGAGCAGCAAGTTTTCAAGCAAGCCATCAAAG
AAATCGAGAAAGTTTCTTGTGTTCGTTTCGTAAAGAGGACCACTGAACGA
GATTATGTTCGAATCATATCAAGCAGAGAAGGTGCATTCGCGGACAAGAC
GAGATACGGTAGCAGACGAATACCGGAAATGGCCGGGAGGGATTGTTCCG
TATACTTTCGGTTTTACTGCAGATGTATTTGATTTTTGTACTGATGTTAC
AATGTTTTTGTTTGACTTCTGGTGGAAAGTTCGTTAAAGAACGAGATACT
TGTCGCGATGACCCATGGGTTGGCTTCCAGTGTTTGTTTTACAGATTTTC
TGGTGGCTGTTATTTCTACCGAGAGCGCATGCGTCAAGCTTGTCCGAAAA
CGTGCGGATTTTGTCGTTCGACGTGTTTTGATACGTCGCAATATTGCAAT
TACTTCGTGTATCATGGTTACTGTACAAGGAGCGAAAATGTTCGAAAACG
ATGTCGTAAAAGTTGTAAGATCTGTCGCATTGCGTAAATGCAAAAACAAC
ACCTCGAATGTGAAGAAGCCGAAAAAGACACGAATCGAGATAGGAGCGAA
AAGACAATTTGAAAAATACAAGCCGGGAGAAGCTCATACTCTCGGACACC
CTTATGATCCGGACAGCATCATGCATTACTCCAACAGAGCCTTTAGTAAG
AATGGACATAAAACCATCACCTACCGGAAAGACCCTTCAAAGAAGTTGGG
ACAGCGAGTAAAATTGAGCCCTATCGATATCAAACAACTGAATGAGCTTT
ACAGATGCTTCTCAACGATTGGTCGTGATGGAGGGCAACAAGATTTATCC
TTAGGAGATGGTTGCCACACCAAAGGCATTGCACTACACGAGACTTTCCA
CACTTTAGGCTTCTATCATGAGCACGTGAGGAGGGACCGCGATCACCATG
TTTTTGTTGATGTCAGCAATGCGATGGAAGGTTACAAAGAGCAGCAAGTT
TTCAAGCAAGCCATCAAAGAAATCGAGAAAGTTTCTTGTGTTCGTTTCGT
AAAGAGGACCACTGAACGAGATTATGTTCGAATCATATCAAGCAGAGAAG
GTGCATTCGCGGACAAGACGAGATACGGTAGCAGACGAATACCGGAAATG
GCCGGGAGGGATTGTTCCGTATACTTTCGGTTTTACTGCAGATGTATTTG
ATTTTTGTACTGATGTTACAATGTTTTTGTTTGACTTCTGGTGGAAAGTT
CGTTAAAGAACGAGATACTTGTCGCGATGACCCATGGGTTGGCTTCCAGT
GTTTGTTTTACAGATTTTCTGGTGGCTGTTATTTCTACCGAGAGCGCATG
CGTCAAGCTTGTCCGAAAACGTGCGGATTTTGTCGTTCGACGTGTTTTGA
TACGTCGCAATATTGCAATTACTTCGTGTATCATGGTTACTGTACAAGGA
GCGAAAATGTTCGAAAACGATGTCGTAAAAGTTGTAAGATCTGTCGCATT
GCGTAAATGCAAAAACAACACCTCGAATGTGAAGAAGCCGAAAAAGACAC
GAATCGAGATAGGAGCGAAAAGACAATTTGAAAAATACAAGCCGGGAGAA
GCTCATACTCTCGGACACCCTTATGATCCGGACAGCATCATGCATTACTC
CAACAGAGCCTTTAGTAAGAATGGACATAAAACCATCACCTACCGGAAAG
ACCCTTCAAAGAAGTTGGGACAGCGAGTAAAATTGAGCCCTATCGATATC
AAACAACTGAATGAGCTTTACAGATGCTTCTCAACGATTGGTCGTGATGG
AGGGCAACAAGATTTATCCTTAGGAGATGGTTGCCACACCAAAGGCATTG
CACTACACGAGACTTTCCACACTTTAGGCTTCTATCATGAGCACGTGAGG
AGGGACCGCGATCACCATGTTTTTGTTGATGTCAGCAATGCGATGGAAGG
TTACAAAGAGCAGCAAGTTTTCAAGCAAGCCATCAAAGAAATCGAGAAAG
TTTCTTGTGTTCGTTTCGTAAAGAGGACCACTGAACGAGATTATGTTCGA
ATCATATCAAGCAGAGAAGGTGCATTCGCGGACAAGACGAGATACGGTAG
CAGACGAATACCGGAAATGGCCGGGAGGGATTGTTCCGTATACTTTCGGT
TTTACTGCAGATGTATTTGATTTTTGTACTGATGTTACAATGTTTTTGTT
TGACTTCTGGTGGAAAGTTCGTTAAAGAACGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000613XLOC_000613Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001094-proteinTCONS_00001094-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001094-exon-sc0000007-1575043694:115618..116006TCONS_00001094-exon-sc0000007-1575043694:115618..116006Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1575043694:114693..114782TCONS_00001094-exon-sc0000007-1575043694:114693..114782Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1575043694:114253..114373TCONS_00001094-exon-sc0000007-1575043694:114253..114373Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1575043694:113501..113676TCONS_00001094-exon-sc0000007-1575043694:113501..113676Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1575043694:112672..112882TCONS_00001094-exon-sc0000007-1575043694:112672..112882Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1575043694:112386..112441TCONS_00001094-exon-sc0000007-1575043694:112386..112441Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1575043694:111454..111899TCONS_00001094-exon-sc0000007-1575043694:111454..111899Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1510915933:115618..116006TCONS_00001094-exon-sc0000007-1510915933:115618..116006Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1510915933:114693..114782TCONS_00001094-exon-sc0000007-1510915933:114693..114782Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1510915933:114253..114373TCONS_00001094-exon-sc0000007-1510915933:114253..114373Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1510915933:113501..113676TCONS_00001094-exon-sc0000007-1510915933:113501..113676Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1510915933:112672..112882TCONS_00001094-exon-sc0000007-1510915933:112672..112882Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1510915933:112386..112441TCONS_00001094-exon-sc0000007-1510915933:112386..112441Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1510915933:111454..111899TCONS_00001094-exon-sc0000007-1510915933:111454..111899Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1491911889:115618..116006TCONS_00001094-exon-sc0000007-1491911889:115618..116006Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1491911889:114693..114782TCONS_00001094-exon-sc0000007-1491911889:114693..114782Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1491911889:114253..114373TCONS_00001094-exon-sc0000007-1491911889:114253..114373Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1491911889:113501..113676TCONS_00001094-exon-sc0000007-1491911889:113501..113676Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1491911889:112672..112882TCONS_00001094-exon-sc0000007-1491911889:112672..112882Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1491911889:112386..112441TCONS_00001094-exon-sc0000007-1491911889:112386..112441Clytia hemisphaericaexon
TCONS_00001094-exon-sc0000007-1491911889:111454..111899TCONS_00001094-exon-sc0000007-1491911889:111454..111899Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:111454..116006 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.01434 0.728345 0.397384 0.859683 2.68596 2.38779 4.4812 4.9444 6.29398 4.49858 5.5492 7.04694 9.93479 9.28564 7.5213 4.35913 4.85936 5.55483 13.4975 18.5553 11.3802 11.0955 7.64787 10.1904 18.5777 16.8187 0.170691 2.33671 10.2243 6.86235
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001506Peptidase_M12A
IPR006026Peptidase_Metallo
IPR003582ShKT_dom
IPR024079MetalloPept_cat_dom
IPR034035Astacin-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004222 metalloendopeptidase activity
molecular_function GO:0008237 metallopeptidase activity
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00001094 vs. Swiss-Prot (Human)
Match: TLL2 (Tolloid-like protein 2 OS=Homo sapiens GN=TLL2 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 7.057e-28
Identity = 88/220 (40.00%), Postives = 120/220 (54.55%), Query Frame = 2
Query:  398 RTRRDTVADEYRKWPGGIVPYTFGFTAGYKEQQVFKQAIKEIEKVSCVRFVKRTTERDYVRIISSREGCFSTIXXXXXX-XXXXXXXXCHTKGIALHETFHTLGFYHEXXXXXXXXXXXXXXSNAMEGAKRQFEKYKPGEAHTLGHPYDPDSIMHYSNRAFSKNGH-KTITYRKDPS---KKLGQRVKLSPIDIKQLNELYRC-------KNNTSNVKKP 1021
            R RR T +   R WPGG++PY  G      ++ +FKQA++  EK +CV F++RT E  ++       GC S +GR GG  Q +S+G  C   GI  HE  H +GF+HEH R DRD HV +   N   G +  F K + GE  +LG  YD DSIMHY+   FS+     TI  R+D +     +GQRV+LS  DI Q  +LY+C       ++ T N   P
Sbjct:  146 RVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFSAP 365          
The following BLAST results are available for this feature:
BLAST of TCONS_00001094 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TLL27.057e-2840.00Tolloid-like protein 2 OS=Homo sapiens GN=TLL2 PE=... [more]
back to top