Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001087 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001087
Unique NameTCONS_00001087
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2888

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001087 ID=TCONS_00001087|Name=TCONS_00001087|organism=Clytia hemisphaerica|type=transcript|length=2888bp
AATGATGGACGCCAAAGGAATAACTCGTCAAGTTTAAGATGGTGATGCTT
CTGCTTGCCATTTGGTTTTATGGTATAACAGCAACAACGATACAGAATGA
ATTTTCATCCACTTTTACATCCATCGAACTTGCTTCGATTTCTCCATCCG
CCAGTTCGATGAAAACCAACACCCTAAATGAACCTTCCCGAACACCACCC
ACTCAAAGAAGCTACTCGTCATATGAAGCTTCTTCGCAACCATCAAACGT
TGACAGTTTTTTAACATTACAAACGACCAACTTTGACGCTTCTTCAATCT
TACAACAATCAACAACATCAGAAAAGACAGCTTTAACGACTGAATCTGTG
GTAACCTCTACCCTCCAGTTATCCTCCCAACCCTTCCATAGAtcctttga
tattttttcaagctCCCTGGAGCACACGTCAACTGTTGCTACAAATTATT
TGGTGACGCCCAACAATCTCGCAACATCGCAGTCAGACTCGCCAACATCC
GCAAAAGCTATGACCACTGATTCAAAGAGTTCGTCTCCTAAGAACATTCA
ACCAAGCACATCTACGAGAGAAATAGTCTCATTGACAACCTCCATTATAT
CCCTACCACCATCAAGAAAACCCTCCACTACTCAACAACCAACCACAACC
ACAACGCAACCACCTTTGCCAGCATTTAAGCAAAATATTGATGATACCAG
TATATTTGTTTTGCTACCTTTGTCTTATCCTGTCGACAGCTGGGAAGAGA
TCACTGTTTATGTCGTCATTCCTTCACTTGGTTACAAGTCAACGGGCTCA
TGGTACAGAATTTTcatcaagaaagaaaaacacgACCGTTACCCTGCACT
TGTCATGAAGCCCAAGCAACTTTCGAACGATCCACGTCGAAAAAGAAGAA
GTGCAGCCAAATTCTTGAACATCAAACTTGGCATCAGTAAAGACTGTACT
AAAGTCGATCAAGAGATTTGTAATGGTCCTCTAACTCCCTCAACTAACTA
CAGTATTCAGTTGGAAGTCTTCTTCACCAATGGAACATCTTTGACAACCC
CCTCCTCAAAACCCTGGTCTACTTTACAAAAAGcGGTGATCGTGCCACAA
GAAGGTGTTCGTTCATCTGTCGTCATCATCATCCTCACCGTCCTTCTCGT
CTTCTTCATCTTTCTCACCATCATCATCACAATCATCGTCTGCCGTAAGA
AACGATCACGAAAATATCTCAGAGGGCAGCAAGACAAGGACAGTATGGGT
GTGTCCCTCATGTCCACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAA
GAAGAAATTCTCAGGACCAGATATTCTCACTGAGcgacgaaaaagtctga
aaggAATGACGAGACCTGTCTTCATCCGAGATTTTCGTGCATGGGTTGAA
AGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGTCTAT
ACGGGATGTCGGGAAATTTGAGAGGCATGAAGTTGCTGACATGGCAGAAA
ATAACGGCAAAAACCGATACGTCAACGTCTTACCATACGATTATACGCGA
GTGAAACTATCGAGTATAGACGACGAACCTGGTTCGGACTATATCAACGC
TAATTATATTCACGGTTACAAGCAACCACGAGCATACATAGCCACACAAG
GACCCCTCCCAAGTACCACAGACCACTTCTGGCAGATGGTCTGGGAACAA
AAATCTCGAATCATTGTCATGGTTACGCAATGCAATGAGAAGAATCGTGT
AAAATGTCATCAATATTGGCCTGCATCAGGTTCGACGCGATACGGAGAAA
TCGAAGTAACGCTTAAGCACGAAACAATATATCCAGAATGGACCGAACGG
GAATTTCTAATGACATTCGAGggCGAATCTCGATTACTCAGACATTTTCA
ATACACAGCATGGCCTGACCACGGCGTACCTCGCTCATCTAAAGAAATGT
TACAGTTCGTGACGACCGTTCGGTTTCATCAACGGCCCGATGACGGCCCT
GTCATCTGTCATTGCTCgGCGGGAGTTGGGCGCACAGGAACTTACTTGTG
TGTTGATATTCTGGTCAATAAACTACAGACCGAAAACAATGTAGATGTTT
ATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCTCCATGGTGCAGACT
GAGGACCAATACATCTTCATTCACCGAGTCATATTGGACTATTTGAAACA
ACGTGACGAAAAGCAACAAATCTTTTCCGGATATTCGACCTTAGAAATGC
GAAGGAAAAGTAAAAGTGAATCCAATCCTGTCGAACCTGCGGCTGAAGCA
TTattgaaagaagaagaaaaagaagacgaGGAAGATGAAAATCTggataa
tgatgatgatgaaacgAAATCTGACGATTTTCTTTCCGAAGAATTCGAGA
ACAGCGATTTAGAAACACCTCCTGTATAATACGCATACTACCTCTTCATA
TTTgtagacttttttttgactttatgtTGTGTAGAAAGAAAATGGATGCC
CTTTTATCGGGTAGGATTTCATCTTAACAAGTGATGATCAAATATCACTC
ACCATGCATCTCCCTCATACTTCGttctttaaaacatttttattgtaatt
tctttttaaatggaAATTGTAAATAGGTACactagaaatttaatttttat
tttgaaattttatataaaTAGCGAGAGATAATATTAGTCTACTTTATTGT
TATATTCTTCTTGGTTTACTTTCGTTGAATTCTTTCAAGATACCGATTGG
CATAAGAAGAAGCTTTCTTTTTTGGGGGCTAAAGAAAACAAGATGATAAT
ATAATAATTTTGTGTTCTTATTTATTATTGTAAATAATATTCTTCACATT
GAAAGTGAGGTAAAGAAATAtcttaaaacaaacaaaag
Run BLAST on NCBI

protein sequence of TCONS_00001087-protein

>TCONS_00001087-protein ID=TCONS_00001087-protein|Name=TCONS_00001087-protein|organism=Clytia hemisphaerica|type=polypeptide|length=796bp
MVMLLLAIWFYGITATTIQNEFSSTFTSIELASISPSASSMKTNTLNEPS
RTPPTQRSYSSYEASSQPSNVDSFLTLQTTNFDASSILQQSTTSEKTALT
TESVVTSTLQLSSQPFHRSFDIFSSSLEHTSTVATNYLVTPNNLATSQSD
SPTSAKAMTTDSKSSSPKNIQPSTSTREIVSLTTSIISLPPSRKPSTTQQ
PTTTTTQPPLPAFKQNIDDTSIFVLLPLSYPVDSWEEITVYVVIPSLGYK
STGSWYRIFIKKEKHDRYPALVMKPKQLSNDPRRKRRSAAKFLNIKLGIS
KDCTKVDQEICNGPLTPSTNYSIQLEVFFTNGTSLTTPSSKPWSTLQKAV
IVPQEGVRSSVVIIILTVLLVFFIFLTIIITIIVCRKKRSRKYLRGQQDK
DSMGVSLMSTNYQRNGASRLKKKFSGPDILTERRKSLKGMTRPVFIRDFR
AWVERSASDSTFRFAEEFESIRDVGKFERHEVADMAENNGKNRYVNVLPY
DYTRVKLSSIDDEPGSDYINANYIHGYKQPRAYIATQGPLPSTTDHFWQM
VWEQKSRIIVMVTQCNEKNRVKCHQYWPASGSTRYGEIEVTLKHETIYPE
WTEREFLMTFEGESRLLRHFQYTAWPDHGVPRSSKEMLQFVTTVRFHQRP
DDGPVICHCSAGVGRTGTYLCVDILVNKLQTENNVDVYGVVCLMRTQRCS
MVQTEDQYIFIHRVILDYLKQRDEKQQIFSGYSTLEMRRKSKSESNPVEP
AAEALLKEEEKEDEEDENLDNDDDETKSDDFLSEEFENSDLETPPV
Run BLAST on NCBI

transcript from alignment at sc0000007:60040..73166-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001087 ID=TCONS_00001087|Name=TCONS_00001087|organism=Clytia hemisphaerica|type=transcript|length=13127bp|location=Sequence derived from alignment at sc0000007:60040..73166- (Clytia hemisphaerica)
AATGATGGACGCCAAAGGAATAACTCGTCAAGTTTAAGGTTGGTTGATTA TCTTTGAAAAGTAGATTTGTCTGTGGTTCTTTAGAATCATTTTCTTTATG GATAATTCAATAATATTTTAGCTACATGCGTGACTTGATTAGTATTCATC CGCCCCTTGAGAGCTTGTTATAAATGGATGAAAATGATAGTTAATCAAAA AATCACTATCAGACATTTTGAGTAGCAATTAGCAATTTGTGTTGAATGAA ATGAGATGAGGGTCATTTAGTTCGGTAATTGCTAGTTATTCGCTTCCTAT ATTTGATTGGAAGTTGAGAAAAGAGATCTGTAATGTGTGTTTCTATGAAG TTTATTTCTACTTGAGATATGATTTGGATGACTCTTTGTGAAAACGATGT ATCATCATCATGATCTTTGAGAAGGTTGTCGTAATATCAAAGTAGTGTTA TCCTCTTCATTACGTTTTATAGAGTTCATCTAATACTTATTAAGCGTATA ATATATATTCATTTCACAAAAAGCTGTAAGTCTTATCATTCATATCGCTT TCATTTTTTATATGTTGTATGAACAGTTAAGAGAGGGGTGTCGTATACTG AACTTTTTTGGTTTTCTTTCTTAGATGGTGATGCTTCTGCTTGCCATTTG GTTTTATGTAAGTTTTCGTTTCTTTTTCATTCTTCGCATTCTCAGAATAT ATTTTTGTAATTCTTCAGGAAGTCTGGATTAGTTAAAATAAAATGTCTAC GTGATGGTATTCTATAGTATGTCTCGAGACACGCCCTTTTATATAAGATC CTGACCCGTGAATAGCTACTTATATTTTGGGCAACGGGTTGGTATGATAT GTGCAGCGAAAAATAGTAAAACGATAATTGTTCCCGTTTCGTTGAACCAG GAAATTTAGAACAAGGAAATTTAATGATCCATCACTTCTTGGAATGAATT ACTGATTTTTTCGTTTCCTTCAGGGTATAACAGCAACAACGATACAGAAT GAATTTTCATCCACTTTTACATCCATCGAACTTGCTTCGATTTCTCCATC CGCCAGTTCGATGAAAACCAACACCCTAAATGAACCTTCCCGAACACCAC CCACTCAAAGGTATAGCTCCTCAATGAACATCATTGCTGAAAGACTGGAA ACAAGTAACCTATCAATAGACATGACTGTACGAACTTTTATATCAACAAC TAAATTGATAATGGTACCTGACTTTTCTACAGACATGAACGTTAAAGAAT CACCAACAACATCTATAGACTTTTCAACATCACAACTCGTGACTGACTTA CAAACTTCTATATCAAGTGATCGTCAAACAAACTCATCCACAGACCTTTC TATAACAGCACTGGACATGTTGTCTTCTATGAAGACCTCACAATTTCAAA CAGAGTTTTCCACGCACTTTCTTGACAGCTCTTCGCCATTTTCTTCTTCA TCTTCTCCCATTGAAAAGTCTCTTTACTCTTCTTCGATTGCTTTGCCGTC CTCACTTTCATCTTCCTACCTCTTATTTTCTACCTCTGTTAGTTCCCAGT TCTCTAGCTTTTCTTCAAGCATTTCTCCCAGTGTACCTTACAGTGTTTCT GCCAGCACCTCCTCGTCAACCATTATCAGATCAGCTGAAGTGGAACCTTC TTCAAACATCATTTCAACTTTACGGGCTTTCTCCACTGTTGACAGAAGCT ACTCGTCATATGAAGCTTCTTCGCAACCATCAAACGTTGACAGTTTTTTA ACATTACAAACGACCAACTTTGACGCTTCTTCAATCTTACAACAATCAAC AACATCAGAAAAGACAGCTTTAACGACTGAATCTGTGGTAACCTCTACCC TCCAGTTATCCTCCCAACCCTTCCATAGATCCTTTGATATTTTTTCAAGC TCCCTGGAGCACACGTCAACTGTTGCTACAAATTATTTGGTGACGCCCAA CAATCTCGCAACATCGCAGTCAGACTCGCCAACATCCGCAAAAGCTATGA CCACTGATTCAAAGAGTTCGTCTCCTAAGAACATTCAACCAAGCACATCT ACGAGAGAAATAGTCTCATTGACAACCTCCATTATATCCCTACCACCATC AAGAAAACCCTCCACTACTCAACAACCAACCACAACCACAACGCAACCAC CTTTGCCAGCATTTAAGCAAAATATTGATGATACCAGTATATTTGTTTTG CTACCTTTGTCTTATCCTGTCGACAGCTGGGAAGAGATCACTGTTTATGT CGTCATTCCTTCACTTGGTAAGTCACTAATTCTTTTTGTAAATTTTGAGA TTTTTATTTCTTTTTGCCACATTTTCTTTCATGTATTCAATTTCGTAATT TCGTATTTAAGAAAAATTTAAGCATGCAAAAAAGTAGTATCTACGAAAAT GTAAAAGGTAACAGTCCTAGTGTCCCTACGGCTATAAAGATACATATTTT TATACAGGTTACAAGTCAACGGGCTCATGGTACAGAATTTTCATCAAGAA AGAAAAACACGACCGTTACCCTGCACTTGTCATGAAGCCCAAGCAACTTT CGAACGATCCACGTCGAAAAAGAAGAAGTGCAGCCAAATTCTTGAACATC AAACTTGGCATCAGTAAAGACTGTACTAAAGTCGATCAAGAGATTTGTAA TGGTCCTCTAACTCCCTCAACTAACTACAGGTTTTACTTAAGTCTGTTCC AAAAAACTCCGTACTTTACACATTGCTCTCACGGGAAAAAAATATAACTA AAAGTAATTAATACCTTTTTGAAAAGATAATTTTAGCAGCTCGATGTGAG CTTTAAAGAATTTTCTAAGGATTTGAAAATGAAGATGAAAAGTGAAAGAA AAAATGAAGATTTTTCTACTCGGTAATATCTTTTCTGAAACAGCGCTGAT TTCAAGTAAGTATTCAGTTTTTCTTTTTGGTAAAGAGTTATAGCCTCTTG TCCATTTCGATCGTTTCTAGCAATTTATGGCCTATTTTGACCTTTCTCGG AGGCTTGTGGTTTTCGATCGAAAAGTGATATAAAAGATCTTATAAAAAAT CTTTCTAAGGAGGTATTACTTTTAGCTATATCTTTTCACTATATCTTTTC ACCTAAAGAGGACTTTTAGACCAAACTTTACAAGAAGTCTTTTTTTGTTG AGAAATATTGCGTAATAATTTCAAGACTACTCCCTCTCAGGTTTTCATTT ATATTTTCGTCCAATGTATGAAAGACAACCCTCAAAGTTATATTTTCACT ATTTTGAACCCACATGAAGTGGTAAAAGAAGGGAGACACACCCATCCTGA AGATCTAATTCAATTTCACAATAAGTTGTTATTGACAAATAGAGACATGG GTATGATAAATATTCTCTTTGATCAAGTGCAGATGTTTTCGAAGATGTAT TAAACTTCTATTTTGTTCGTTTAGTATTCAGTTGGAAGTCTTCTTCACCA ATGGAACATCTTTGACAACCCCCTCCTCAAAACCCTGGTCTACTTTACAA AAAGGTTGGTAACTTTTTTTTTTATTTCCTCCTTTGCTAGTTTCTTCTCC AGTAATCTCGTATTCAGATATTACCTTGTTTTGTGATTGAGCTCTCCGAG TAAATGTTTGTACAACCCGGGACGAAGATATTATTTTTCCCTGTCAACTA ATGCCGTTGTCTAGGGAGGCGGTGACTTGTTTCGTGGGAGGTTTATCACT TACAAATCTGTGTTTTGGAAGAACCAAAACAATGTACGCAAGGTTTGATA TGAAGGCCTGCTCAAGATCAATAATGAACGGCTTTATGAAACTATTTTGT TAATATCACGAGAAGCCTTCAGTTAATTTTTGATTTTGATTTGATTTTTT TTANATGGCCAGTTCATTTTTTTTATTTCGATTCTTGAGGAGTGTGTTCT ATAAAATTTGATTTTTTTCTTCCAGCGGTGATCGTGCCACAAGAAGGTGT TCGTTCATCTGTCGTCATCATCATCCTCACCGTCCTTCTCGTCTTCTTCA TCTTTCTCACCATCATCATCACAATCATCGTCTGCCGTAAGAAACGATCA CGAAAATATCTCAGGTATGTATCTTACGTGTTTCAACCTCTTTTCGTCAT TTTTTTTTAGGCCCCTCCCAAGTGTTACCAACTATTCTTCGTTAATATTT TTTTAATGAATTATGAATTTTATGAGACAGTCCTTGAAACAATCGGTGTT CTTCACTGATCTGAAAGAAAAAAGCTTCCATTAGAGTATAGCAAAAAAAG GTCCTCCGATCCTTCCTACGAGCAGTTCATTTTGTACTACAACCAGGAAA TGGACTATATCCAGAATAATTTGAATTAAACAGGGAAATTATATAACAAT TAATGGACATCCTCTCCAAGGGTAGCAGTGCTTTTGCAGCTTGCCGTTAC TATATTCAATTTATAGACATACAGCTAACTGTGGTATTTTGTAGCAGGTT CTCTCTTTGAAATGTAGATTTTATATAAATTAAATGTTTATATGTCACTT CAATAAACCTTCTATCATTTGCAAAGCTATGTTTCTTGGCGTCAGTTTGT TTGCGATTTCTTAAAACGATCGATTAACCTCTATGTCCGTCTTTCATAAG TATGTTGCGATTGATGTTGGATGGAAGCAGGCACTTTGCATCTTTTTGTG ACGGTCGGATGAATTAAACGCTTTCACGGGCTGAGAAACTCTCATTGTGA CGTTCACAGAGAGTGTCAAATAGGTTAAGCCTCGTCATTTGGCACAATGT CCCATCAAAAAGTTTTGATTGATTTTGCAGACGAAATTCTCCAATAAATA GCGCATGCTGGTTATGTTTTCCATCATTTTCTTTTTAAAATATTGGATTC TGATTGCTTAATCTCATCAAAAAGACTTCATATGGCGCTCTCTTTCCGAA AGAGAAGAAGAGGTTGAAGAAGAAGAGTTTGCTCTTTCAAAACTCCGTCC TCGCTCCTTTATAACCATTTCCAACTATTGCTTTTGAAATAATTAAGGAG TTTTTAAAGAGTTGTATAATGGAAAAAGAAGGGCTTAAAAAGCTGAAACG AATAGTTTACGACTAGTTGCTTTTATTTCTGCTGATTGAGAAGTAAAGAA GTCATTTTCTGGGTGAAACATGAAAGGTTGTTTAGGCTAGGCTCTTAATT CGAATATAGATTTATGGAAACTGGAATTCCTTTCTTTCTCAAAACGGAAA TGAAATTAGCATTTGTTGATGATTTGTGTTTTCGATTAACTGGATTGGAT TGATTGGATGAAACCATAAATTTGATGATATAAAACATTAACGACGATTA CGTAACTCCTTTTCGCAGCTTTAATTGCATCCGGCGTTTGATTTTAGCAC AGTGACAAATTTTATGTAGTGTGCAATATATTGGTTGGTATTATCAGTAC ATTTGATAAGCTGCTTCTGCTCATTAACCACCTTCAAACAATTATTCTTC CTTATTCTCTTCGTTTCGTCATTTTCCTGTTTTCGACAAAACACGTGTTT ATTTTCGACCATATTATTGCGAGGATGTTTTCGCGTGAAGCGGTGAAGAA GAAGGAGGATCAAGGGAAGATGTCCTCTGCACTTGCATTTTTTGTAGACG GGATATGTCCTTTTCATCACTTGTACTCGGTATCTTGAATTTTGCGAATG CTTTTCAAATACTTTTTAGAGTAATTTTTAAAGGGAGATAAAATATGCTT TTGCTGTAAAATCGGGTTTTGTTTTGTTGTTGCCTTGACAACAATCATTC CATCAAAATGGCTACGGCTTATCCCCCTTCCTGGTGCAAAAAAGCGGCGC CAATAATCCCTCTTCTATCTCTATTTAATTAATCCAACATTTTCATTACT TTTTCAAAAGAAGACTTAATTTGTCTTTTCCTTCTCACTCTTTTAATTTG TTATTTCGGGAGATGGATATTATATGTTCTTCCTTTGCAAGCTTCAAAAC ATCAGCACATGATATTGCTGCTAATGTCTTTGTTTCGCACCGGCGTAGGA AACTTACTTTTGATCAATTAAGAAAGACAATAGAATGTAAGAATTGATCT CTTAATGGCTTTGCGTCTCATCAGCCAAAATATTACTTCACTAATTGTCT AATCTTTATCACTTGATGATTTCAACTGGCTTGTGTGTTCTTTAATAGAT GTCCTTATGGAAGTTGTTTGCGGAGAGTCAACGGAGTTAGAAGTACTTTA GTAAAGTCAATGTTTACACATTATGTAATGTGGCGAGAACGTCCTTCTTT AATTTTAGCGAATGATATCATGGGAATTTGCGACCGTTATTTTTTTGTGT GTTTTTGTGATGAGTTGTACATCATTTTTGGTCTTTCGTGTTTAAGCGTC ACTGAGGGGTAATGAAAGTTCACTTTCAGATCTTTTGATACAGAAGGGGG GAACATTCTGGTTGGGCGTTTGATTGTTTTGTTTGAGACATGGATTAAAT GGGAATGGAAGGGAATTCAGCTGCTTCGTTGAGTTTTCACGTTTACACAT CATCATAGAGAGACACATGCACCTTCTCATTTCATTTTCAACCTCAAAGA AAAGAAAACAGAAAGAAAGGGAATATTTCTCAATAATTATTTCTTCTCCA ACATCTTCATATATTACATCGTATTCATTTTTTCCAAAACATGTGTCTGT TTGTCTTCTCTATTTTTCTTCTTTCTTTCTTCTTCTTTCCATTTCTCGAC TTGAACACTCTTCCCTCTCATCACAACGTTCAAGTGAAAGAGTGATCTGT TTCTTTCTCGACTGAACAGCACAGCAAGACTNTGAACACTCTTCCCTCTC ATCACAACACAACGTTCAAGTGAAAGAGTGATCTGTTTCTTTCTCGACTG AACAACACAGCAAGACTCTCACGATGTGTTCCGAAGCACCCTCAAACTAC CGAAGACGTCGTTTTCAAATGTGCTTCTGCTTAGTGTAAGTCTTTACTTC CCTTTTCAACCTTTTTTTCCTTTCTTTCTGTTTTCATGCAGGGCTTTAGA GGTGGTGAATTTCCTCTGTTTTCATCGCGGAAATCTAGTTTCTTTTTCTG ATTTTGAACACCCAAAAGATAATGGAGGAAGGGTGATTTCCACCATCGGT ACTTTCCGACTGATGTTGTTGTGTGGGCTTCTCTTGAGTTCAGTGGGTAG TTCATCCTATGGAAAGCAATAGGAACAAAATACAACAAGTCAATGATAGA AATTTTAATTGACTTATTCACATGGTTAGGTGAACTTTCTTTTTGTGATG AGTACTTTTATAAAAAGAGAAAGTCGAAGCTTTATTAAACTGTCTTGATC CTGTATTATAATGTTTATTTTGAACATGAGACAAAGAGAAGTGTATGAAT CATGCGAGAAGTTAGTGACATCTCTTCAATTATAAATAACATTCTTACTT CAAAGCATTCACACCACACTTCTATCGAAATTCATACACTGTATTTAAAA CAAGTTGAATGTTGCATTCTGTAACTTCGCAATGAAGAAGAAAATTTGCT GTTGATTTTCCTTTTATGGTGTTTGTATGTGTTGAATGATTGGTTTCTGC TTTGACGTGCTTCCATCTCTGACTGAGAATCAATGTCTCATTTCATTCAA ATGACATACTTTGCACTCACACAAGTCTTCTAACTGCTTTTACTGTGTAT TATATTTATTAGTTGCAAAAAATTAAAAACAAAGGGATCATTTTTGAAGA TATGCGGATGTACGACTTGGTGGACGAGAACAATGTGTTGTTTGACAAGC AAACCATCAAACGACACAATAGTCGTGAACTGAACAACAATGAACCCGCT CTTCTCCGAAGAACTGTTTCTTTTTCCAACACCATAAGGTGTAAATGTTC AAAACTCTTAACTTTAACACCCCATCTTCACCGTAGAGGGCAGCAAGACA AGGACAGTATGGGTGTGTCCCTCATGTCCACCAACTATCAGAGGAATGGG GCGAGCAGGTTGAAGAAGAAATTCTCAGGACCAGATATTCTCACTGAGCG ACGAAAAAGTCTGAAAGGAATGACGAGGTAAGTGTTTTCTCTTTTTTCTA ATTTTTAGATCATGGCCGTTTGTTTATTTTTTCGAGTTTGAGCGAAACTG TTTTGTCTGAACGAGATATGTCACACTCTGAAGGGTTTCCGTCAATAGTC AATAGACTGACGGGTTTTCGGGACTTTTAAAATAATGATATTTTCCAAAC AATCAGCCTGCATTAACTATATATGATGATGTCATCATTAGGTAATGTTA AAATGCATAATTTATTACCGACGGCCCGAACTGAGTGATAGGAAGATAAT AAACGCAATAACAAATATAGAAATCGTTTTATCTTTACATCGAACATGCA ATTTCACAAACATTCTTCTGATAAGAGAGGTAGCAAGCCATGTTTCAAGA TAAGGCCTTTTGTTTCGCATTTTTAATAAGCATTTGAACACCCCTCGACG TGATGTATCGCTTGATTAATGATACCGTTGTAAATATAAAAGCCTGTCAA AGTGTCATTCTTCATAATATGTTGTTTTCATAATGTATTTTCGTTTGTTT GTCAGACCTGTCTTCATCCGAGATTTTCGTGCATGGGTTGAAAGAAGTGC ATCGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGGTATGATGTTACC CTTTCACCACCACTTTCACAAGTTTGTGTCAAAAATGACAAACGTGAACT TTTGGAAATTAACCTTTACTTATATCTTCCCTTTCATTAATATTTGTAAT AACCAAACAAGTTGACCATTTACACGCCATAATTTCTGTACAACATTTTT TTGGATGTTATTCAAAATGGGACGGAACGTCTAATTAATGATCATTAAGT CTTTTTAAGCCATCCTTAATATTACACAATTTCTTCTAATTATAACTTTC TTAATGTTTATCTTTCAGTCTATACGGGATGTCGGGAANATGTTTCAATC TTTAAAGCATTAAAAGCTTTATAAATCTTTAAAGCATTAAAAGCTTTATA AGTGCATGTCATGACCTTTCAGTGGGGGCATTTAGTGAAAGCTATGACTA GTTTAGATTTTAGATCATGGCCGTTTGTTTATTTTTTCGAGTTTGAGCGA AACTGTTTTGTCTGAACGAGATATGTCACATTCATTCTGAAGGGTTTCCG TCAATAGTCAATAGACTGACGGGTTTGCGGGACTTTTAAAATAATGATAT TTTCCAAACAATCAGCCTGTATTAACTATATATGATGATGTCATCATTAG GTAATGTTAAAATGCATAATTTATTACCGACGGCCCGAAACTGAGTGATA GGAAGATAATAAACGCAATAACAAATATAGGCATCGTTTTATCTTTACAT CGAACATGCAATTTCACAAACATTCTTCTGATAAGAGAGGTAGCAAGCCA TGTTTCAAGATAAGGCCTTTTGTTTCGCATTTTTAATAAGCATTTGAACA CCCCTCGACGTGTGTATCGCTTGATTAATGATACCGTTGTAAATATAAAA GCCTGTCAAAGTGTCATTCTTCATATGCTCTTATTTTCATAATGTATTTT CGTTTGTTTGTCAGACCTGTCTTCATCCGAGATTTTCGTGCATGGGTTGA AAGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGGTAT GATGTTACCCTTTCACCACCACTTTCACAAGTTTGTGTCAAAAATGACAA ACGTGAACTTTTGGAAATTAACCTTTACTTATATCTTCCCTTTCATTAAT ATTTGTAATAACCAAACAAGTTGACCATTTACACGCCATAATTTCTGTAC AACATTTTTTTGGATGTTATTCAAAATGGGACGGAACGTCTAATTAATGA TCATTAAGTCTTTTTAAGCCATCCTTAATATTACACAATTTCTTCTAATT ATAACTTTCTTAATGTTTATCTTTCAGTCTATACGGGATGTCGGGAAATT TGAGAGGCATGAAGTTGCTGACATGGCAGAAAATAACGGCAAAAACCGAT ACGTCAACGTCTTACCATGTAAGTCAAGTTTCGTTTTAGGAAAATTTTTG GCTCTGAATTGAATTTATGATTCTTTCCTTAAAGAGAGATTTTTAGAAAT GTAGAAATTTTTTCTTGGTATTTCCTGTGATGTGACCACCATGCAGTCTT TATAGAATTTCTCCTTATTAATCATCTGTATTTTGGTTTACCAGACGATT ATACGCGAGTGAAACTATCGAGTATAGACGACGAACCTGGTTCGGACTAT ATCAACGCTAATTATATTCACGTGAGTTGTTGTGCATTCATCAATTTTAG CTTTTTGGATTATTATTTTTTCAAGATAATTTTTTAACTTGCCATACCGG ATCTGTTTTACAGCGGAAACAAATCAGACTTTAATACGGTTAGAATTTCG TCTTTGTAGGGTTACAAGCAACCACGAGCATACATAGCCACACAAGGACC CCTCCCAAGTACCACAGACCACTTCTGGCAGATGGTCTGGGAACAAAAAT CTCGAATCATTGTCATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAA TGTCATCAATATTGGCCTGCATCAGGTTCGACGCGATACGGAGAAATCGA AGTAACGCTTAAGCACGAAACAATATATCCAGAATGGACCGAACGGGAAT TTCTAATGACATTCGAGGTGAGGAAAACTTCCCACGTTTTCTTGAACAGT TGATATTGGGTTGTCTGGTTCTCACTCTTTTAACGACGTTTATGGAGAAA TATTCGTCTCCTATTAATAACATGAATAAAAACAATATCTTTTATTATTT TAAAGGGCGAATCTCGATTACTCAGACATTTTCAATACACAGCATGGCCT GACCACGGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGACGAC CGTTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCATCTGTCATTGCT CGTAAGTTCTCTCCTCTTCACTTGCAGTAAATGACGTCATTTGTTTTCTT TCGGTTTTTAGAACAGCTCGGTAACGTAAAGGGTGAAGGGGTTGTATTTT TAGATTGGGAAATTAAACTTATTAAAAGAAGTTCTTAAAAATTTATCTTG TTCGTGCCTCCTTAACTTTTCATGCCAACCTATCTTAATTCGGAGCAATT TTCCTTAATGATAATTTCCTACACTTTTCTTGAATAGTTTCCTCATTAAA TTTAATCAGAAAATTCATGACAATCGGTTAAACCAGCTTAACGCAACCCA TTAGATAAATTGCACAATTTCGTGGTGGTGAATAACCAAGGGTAGCCATT CTTTCACACAACCAATATTTACTGCGACGCTGTTAAACGCTTTTTTTCGT AATTTCTACACACACCAAACCTCAAAAAACCCCTGACATACTTAACTTTA TACTAGTTCTTTTACGGTCTGTAAGTGTTCAAAATCTCATTAATCAAGCC TTGTTGTAAACGATTGTAGGGACATAAGATGCCATAACTTACTGCATCCT GTTATGACATAATATTAAGTAACAATTAATTATTTTGTTTGTGTTTTAGG GCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATATTCTGGTCAA TAAACTACAGACCGAAAACAATGTAGATGTTTATGGTGTAGTGTGTTTAA TGAGGACTCAACGATGCTCCATGGTGCAGACTGAGGTAATGAAATACAGA CCACATTTTTAAGCATCTTCAAAACCTAATCTTTATTCAACATTTTTACA AACCTACTGTTTTCTAGAATTGTACTCTATACTAAAATATAGGATTGCTT TTACTTTCAGGACCAATACATCTTCATTCACCGAGTCATATTGGACTATT TGAAACAACGTGACGAAAAGCAACAAATCTTTTCCGGATATTCGACCTTA GAAATGCGAAGGAAAAGTAAAAGTGAATCCAATCCTGTCGAACCTGCGGC TGAAGGTACGTTTCAAGTTTGTTTTGATAAGTAATCCTCAAGAACTGTCT TCTCAGAACGCAAAAACCGTAGATCAAGAATAAACATAACGAATTCGAGA AAGAAACAAATCGTTTTTTGTTGGAACTTGATCAGACTTGTTTCATAATT CTGTCTTCTCAGAATGTAAAAACCATAGACCTCATCAGATTTGATATAAA AAAATCAATCAACAAATAAACAATTTTCTAAGAAATCATAACGAACTCGT GAAAGAAACAAATCATTTTTGTTGGCACTTGATCAAATTTGTTTCATAAT CTGTATGTTATCATATACAATCAGGTTTTTTACTCAATTAAGTTCGCATT ACAGATCGTCTGATCTTTCGGTGAATTACCGTGACGTCATAATAGATCAC GCTGGTCTTTGATGGGAATCAGTATTAGGAAATCGCAGTTTACAAATTTA TCAAGAAATTAAGAAAAGCAATTCGATTATAAAATCTGTGATATCTTATC CCCCTGATTTCTCCATATAAATGCAACATTGTTTGGTGAGAATTCAGCCT TTGTTCATCCCTTAATTATTTTTTCTCTCATCTTCAGCATTATTGAAAGA AGAAGAAAAAGAAGACGAGGAAGATGAAAATCTGGATAATGATGATGATG AAACGAAATCTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTA GAAACACCTCCTGTATAATACGCATACTACCTCTTCATATTTGTAGACTT TTTTTTGACTTTATGTTGTGTAGAAAGAAAATGGATGCCCTTTTATCGGG TAGGATTTCATCTTAACAAGTGATGATCAAATATCACTCACCATGCATCT CCCTCATACTTCGTTCTTTAAAACATTTTTATTGTAATTTCTTTTTAAAT GGAAATTGTAAATAGGTACACTAGAAATTTAATTTTTATTTTGAAATTTT ATATAAATAGCGAGAGATAATATTAGTCTACTTTATTGTTATATTCTTCT TGGTTTACTTTCGTTGAATTCTTTCAAGATACCGATTGGCATAAGAAGAA GCTTTCTTTTTTGGGGGCTAAAGAAAACAAGATGATAATATAATAATTTT GTGTTCTTATTTATTATTGTAAATAATATTCTTCACATTGAAAGTGAGGT AAAGAAATATCTTAAAACAAACAAAAG

Coding sequence (CDS) from alignment at sc0000007:60040..73166-

>TCONS_00001087 ID=TCONS_00001087|Name=TCONS_00001087|organism=Clytia hemisphaerica|type=CDS|length=35865bp|location=Sequence derived from alignment at sc0000007:60040..73166- (Clytia hemisphaerica)
CATTATTGAAAGAAGAAGAAAAAGAAGACGAGGAAGATGAAAATCTGGAT
AATGATGATGATGAAACGAAATCTGACGATTTTCTTTCCGAAGAATTCGA
GAACAGCGATTTAGAAACACCTCCTGTATAAGACCAATACATCTTCATTC
ACCGAGTCATATTGGACTATTTGAAACAACGTGACGAAAAGCAACAAATC
TTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAGTGAATC
CAATCCTGTCGAACCTGCGGCTGAAGGGCGGGAGTTGGGCGCACAGGAAC
TTACTTGTGTGTTGATATTCTGGTCAATAAACTACAGACCGAAAACAATG
TAGATGTTTATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCTCCATG
GTGCAGACTGAGGGCGAATCTCGATTACTCAGACATTTTCAATACACAGC
ATGGCCTGACCACGGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTCG
TGACGACCGTTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCATCTGT
CATTGCTCGGTTACAAGCAACCACGAGCATACATAGCCACACAAGGACCC
CTCCCAAGTACCACAGACCACTTCTGGCAGATGGTCTGGGAACAAAAATC
TCGAATCATTGTCATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAAT
GTCATCAATATTGGCCTGCATCAGGTTCGACGCGATACGGAGAAATCGAA
GTAACGCTTAAGCACGAAACAATATATCCAGAATGGACCGAACGGGAATT
TCTAATGACATTCGAGACGATTATACGCGAGTGAAACTATCGAGTATAGA
CGACGAACCTGGTTCGGACTATATCAACGCTAATTATATTCACTCTATAC
GGGATGTCGGGAAATTTGAGAGGCATGAAGTTGCTGACATGGCAGAAAAT
AACGGCAAAAACCGATACGTCAACGTCTTACCATACCTGTCTTCATCCGA
GATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTTT
TGCCGAAGAATTTGAGAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCC
CTCATGTCCACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAA
ATTCTCAGGACCAGATATTCTCACTGAGCGACGAAAAAGTCTGAAAGGAA
TGACGAGCGGTGATCGTGCCACAAGAAGGTGTTCGTTCATCTGTCGTCAT
CATCATCCTCACCGTCCTTCTCGTCTTCTTCATCTTTCTCACCATCATCA
TCACAATCATCGTCTGCCGTAAGAAACGATCACGAAAATATCTCAGTATT
CAGTTGGAAGTCTTCTTCACCAATGGAACATCTTTGACAACCCCCTCCTC
AAAACCCTGGTCTACTTTACAAAAAGGTTACAAGTCAACGGGCTCATGGT
ACAGAATTTTCATCAAGAAAGAAAAACACGACCGTTACCCTGCACTTGTC
ATGAAGCCCAAGCAACTTTCGAACGATCCACGTCGAAAAAGAAGAAGTGC
AGCCAAATTCTTGAACATCAAACTTGGCATCAGTAAAGACTGTACTAAAG
TCGATCAAGAGATTTGTAATGGTCCTCTAACTCCCTCAACTAACTACAGA
AGCTACTCGTCATATGAAGCTTCTTCGCAACCATCAAACGTTGACAGTTT
TTTAACATTACAAACGACCAACTTTGACGCTTCTTCAATCTTACAACAAT
CAACAACATCAGAAAAGACAGCTTTAACGACTGAATCTGTGGTAACCTCT
ACCCTCCAGTTATCCTCCCAACCCTTCCATAGATCCTTTGATATTTTTTC
AAGCTCCCTGGAGCACACGTCAACTGTTGCTACAAATTATTTGGTGACGC
CCAACAATCTCGCAACATCGCAGTCAGACTCGCCAACATCCGCAAAAGCT
ATGACCACTGATTCAAAGAGTTCGTCTCCTAAGAACATTCAACCAAGCAC
ATCTACGAGAGAAATAGTCTCATTGACAACCTCCATTATATCCCTACCAC
CATCAAGAAAACCCTCCACTACTCAACAACCAACCACAACCACAACGCAA
CCACCTTTGCCAGCATTTAAGCAAAATATTGATGATACCAGTATATTTGT
TTTGCTACCTTTGTCTTATCCTGTCGACAGCTGGGAAGAGATCACTGTTT
ATGTCGTCATTCCTTCACTTGGGTATAACAGCAACAACGATACAGAATGA
ATTTTCATCCACTTTTACATCCATCGAACTTGCTTCGATTTCTCCATCCG
CCAGTTCGATGAAAACCAACACCCTAAATGAACCTTCCCGAACACCACCC
ACTCAAAGATGGTGATGCTTCTGCTTGCCATTTGGTTTTATCATTATTGA
AAGAAGAAGAAAAAGAAGACGAGGAAGATGAAAATCTGGATAATGATGAT
GATGAAACGAAATCTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCGA
TTTAGAAACACCTCCTGTATAAGACCAATACATCTTCATTCACCGAGTCA
TATTGGACTATTTGAAACAACGTGACGAAAAGCAACAAATCTTTTCCGGA
TATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAGTGAATCCAATCCTGT
CGAACCTGCGGCTGAAGGGCGGGAGTTGGGCGCACAGGAACTTACTTGTG
TGTTGATATTCTGGTCAATAAACTACAGACCGAAAACAATGTAGATGTTT
ATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCTCCATGGTGCAGACT
GAGGGCGAATCTCGATTACTCAGACATTTTCAATACACAGCATGGCCTGA
CCACGGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGACGACCG
TTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCATCTGTCATTGCTCG
GTTACAAGCAACCACGAGCATACATAGCCACACAAGGACCCCTCCCAAGT
ACCACAGACCACTTCTGGCAGATGGTCTGGGAACAAAAATCTCGAATCAT
TGTCATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAATGTCATCAAT
ATTGGCCTGCATCAGGTTCGACGCGATACGGAGAAATCGAAGTAACGCTT
AAGCACGAAACAATATATCCAGAATGGACCGAACGGGAATTTCTAATGAC
ATTCGAGACGATTATACGCGAGTGAAACTATCGAGTATAGACGACGAACC
TGGTTCGGACTATATCAACGCTAATTATATTCACTCTATACGGGATGTCG
GGAAATTTGAGAGGCATGAAGTTGCTGACATGGCAGAAAATAACGGCAAA
AACCGATACGTCAACGTCTTACCATACCTGTCTTCATCCGAGATTTTCGT
GCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAGA
ATTTGAGAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTCC
ACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGG
ACCAGATATTCTCACTGAGCGACGAAAAAGTCTGAAAGGAATGACGAGCG
GTGATCGTGCCACAAGAAGGTGTTCGTTCATCTGTCGTCATCATCATCCT
CACCGTCCTTCTCGTCTTCTTCATCTTTCTCACCATCATCATCACAATCA
TCGTCTGCCGTAAGAAACGATCACGAAAATATCTCAGTATTCAGTTGGAA
GTCTTCTTCACCAATGGAACATCTTTGACAACCCCCTCCTCAAAACCCTG
GTCTACTTTACAAAAAGGTTACAAGTCAACGGGCTCATGGTACAGAATTT
TCATCAAGAAAGAAAAACACGACCGTTACCCTGCACTTGTCATGAAGCCC
AAGCAACTTTCGAACGATCCACGTCGAAAAAGAAGAAGTGCAGCCAAATT
CTTGAACATCAAACTTGGCATCAGTAAAGACTGTACTAAAGTCGATCAAG
AGATTTGTAATGGTCCTCTAACTCCCTCAACTAACTACAGAAGCTACTCG
TCATATGAAGCTTCTTCGCAACCATCAAACGTTGACAGTTTTTTAACATT
ACAAACGACCAACTTTGACGCTTCTTCAATCTTACAACAATCAACAACAT
CAGAAAAGACAGCTTTAACGACTGAATCTGTGGTAACCTCTACCCTCCAG
TTATCCTCCCAACCCTTCCATAGATCCTTTGATATTTTTTCAAGCTCCCT
GGAGCACACGTCAACTGTTGCTACAAATTATTTGGTGACGCCCAACAATC
TCGCAACATCGCAGTCAGACTCGCCAACATCCGCAAAAGCTATGACCACT
GATTCAAAGAGTTCGTCTCCTAAGAACATTCAACCAAGCACATCTACGAG
AGAAATAGTCTCATTGACAACCTCCATTATATCCCTACCACCATCAAGAA
AACCCTCCACTACTCAACAACCAACCACAACCACAACGCAACCACCTTTG
CCAGCATTTAAGCAAAATATTGATGATACCAGTATATTTGTTTTGCTACC
TTTGTCTTATCCTGTCGACAGCTGGGAAGAGATCACTGTTTATGTCGTCA
TTCCTTCACTTGGGTATAACAGCAACAACGATACAGAATGAATTTTCATC
CACTTTTACATCCATCGAACTTGCTTCGATTTCTCCATCCGCCAGTTCGA
TGAAAACCAACACCCTAAATGAACCTTCCCGAACACCACCCACTCAAAGA
TGGTGATGCTTCTGCTTGCCATTTGGTTTTATCATTATTGAAAGAAGAAG
AAAAAGAAGACGAGGAAGATGAAAATCTGGATAATGATGATGATGAAACG
AAATCTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTAGAAAC
ACCTCCTGTATAAGACCAATACATCTTCATTCACCGAGTCATATTGGACT
ATTTGAAACAACGTGACGAAAAGCAACAAATCTTTTCCGGATATTCGACC
TTAGAAATGCGAAGGAAAAGTAAAAGTGAATCCAATCCTGTCGAACCTGC
GGCTGAAGGGCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATAT
TCTGGTCAATAAACTACAGACCGAAAACAATGTAGATGTTTATGGTGTAG
TGTGTTTAATGAGGACTCAACGATGCTCCATGGTGCAGACTGAGGGCGAA
TCTCGATTACTCAGACATTTTCAATACACAGCATGGCCTGACCACGGCGT
ACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGACGACCGTTCGGTTTC
ATCAACGGCCCGATGACGGCCCTGTCATCTGTCATTGCTCGGTTACAAGC
AACCACGAGCATACATAGCCACACAAGGACCCCTCCCAAGTACCACAGAC
CACTTCTGGCAGATGGTCTGGGAACAAAAATCTCGAATCATTGTCATGGT
TACGCAATGCAATGAGAAGAATCGTGTAAAATGTCATCAATATTGGCCTG
CATCAGGTTCGACGCGATACGGAGAAATCGAAGTAACGCTTAAGCACGAA
ACAATATATCCAGAATGGACCGAACGGGAATTTCTAATGACATTCGAGAC
GATTATACGCGAGTGAAACTATCGAGTATAGACGACGAACCTGGTTCGGA
CTATATCAACGCTAATTATATTCACTCTATACGGGATGTCGGGAAATTTG
AGAGGCATGAAGTTGCTGACATGGCAGAAAATAACGGCAAAAACCGATAC
GTCAACGTCTTACCATACCTGTCTTCATCCGAGATTTTCGTGCATGGGTT
GAAAGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGAG
GGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTCCACCAACTAT
CAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGGACCAGATAT
TCTCACTGAGCGACGAAAAAGTCTGAAAGGAATGACGAGCGGTGATCGTG
CCACAAGAAGGTGTTCGTTCATCTGTCGTCATCATCATCCTCACCGTCCT
TCTCGTCTTCTTCATCTTTCTCACCATCATCATCACAATCATCGTCTGCC
GTAAGAAACGATCACGAAAATATCTCAGTATTCAGTTGGAAGTCTTCTTC
ACCAATGGAACATCTTTGACAACCCCCTCCTCAAAACCCTGGTCTACTTT
ACAAAAAGGTTACAAGTCAACGGGCTCATGGTACAGAATTTTCATCAAGA
AAGAAAAACACGACCGTTACCCTGCACTTGTCATGAAGCCCAAGCAACTT
TCGAACGATCCACGTCGAAAAAGAAGAAGTGCAGCCAAATTCTTGAACAT
CAAACTTGGCATCAGTAAAGACTGTACTAAAGTCGATCAAGAGATTTGTA
ATGGTCCTCTAACTCCCTCAACTAACTACAGAAGCTACTCGTCATATGAA
GCTTCTTCGCAACCATCAAACGTTGACAGTTTTTTAACATTACAAACGAC
CAACTTTGACGCTTCTTCAATCTTACAACAATCAACAACATCAGAAAAGA
CAGCTTTAACGACTGAATCTGTGGTAACCTCTACCCTCCAGTTATCCTCC
CAACCCTTCCATAGATCCTTTGATATTTTTTCAAGCTCCCTGGAGCACAC
GTCAACTGTTGCTACAAATTATTTGGTGACGCCCAACAATCTCGCAACAT
CGCAGTCAGACTCGCCAACATCCGCAAAAGCTATGACCACTGATTCAAAG
AGTTCGTCTCCTAAGAACATTCAACCAAGCACATCTACGAGAGAAATAGT
CTCATTGACAACCTCCATTATATCCCTACCACCATCAAGAAAACCCTCCA
CTACTCAACAACCAACCACAACCACAACGCAACCACCTTTGCCAGCATTT
AAGCAAAATATTGATGATACCAGTATATTTGTTTTGCTACCTTTGTCTTA
TCCTGTCGACAGCTGGGAAGAGATCACTGTTTATGTCGTCATTCCTTCAC
TTGGGTATAACAGCAACAACGATACAGAATGAATTTTCATCCACTTTTAC
ATCCATCGAACTTGCTTCGATTTCTCCATCCGCCAGTTCGATGAAAACCA
ACACCCTAAATGAACCTTCCCGAACACCACCCACTCAAAGATGGTGATGC
TTCTGCTTGCCATTTGGTTTTATCATTATTGAAAGAAGAAGAAAAAGAAG
ACGAGGAAGATGAAAATCTGGATAATGATGATGATGAAACGAAATCTGAC
GATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTAGAAACACCTCCTGT
ATAAGACCAATACATCTTCATTCACCGAGTCATATTGGACTATTTGAAAC
AACGTGACGAAAAGCAACAAATCTTTTCCGGATATTCGACCTTAGAAATG
CGAAGGAAAAGTAAAAGTGAATCCAATCCTGTCGAACCTGCGGCTGAAGG
GCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATATTCTGGTCAA
TAAACTACAGACCGAAAACAATGTAGATGTTTATGGTGTAGTGTGTTTAA
TGAGGACTCAACGATGCTCCATGGTGCAGACTGAGGGCGAATCTCGATTA
CTCAGACATTTTCAATACACAGCATGGCCTGACCACGGCGTACCTCGCTC
ATCTAAAGAAATGTTACAGTTCGTGACGACCGTTCGGTTTCATCAACGGC
CCGATGACGGCCCTGTCATCTGTCATTGCTCGGTTACAAGCAACCACGAG
CATACATAGCCACACAAGGACCCCTCCCAAGTACCACAGACCACTTCTGG
CAGATGGTCTGGGAACAAAAATCTCGAATCATTGTCATGGTTACGCAATG
CAATGAGAAGAATCGTGTAAAATGTCATCAATATTGGCCTGCATCAGGTT
CGACGCGATACGGAGAAATCGAAGTAACGCTTAAGCACGAAACAATATAT
CCAGAATGGACCGAACGGGAATTTCTAATGACATTCGAGACGATTATACG
CGAGTGAAACTATCGAGTATAGACGACGAACCTGGTTCGGACTATATCAA
CGCTAATTATATTCACTCTATACGGGATGTCGGGAAATTTGAGAGGCATG
AAGTTGCTGACATGGCAGAAAATAACGGCAAAAACCGATACGTCAACGTC
TTACCATACCTGTCTTCATCCGAGATTTTCGTGCATGGGTTGAAAGAAGT
GCATCGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGAGGGCAGCAAG
ACAAGGACAGTATGGGTGTGTCCCTCATGTCCACCAACTATCAGAGGAAT
GGGGCGAGCAGGTTGAAGAAGAAATTCTCAGGACCAGATATTCTCACTGA
GCGACGAAAAAGTCTGAAAGGAATGACGAGCGGTGATCGTGCCACAAGAA
GGTGTTCGTTCATCTGTCGTCATCATCATCCTCACCGTCCTTCTCGTCTT
CTTCATCTTTCTCACCATCATCATCACAATCATCGTCTGCCGTAAGAAAC
GATCACGAAAATATCTCAGTATTCAGTTGGAAGTCTTCTTCACCAATGGA
ACATCTTTGACAACCCCCTCCTCAAAACCCTGGTCTACTTTACAAAAAGG
TTACAAGTCAACGGGCTCATGGTACAGAATTTTCATCAAGAAAGAAAAAC
ACGACCGTTACCCTGCACTTGTCATGAAGCCCAAGCAACTTTCGAACGAT
CCACGTCGAAAAAGAAGAAGTGCAGCCAAATTCTTGAACATCAAACTTGG
CATCAGTAAAGACTGTACTAAAGTCGATCAAGAGATTTGTAATGGTCCTC
TAACTCCCTCAACTAACTACAGAAGCTACTCGTCATATGAAGCTTCTTCG
CAACCATCAAACGTTGACAGTTTTTTAACATTACAAACGACCAACTTTGA
CGCTTCTTCAATCTTACAACAATCAACAACATCAGAAAAGACAGCTTTAA
CGACTGAATCTGTGGTAACCTCTACCCTCCAGTTATCCTCCCAACCCTTC
CATAGATCCTTTGATATTTTTTCAAGCTCCCTGGAGCACACGTCAACTGT
TGCTACAAATTATTTGGTGACGCCCAACAATCTCGCAACATCGCAGTCAG
ACTCGCCAACATCCGCAAAAGCTATGACCACTGATTCAAAGAGTTCGTCT
CCTAAGAACATTCAACCAAGCACATCTACGAGAGAAATAGTCTCATTGAC
AACCTCCATTATATCCCTACCACCATCAAGAAAACCCTCCACTACTCAAC
AACCAACCACAACCACAACGCAACCACCTTTGCCAGCATTTAAGCAAAAT
ATTGATGATACCAGTATATTTGTTTTGCTACCTTTGTCTTATCCTGTCGA
CAGCTGGGAAGAGATCACTGTTTATGTCGTCATTCCTTCACTTGGGTATA
ACAGCAACAACGATACAGAATGAATTTTCATCCACTTTTACATCCATCGA
ACTTGCTTCGATTTCTCCATCCGCCAGTTCGATGAAAACCAACACCCTAA
ATGAACCTTCCCGAACACCACCCACTCAAAGATGGTGATGCTTCTGCTTG
CCATTTGGTTTTATCATTATTGAAAGAAGAAGAAAAAGAAGACGAGGAAG
ATGAAAATCTGGATAATGATGATGATGAAACGAAATCTGACGATTTTCTT
TCCGAAGAATTCGAGAACAGCGATTTAGAAACACCTCCTGTATAAGACCA
ATACATCTTCATTCACCGAGTCATATTGGACTATTTGAAACAACGTGACG
AAAAGCAACAAATCTTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAA
AGTAAAAGTGAATCCAATCCTGTCGAACCTGCGGCTGAAGGGCGGGAGTT
GGGCGCACAGGAACTTACTTGTGTGTTGATATTCTGGTCAATAAACTACA
GACCGAAAACAATGTAGATGTTTATGGTGTAGTGTGTTTAATGAGGACTC
AACGATGCTCCATGGTGCAGACTGAGGGCGAATCTCGATTACTCAGACAT
TTTCAATACACAGCATGGCCTGACCACGGCGTACCTCGCTCATCTAAAGA
AATGTTACAGTTCGTGACGACCGTTCGGTTTCATCAACGGCCCGATGACG
GCCCTGTCATCTGTCATTGCTCGGTTACAAGCAACCACGAGCATACATAG
CCACACAAGGACCCCTCCCAAGTACCACAGACCACTTCTGGCAGATGGTC
TGGGAACAAAAATCTCGAATCATTGTCATGGTTACGCAATGCAATGAGAA
GAATCGTGTAAAATGTCATCAATATTGGCCTGCATCAGGTTCGACGCGAT
ACGGAGAAATCGAAGTAACGCTTAAGCACGAAACAATATATCCAGAATGG
ACCGAACGGGAATTTCTAATGACATTCGAGACGATTATACGCGAGTGAAA
CTATCGAGTATAGACGACGAACCTGGTTCGGACTATATCAACGCTAATTA
TATTCACTCTATACGGGATGTCGGGAAATTTGAGAGGCATGAAGTTGCTG
ACATGGCAGAAAATAACGGCAAAAACCGATACGTCAACGTCTTACCATAC
CTGTCTTCATCCGAGATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGAT
AGTACCTTTCGTTTTGCCGAAGAATTTGAGAGGGCAGCAAGACAAGGACA
GTATGGGTGTGTCCCTCATGTCCACCAACTATCAGAGGAATGGGGCGAGC
AGGTTGAAGAAGAAATTCTCAGGACCAGATATTCTCACTGAGCGACGAAA
AAGTCTGAAAGGAATGACGAGCGGTGATCGTGCCACAAGAAGGTGTTCGT
TCATCTGTCGTCATCATCATCCTCACCGTCCTTCTCGTCTTCTTCATCTT
TCTCACCATCATCATCACAATCATCGTCTGCCGTAAGAAACGATCACGAA
AATATCTCAGTATTCAGTTGGAAGTCTTCTTCACCAATGGAACATCTTTG
ACAACCCCCTCCTCAAAACCCTGGTCTACTTTACAAAAAGGTTACAAGTC
AACGGGCTCATGGTACAGAATTTTCATCAAGAAAGAAAAACACGACCGTT
ACCCTGCACTTGTCATGAAGCCCAAGCAACTTTCGAACGATCCACGTCGA
AAAAGAAGAAGTGCAGCCAAATTCTTGAACATCAAACTTGGCATCAGTAA
AGACTGTACTAAAGTCGATCAAGAGATTTGTAATGGTCCTCTAACTCCCT
CAACTAACTACAGAAGCTACTCGTCATATGAAGCTTCTTCGCAACCATCA
AACGTTGACAGTTTTTTAACATTACAAACGACCAACTTTGACGCTTCTTC
AATCTTACAACAATCAACAACATCAGAAAAGACAGCTTTAACGACTGAAT
CTGTGGTAACCTCTACCCTCCAGTTATCCTCCCAACCCTTCCATAGATCC
TTTGATATTTTTTCAAGCTCCCTGGAGCACACGTCAACTGTTGCTACAAA
TTATTTGGTGACGCCCAACAATCTCGCAACATCGCAGTCAGACTCGCCAA
CATCCGCAAAAGCTATGACCACTGATTCAAAGAGTTCGTCTCCTAAGAAC
ATTCAACCAAGCACATCTACGAGAGAAATAGTCTCATTGACAACCTCCAT
TATATCCCTACCACCATCAAGAAAACCCTCCACTACTCAACAACCAACCA
CAACCACAACGCAACCACCTTTGCCAGCATTTAAGCAAAATATTGATGAT
ACCAGTATATTTGTTTTGCTACCTTTGTCTTATCCTGTCGACAGCTGGGA
AGAGATCACTGTTTATGTCGTCATTCCTTCACTTGGGTATAACAGCAACA
ACGATACAGAATGAATTTTCATCCACTTTTACATCCATCGAACTTGCTTC
GATTTCTCCATCCGCCAGTTCGATGAAAACCAACACCCTAAATGAACCTT
CCCGAACACCACCCACTCAAAGATGGTGATGCTTCTGCTTGCCATTTGGT
TTTATCATTATTGAAAGAAGAAGAAAAAGAAGACGAGGAAGATGAAAATC
TGGATAATGATGATGATGAAACGAAATCTGACGATTTTCTTTCCGAAGAA
TTCGAGAACAGCGATTTAGAAACACCTCCTGTATAAGACCAATACATCTT
CATTCACCGAGTCATATTGGACTATTTGAAACAACGTGACGAAAAGCAAC
AAATCTTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAGT
GAATCCAATCCTGTCGAACCTGCGGCTGAAGGGCGGGAGTTGGGCGCACA
GGAACTTACTTGTGTGTTGATATTCTGGTCAATAAACTACAGACCGAAAA
CAATGTAGATGTTTATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCT
CCATGGTGCAGACTGAGGGCGAATCTCGATTACTCAGACATTTTCAATAC
ACAGCATGGCCTGACCACGGCGTACCTCGCTCATCTAAAGAAATGTTACA
GTTCGTGACGACCGTTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCA
TCTGTCATTGCTCGGTTACAAGCAACCACGAGCATACATAGCCACACAAG
GACCCCTCCCAAGTACCACAGACCACTTCTGGCAGATGGTCTGGGAACAA
AAATCTCGAATCATTGTCATGGTTACGCAATGCAATGAGAAGAATCGTGT
AAAATGTCATCAATATTGGCCTGCATCAGGTTCGACGCGATACGGAGAAA
TCGAAGTAACGCTTAAGCACGAAACAATATATCCAGAATGGACCGAACGG
GAATTTCTAATGACATTCGAGACGATTATACGCGAGTGAAACTATCGAGT
ATAGACGACGAACCTGGTTCGGACTATATCAACGCTAATTATATTCACTC
TATACGGGATGTCGGGAAATTTGAGAGGCATGAAGTTGCTGACATGGCAG
AAAATAACGGCAAAAACCGATACGTCAACGTCTTACCATACCTGTCTTCA
TCCGAGATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTT
CGTTTTGCCGAAGAATTTGAGAGGGCAGCAAGACAAGGACAGTATGGGTG
TGTCCCTCATGTCCACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAG
AAGAAATTCTCAGGACCAGATATTCTCACTGAGCGACGAAAAAGTCTGAA
AGGAATGACGAGCGGTGATCGTGCCACAAGAAGGTGTTCGTTCATCTGTC
GTCATCATCATCCTCACCGTCCTTCTCGTCTTCTTCATCTTTCTCACCAT
CATCATCACAATCATCGTCTGCCGTAAGAAACGATCACGAAAATATCTCA
GTATTCAGTTGGAAGTCTTCTTCACCAATGGAACATCTTTGACAACCCCC
TCCTCAAAACCCTGGTCTACTTTACAAAAAGGTTACAAGTCAACGGGCTC
ATGGTACAGAATTTTCATCAAGAAAGAAAAACACGACCGTTACCCTGCAC
TTGTCATGAAGCCCAAGCAACTTTCGAACGATCCACGTCGAAAAAGAAGA
AGTGCAGCCAAATTCTTGAACATCAAACTTGGCATCAGTAAAGACTGTAC
TAAAGTCGATCAAGAGATTTGTAATGGTCCTCTAACTCCCTCAACTAACT
ACAGAAGCTACTCGTCATATGAAGCTTCTTCGCAACCATCAAACGTTGAC
AGTTTTTTAACATTACAAACGACCAACTTTGACGCTTCTTCAATCTTACA
ACAATCAACAACATCAGAAAAGACAGCTTTAACGACTGAATCTGTGGTAA
CCTCTACCCTCCAGTTATCCTCCCAACCCTTCCATAGATCCTTTGATATT
TTTTCAAGCTCCCTGGAGCACACGTCAACTGTTGCTACAAATTATTTGGT
GACGCCCAACAATCTCGCAACATCGCAGTCAGACTCGCCAACATCCGCAA
AAGCTATGACCACTGATTCAAAGAGTTCGTCTCCTAAGAACATTCAACCA
AGCACATCTACGAGAGAAATAGTCTCATTGACAACCTCCATTATATCCCT
ACCACCATCAAGAAAACCCTCCACTACTCAACAACCAACCACAACCACAA
CGCAACCACCTTTGCCAGCATTTAAGCAAAATATTGATGATACCAGTATA
TTTGTTTTGCTACCTTTGTCTTATCCTGTCGACAGCTGGGAAGAGATCAC
TGTTTATGTCGTCATTCCTTCACTTGGGTATAACAGCAACAACGATACAG
AATGAATTTTCATCCACTTTTACATCCATCGAACTTGCTTCGATTTCTCC
ATCCGCCAGTTCGATGAAAACCAACACCCTAAATGAACCTTCCCGAACAC
CACCCACTCAAAGATGGTGATGCTTCTGCTTGCCATTTGGTTTTATCATT
ATTGAAAGAAGAAGAAAAAGAAGACGAGGAAGATGAAAATCTGGATAATG
ATGATGATGAAACGAAATCTGACGATTTTCTTTCCGAAGAATTCGAGAAC
AGCGATTTAGAAACACCTCCTGTATAAGACCAATACATCTTCATTCACCG
AGTCATATTGGACTATTTGAAACAACGTGACGAAAAGCAACAAATCTTTT
CCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAGTGAATCCAAT
CCTGTCGAACCTGCGGCTGAAGGGCGGGAGTTGGGCGCACAGGAACTTAC
TTGTGTGTTGATATTCTGGTCAATAAACTACAGACCGAAAACAATGTAGA
TGTTTATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCTCCATGGTGC
AGACTGAGGGCGAATCTCGATTACTCAGACATTTTCAATACACAGCATGG
CCTGACCACGGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGAC
GACCGTTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCATCTGTCATT
GCTCGGTTACAAGCAACCACGAGCATACATAGCCACACAAGGACCCCTCC
CAAGTACCACAGACCACTTCTGGCAGATGGTCTGGGAACAAAAATCTCGA
ATCATTGTCATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAATGTCA
TCAATATTGGCCTGCATCAGGTTCGACGCGATACGGAGAAATCGAAGTAA
CGCTTAAGCACGAAACAATATATCCAGAATGGACCGAACGGGAATTTCTA
ATGACATTCGAGACGATTATACGCGAGTGAAACTATCGAGTATAGACGAC
GAACCTGGTTCGGACTATATCAACGCTAATTATATTCACTCTATACGGGA
TGTCGGGAAATTTGAGAGGCATGAAGTTGCTGACATGGCAGAAAATAACG
GCAAAAACCGATACGTCAACGTCTTACCATACCTGTCTTCATCCGAGATT
TTCGTGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTTTTGCC
GAAGAATTTGAGAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCA
TGTCCACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTC
TCAGGACCAGATATTCTCACTGAGCGACGAAAAAGTCTGAAAGGAATGAC
GAGCGGTGATCGTGCCACAAGAAGGTGTTCGTTCATCTGTCGTCATCATC
ATCCTCACCGTCCTTCTCGTCTTCTTCATCTTTCTCACCATCATCATCAC
AATCATCGTCTGCCGTAAGAAACGATCACGAAAATATCTCAGTATTCAGT
TGGAAGTCTTCTTCACCAATGGAACATCTTTGACAACCCCCTCCTCAAAA
CCCTGGTCTACTTTACAAAAAGGTTACAAGTCAACGGGCTCATGGTACAG
AATTTTCATCAAGAAAGAAAAACACGACCGTTACCCTGCACTTGTCATGA
AGCCCAAGCAACTTTCGAACGATCCACGTCGAAAAAGAAGAAGTGCAGCC
AAATTCTTGAACATCAAACTTGGCATCAGTAAAGACTGTACTAAAGTCGA
TCAAGAGATTTGTAATGGTCCTCTAACTCCCTCAACTAACTACAGAAGCT
ACTCGTCATATGAAGCTTCTTCGCAACCATCAAACGTTGACAGTTTTTTA
ACATTACAAACGACCAACTTTGACGCTTCTTCAATCTTACAACAATCAAC
AACATCAGAAAAGACAGCTTTAACGACTGAATCTGTGGTAACCTCTACCC
TCCAGTTATCCTCCCAACCCTTCCATAGATCCTTTGATATTTTTTCAAGC
TCCCTGGAGCACACGTCAACTGTTGCTACAAATTATTTGGTGACGCCCAA
CAATCTCGCAACATCGCAGTCAGACTCGCCAACATCCGCAAAAGCTATGA
CCACTGATTCAAAGAGTTCGTCTCCTAAGAACATTCAACCAAGCACATCT
ACGAGAGAAATAGTCTCATTGACAACCTCCATTATATCCCTACCACCATC
AAGAAAACCCTCCACTACTCAACAACCAACCACAACCACAACGCAACCAC
CTTTGCCAGCATTTAAGCAAAATATTGATGATACCAGTATATTTGTTTTG
CTACCTTTGTCTTATCCTGTCGACAGCTGGGAAGAGATCACTGTTTATGT
CGTCATTCCTTCACTTGGGTATAACAGCAACAACGATACAGAATGAATTT
TCATCCACTTTTACATCCATCGAACTTGCTTCGATTTCTCCATCCGCCAG
TTCGATGAAAACCAACACCCTAAATGAACCTTCCCGAACACCACCCACTC
AAAGATGGTGATGCTTCTGCTTGCCATTTGGTTTTATCATTATTGAAAGA
AGAAGAAAAAGAAGACGAGGAAGATGAAAATCTGGATAATGATGATGATG
AAACGAAATCTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTA
GAAACACCTCCTGTATAAGACCAATACATCTTCATTCACCGAGTCATATT
GGACTATTTGAAACAACGTGACGAAAAGCAACAAATCTTTTCCGGATATT
CGACCTTAGAAATGCGAAGGAAAAGTAAAAGTGAATCCAATCCTGTCGAA
CCTGCGGCTGAAGGGCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTT
GATATTCTGGTCAATAAACTACAGACCGAAAACAATGTAGATGTTTATGG
TGTAGTGTGTTTAATGAGGACTCAACGATGCTCCATGGTGCAGACTGAGG
GCGAATCTCGATTACTCAGACATTTTCAATACACAGCATGGCCTGACCAC
GGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGACGACCGTTCG
GTTTCATCAACGGCCCGATGACGGCCCTGTCATCTGTCATTGCTCGGTTA
CAAGCAACCACGAGCATACATAGCCACACAAGGACCCCTCCCAAGTACCA
CAGACCACTTCTGGCAGATGGTCTGGGAACAAAAATCTCGAATCATTGTC
ATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAATGTCATCAATATTG
GCCTGCATCAGGTTCGACGCGATACGGAGAAATCGAAGTAACGCTTAAGC
ACGAAACAATATATCCAGAATGGACCGAACGGGAATTTCTAATGACATTC
GAGACGATTATACGCGAGTGAAACTATCGAGTATAGACGACGAACCTGGT
TCGGACTATATCAACGCTAATTATATTCACTCTATACGGGATGTCGGGAA
ATTTGAGAGGCATGAAGTTGCTGACATGGCAGAAAATAACGGCAAAAACC
GATACGTCAACGTCTTACCATACCTGTCTTCATCCGAGATTTTCGTGCAT
GGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAGAATTT
GAGAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTCCACCA
ACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGGACCA
GATATTCTCACTGAGCGACGAAAAAGTCTGAAAGGAATGACGAGCGGTGA
TCGTGCCACAAGAAGGTGTTCGTTCATCTGTCGTCATCATCATCCTCACC
GTCCTTCTCGTCTTCTTCATCTTTCTCACCATCATCATCACAATCATCGT
CTGCCGTAAGAAACGATCACGAAAATATCTCAGTATTCAGTTGGAAGTCT
TCTTCACCAATGGAACATCTTTGACAACCCCCTCCTCAAAACCCTGGTCT
ACTTTACAAAAAGGTTACAAGTCAACGGGCTCATGGTACAGAATTTTCAT
CAAGAAAGAAAAACACGACCGTTACCCTGCACTTGTCATGAAGCCCAAGC
AACTTTCGAACGATCCACGTCGAAAAAGAAGAAGTGCAGCCAAATTCTTG
AACATCAAACTTGGCATCAGTAAAGACTGTACTAAAGTCGATCAAGAGAT
TTGTAATGGTCCTCTAACTCCCTCAACTAACTACAGAAGCTACTCGTCAT
ATGAAGCTTCTTCGCAACCATCAAACGTTGACAGTTTTTTAACATTACAA
ACGACCAACTTTGACGCTTCTTCAATCTTACAACAATCAACAACATCAGA
AAAGACAGCTTTAACGACTGAATCTGTGGTAACCTCTACCCTCCAGTTAT
CCTCCCAACCCTTCCATAGATCCTTTGATATTTTTTCAAGCTCCCTGGAG
CACACGTCAACTGTTGCTACAAATTATTTGGTGACGCCCAACAATCTCGC
AACATCGCAGTCAGACTCGCCAACATCCGCAAAAGCTATGACCACTGATT
CAAAGAGTTCGTCTCCTAAGAACATTCAACCAAGCACATCTACGAGAGAA
ATAGTCTCATTGACAACCTCCATTATATCCCTACCACCATCAAGAAAACC
CTCCACTACTCAACAACCAACCACAACCACAACGCAACCACCTTTGCCAG
CATTTAAGCAAAATATTGATGATACCAGTATATTTGTTTTGCTACCTTTG
TCTTATCCTGTCGACAGCTGGGAAGAGATCACTGTTTATGTCGTCATTCC
TTCACTTGGGTATAACAGCAACAACGATACAGAATGAATTTTCATCCACT
TTTACATCCATCGAACTTGCTTCGATTTCTCCATCCGCCAGTTCGATGAA
AACCAACACCCTAAATGAACCTTCCCGAACACCACCCACTCAAAGATGGT
GATGCTTCTGCTTGCCATTTGGTTTTATCATTATTGAAAGAAGAAGAAAA
AGAAGACGAGGAAGATGAAAATCTGGATAATGATGATGATGAAACGAAAT
CTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTAGAAACACCT
CCTGTATAAGACCAATACATCTTCATTCACCGAGTCATATTGGACTATTT
GAAACAACGTGACGAAAAGCAACAAATCTTTTCCGGATATTCGACCTTAG
AAATGCGAAGGAAAAGTAAAAGTGAATCCAATCCTGTCGAACCTGCGGCT
GAAGGGCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATATTCTG
GTCAATAAACTACAGACCGAAAACAATGTAGATGTTTATGGTGTAGTGTG
TTTAATGAGGACTCAACGATGCTCCATGGTGCAGACTGAGGGCGAATCTC
GATTACTCAGACATTTTCAATACACAGCATGGCCTGACCACGGCGTACCT
CGCTCATCTAAAGAAATGTTACAGTTCGTGACGACCGTTCGGTTTCATCA
ACGGCCCGATGACGGCCCTGTCATCTGTCATTGCTCGGTTACAAGCAACC
ACGAGCATACATAGCCACACAAGGACCCCTCCCAAGTACCACAGACCACT
TCTGGCAGATGGTCTGGGAACAAAAATCTCGAATCATTGTCATGGTTACG
CAATGCAATGAGAAGAATCGTGTAAAATGTCATCAATATTGGCCTGCATC
AGGTTCGACGCGATACGGAGAAATCGAAGTAACGCTTAAGCACGAAACAA
TATATCCAGAATGGACCGAACGGGAATTTCTAATGACATTCGAGACGATT
ATACGCGAGTGAAACTATCGAGTATAGACGACGAACCTGGTTCGGACTAT
ATCAACGCTAATTATATTCACTCTATACGGGATGTCGGGAAATTTGAGAG
GCATGAAGTTGCTGACATGGCAGAAAATAACGGCAAAAACCGATACGTCA
ACGTCTTACCATACCTGTCTTCATCCGAGATTTTCGTGCATGGGTTGAAA
GAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGAGGGCA
GCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTCCACCAACTATCAGA
GGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGGACCAGATATTCTC
ACTGAGCGACGAAAAAGTCTGAAAGGAATGACGAGCGGTGATCGTGCCAC
AAGAAGGTGTTCGTTCATCTGTCGTCATCATCATCCTCACCGTCCTTCTC
GTCTTCTTCATCTTTCTCACCATCATCATCACAATCATCGTCTGCCGTAA
GAAACGATCACGAAAATATCTCAGTATTCAGTTGGAAGTCTTCTTCACCA
ATGGAACATCTTTGACAACCCCCTCCTCAAAACCCTGGTCTACTTTACAA
AAAGGTTACAAGTCAACGGGCTCATGGTACAGAATTTTCATCAAGAAAGA
AAAACACGACCGTTACCCTGCACTTGTCATGAAGCCCAAGCAACTTTCGA
ACGATCCACGTCGAAAAAGAAGAAGTGCAGCCAAATTCTTGAACATCAAA
CTTGGCATCAGTAAAGACTGTACTAAAGTCGATCAAGAGATTTGTAATGG
TCCTCTAACTCCCTCAACTAACTACAGAAGCTACTCGTCATATGAAGCTT
CTTCGCAACCATCAAACGTTGACAGTTTTTTAACATTACAAACGACCAAC
TTTGACGCTTCTTCAATCTTACAACAATCAACAACATCAGAAAAGACAGC
TTTAACGACTGAATCTGTGGTAACCTCTACCCTCCAGTTATCCTCCCAAC
CCTTCCATAGATCCTTTGATATTTTTTCAAGCTCCCTGGAGCACACGTCA
ACTGTTGCTACAAATTATTTGGTGACGCCCAACAATCTCGCAACATCGCA
GTCAGACTCGCCAACATCCGCAAAAGCTATGACCACTGATTCAAAGAGTT
CGTCTCCTAAGAACATTCAACCAAGCACATCTACGAGAGAAATAGTCTCA
TTGACAACCTCCATTATATCCCTACCACCATCAAGAAAACCCTCCACTAC
TCAACAACCAACCACAACCACAACGCAACCACCTTTGCCAGCATTTAAGC
AAAATATTGATGATACCAGTATATTTGTTTTGCTACCTTTGTCTTATCCT
GTCGACAGCTGGGAAGAGATCACTGTTTATGTCGTCATTCCTTCACTTGG
GTATAACAGCAACAACGATACAGAATGAATTTTCATCCACTTTTACATCC
ATCGAACTTGCTTCGATTTCTCCATCCGCCAGTTCGATGAAAACCAACAC
CCTAAATGAACCTTCCCGAACACCACCCACTCAAAGATGGTGATGCTTCT
GCTTGCCATTTGGTTTTATCATTATTGAAAGAAGAAGAAAAAGAAGACGA
GGAAGATGAAAATCTGGATAATGATGATGATGAAACGAAATCTGACGATT
TTCTTTCCGAAGAATTCGAGAACAGCGATTTAGAAACACCTCCTGTATAA
GACCAATACATCTTCATTCACCGAGTCATATTGGACTATTTGAAACAACG
TGACGAAAAGCAACAAATCTTTTCCGGATATTCGACCTTAGAAATGCGAA
GGAAAAGTAAAAGTGAATCCAATCCTGTCGAACCTGCGGCTGAAGGGCGG
GAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATATTCTGGTCAATAAA
CTACAGACCGAAAACAATGTAGATGTTTATGGTGTAGTGTGTTTAATGAG
GACTCAACGATGCTCCATGGTGCAGACTGAGGGCGAATCTCGATTACTCA
GACATTTTCAATACACAGCATGGCCTGACCACGGCGTACCTCGCTCATCT
AAAGAAATGTTACAGTTCGTGACGACCGTTCGGTTTCATCAACGGCCCGA
TGACGGCCCTGTCATCTGTCATTGCTCGGTTACAAGCAACCACGAGCATA
CATAGCCACACAAGGACCCCTCCCAAGTACCACAGACCACTTCTGGCAGA
TGGTCTGGGAACAAAAATCTCGAATCATTGTCATGGTTACGCAATGCAAT
GAGAAGAATCGTGTAAAATGTCATCAATATTGGCCTGCATCAGGTTCGAC
GCGATACGGAGAAATCGAAGTAACGCTTAAGCACGAAACAATATATCCAG
AATGGACCGAACGGGAATTTCTAATGACATTCGAGACGATTATACGCGAG
TGAAACTATCGAGTATAGACGACGAACCTGGTTCGGACTATATCAACGCT
AATTATATTCACTCTATACGGGATGTCGGGAAATTTGAGAGGCATGAAGT
TGCTGACATGGCAGAAAATAACGGCAAAAACCGATACGTCAACGTCTTAC
CATACCTGTCTTCATCCGAGATTTTCGTGCATGGGTTGAAAGAAGTGCAT
CGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGAGGGCAGCAAGACAA
GGACAGTATGGGTGTGTCCCTCATGTCCACCAACTATCAGAGGAATGGGG
CGAGCAGGTTGAAGAAGAAATTCTCAGGACCAGATATTCTCACTGAGCGA
CGAAAAAGTCTGAAAGGAATGACGAGCGGTGATCGTGCCACAAGAAGGTG
TTCGTTCATCTGTCGTCATCATCATCCTCACCGTCCTTCTCGTCTTCTTC
ATCTTTCTCACCATCATCATCACAATCATCGTCTGCCGTAAGAAACGATC
ACGAAAATATCTCAGTATTCAGTTGGAAGTCTTCTTCACCAATGGAACAT
CTTTGACAACCCCCTCCTCAAAACCCTGGTCTACTTTACAAAAAGGTTAC
AAGTCAACGGGCTCATGGTACAGAATTTTCATCAAGAAAGAAAAACACGA
CCGTTACCCTGCACTTGTCATGAAGCCCAAGCAACTTTCGAACGATCCAC
GTCGAAAAAGAAGAAGTGCAGCCAAATTCTTGAACATCAAACTTGGCATC
AGTAAAGACTGTACTAAAGTCGATCAAGAGATTTGTAATGGTCCTCTAAC
TCCCTCAACTAACTACAGAAGCTACTCGTCATATGAAGCTTCTTCGCAAC
CATCAAACGTTGACAGTTTTTTAACATTACAAACGACCAACTTTGACGCT
TCTTCAATCTTACAACAATCAACAACATCAGAAAAGACAGCTTTAACGAC
TGAATCTGTGGTAACCTCTACCCTCCAGTTATCCTCCCAACCCTTCCATA
GATCCTTTGATATTTTTTCAAGCTCCCTGGAGCACACGTCAACTGTTGCT
ACAAATTATTTGGTGACGCCCAACAATCTCGCAACATCGCAGTCAGACTC
GCCAACATCCGCAAAAGCTATGACCACTGATTCAAAGAGTTCGTCTCCTA
AGAACATTCAACCAAGCACATCTACGAGAGAAATAGTCTCATTGACAACC
TCCATTATATCCCTACCACCATCAAGAAAACCCTCCACTACTCAACAACC
AACCACAACCACAACGCAACCACCTTTGCCAGCATTTAAGCAAAATATTG
ATGATACCAGTATATTTGTTTTGCTACCTTTGTCTTATCCTGTCGACAGC
TGGGAAGAGATCACTGTTTATGTCGTCATTCCTTCACTTGGGTATAACAG
CAACAACGATACAGAATGAATTTTCATCCACTTTTACATCCATCGAACTT
GCTTCGATTTCTCCATCCGCCAGTTCGATGAAAACCAACACCCTAAATGA
ACCTTCCCGAACACCACCCACTCAAAGATGGTGATGCTTCTGCTTGCCAT
TTGGTTTTATCATTATTGAAAGAAGAAGAAAAAGAAGACGAGGAAGATGA
AAATCTGGATAATGATGATGATGAAACGAAATCTGACGATTTTCTTTCCG
AAGAATTCGAGAACAGCGATTTAGAAACACCTCCTGTATAAGACCAATAC
ATCTTCATTCACCGAGTCATATTGGACTATTTGAAACAACGTGACGAAAA
GCAACAAATCTTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTA
AAAGTGAATCCAATCCTGTCGAACCTGCGGCTGAAGGGCGGGAGTTGGGC
GCACAGGAACTTACTTGTGTGTTGATATTCTGGTCAATAAACTACAGACC
GAAAACAATGTAGATGTTTATGGTGTAGTGTGTTTAATGAGGACTCAACG
ATGCTCCATGGTGCAGACTGAGGGCGAATCTCGATTACTCAGACATTTTC
AATACACAGCATGGCCTGACCACGGCGTACCTCGCTCATCTAAAGAAATG
TTACAGTTCGTGACGACCGTTCGGTTTCATCAACGGCCCGATGACGGCCC
TGTCATCTGTCATTGCTCGGTTACAAGCAACCACGAGCATACATAGCCAC
ACAAGGACCCCTCCCAAGTACCACAGACCACTTCTGGCAGATGGTCTGGG
AACAAAAATCTCGAATCATTGTCATGGTTACGCAATGCAATGAGAAGAAT
CGTGTAAAATGTCATCAATATTGGCCTGCATCAGGTTCGACGCGATACGG
AGAAATCGAAGTAACGCTTAAGCACGAAACAATATATCCAGAATGGACCG
AACGGGAATTTCTAATGACATTCGAGACGATTATACGCGAGTGAAACTAT
CGAGTATAGACGACGAACCTGGTTCGGACTATATCAACGCTAATTATATT
CACTCTATACGGGATGTCGGGAAATTTGAGAGGCATGAAGTTGCTGACAT
GGCAGAAAATAACGGCAAAAACCGATACGTCAACGTCTTACCATACCTGT
CTTCATCCGAGATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGATAGTA
CCTTTCGTTTTGCCGAAGAATTTGAGAGGGCAGCAAGACAAGGACAGTAT
GGGTGTGTCCCTCATGTCCACCAACTATCAGAGGAATGGGGCGAGCAGGT
TGAAGAAGAAATTCTCAGGACCAGATATTCTCACTGAGCGACGAAAAAGT
CTGAAAGGAATGACGAGCGGTGATCGTGCCACAAGAAGGTGTTCGTTCAT
CTGTCGTCATCATCATCCTCACCGTCCTTCTCGTCTTCTTCATCTTTCTC
ACCATCATCATCACAATCATCGTCTGCCGTAAGAAACGATCACGAAAATA
TCTCAGTATTCAGTTGGAAGTCTTCTTCACCAATGGAACATCTTTGACAA
CCCCCTCCTCAAAACCCTGGTCTACTTTACAAAAAGGTTACAAGTCAACG
GGCTCATGGTACAGAATTTTCATCAAGAAAGAAAAACACGACCGTTACCC
TGCACTTGTCATGAAGCCCAAGCAACTTTCGAACGATCCACGTCGAAAAA
GAAGAAGTGCAGCCAAATTCTTGAACATCAAACTTGGCATCAGTAAAGAC
TGTACTAAAGTCGATCAAGAGATTTGTAATGGTCCTCTAACTCCCTCAAC
TAACTACAGAAGCTACTCGTCATATGAAGCTTCTTCGCAACCATCAAACG
TTGACAGTTTTTTAACATTACAAACGACCAACTTTGACGCTTCTTCAATC
TTACAACAATCAACAACATCAGAAAAGACAGCTTTAACGACTGAATCTGT
GGTAACCTCTACCCTCCAGTTATCCTCCCAACCCTTCCATAGATCCTTTG
ATATTTTTTCAAGCTCCCTGGAGCACACGTCAACTGTTGCTACAAATTAT
TTGGTGACGCCCAACAATCTCGCAACATCGCAGTCAGACTCGCCAACATC
CGCAAAAGCTATGACCACTGATTCAAAGAGTTCGTCTCCTAAGAACATTC
AACCAAGCACATCTACGAGAGAAATAGTCTCATTGACAACCTCCATTATA
TCCCTACCACCATCAAGAAAACCCTCCACTACTCAACAACCAACCACAAC
CACAACGCAACCACCTTTGCCAGCATTTAAGCAAAATATTGATGATACCA
GTATATTTGTTTTGCTACCTTTGTCTTATCCTGTCGACAGCTGGGAAGAG
ATCACTGTTTATGTCGTCATTCCTTCACTTGGGTATAACAGCAACAACGA
TACAGAATGAATTTTCATCCACTTTTACATCCATCGAACTTGCTTCGATT
TCTCCATCCGCCAGTTCGATGAAAACCAACACCCTAAATGAACCTTCCCG
AACACCACCCACTCAAAGATGGTGATGCTTCTGCTTGCCATTTGGTTTTA
TCATTATTGAAAGAAGAAGAAAAAGAAGACGAGGAAGATGAAAATCTGGA
TAATGATGATGATGAAACGAAATCTGACGATTTTCTTTCCGAAGAATTCG
AGAACAGCGATTTAGAAACACCTCCTGTATAAGACCAATACATCTTCATT
CACCGAGTCATATTGGACTATTTGAAACAACGTGACGAAAAGCAACAAAT
CTTTTCCGGATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAGTGAAT
CCAATCCTGTCGAACCTGCGGCTGAAGGGCGGGAGTTGGGCGCACAGGAA
CTTACTTGTGTGTTGATATTCTGGTCAATAAACTACAGACCGAAAACAAT
GTAGATGTTTATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCTCCAT
GGTGCAGACTGAGGGCGAATCTCGATTACTCAGACATTTTCAATACACAG
CATGGCCTGACCACGGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTC
GTGACGACCGTTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCATCTG
TCATTGCTCGGTTACAAGCAACCACGAGCATACATAGCCACACAAGGACC
CCTCCCAAGTACCACAGACCACTTCTGGCAGATGGTCTGGGAACAAAAAT
CTCGAATCATTGTCATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAA
TGTCATCAATATTGGCCTGCATCAGGTTCGACGCGATACGGAGAAATCGA
AGTAACGCTTAAGCACGAAACAATATATCCAGAATGGACCGAACGGGAAT
TTCTAATGACATTCGAGACGATTATACGCGAGTGAAACTATCGAGTATAG
ACGACGAACCTGGTTCGGACTATATCAACGCTAATTATATTCACTCTATA
CGGGATGTCGGGAAATTTGAGAGGCATGAAGTTGCTGACATGGCAGAAAA
TAACGGCAAAAACCGATACGTCAACGTCTTACCATACCTGTCTTCATCCG
AGATTTTCGTGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTT
TTGCCGAAGAATTTGAGAGGGCAGCAAGACAAGGACAGTATGGGTGTGTC
CCTCATGTCCACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGA
AATTCTCAGGACCAGATATTCTCACTGAGCGACGAAAAAGTCTGAAAGGA
ATGACGAGCGGTGATCGTGCCACAAGAAGGTGTTCGTTCATCTGTCGTCA
TCATCATCCTCACCGTCCTTCTCGTCTTCTTCATCTTTCTCACCATCATC
ATCACAATCATCGTCTGCCGTAAGAAACGATCACGAAAATATCTCAGTAT
TCAGTTGGAAGTCTTCTTCACCAATGGAACATCTTTGACAACCCCCTCCT
CAAAACCCTGGTCTACTTTACAAAAAGGTTACAAGTCAACGGGCTCATGG
TACAGAATTTTCATCAAGAAAGAAAAACACGACCGTTACCCTGCACTTGT
CATGAAGCCCAAGCAACTTTCGAACGATCCACGTCGAAAAAGAAGAAGTG
CAGCCAAATTCTTGAACATCAAACTTGGCATCAGTAAAGACTGTACTAAA
GTCGATCAAGAGATTTGTAATGGTCCTCTAACTCCCTCAACTAACTACAG
AAGCTACTCGTCATATGAAGCTTCTTCGCAACCATCAAACGTTGACAGTT
TTTTAACATTACAAACGACCAACTTTGACGCTTCTTCAATCTTACAACAA
TCAACAACATCAGAAAAGACAGCTTTAACGACTGAATCTGTGGTAACCTC
TACCCTCCAGTTATCCTCCCAACCCTTCCATAGATCCTTTGATATTTTTT
CAAGCTCCCTGGAGCACACGTCAACTGTTGCTACAAATTATTTGGTGACG
CCCAACAATCTCGCAACATCGCAGTCAGACTCGCCAACATCCGCAAAAGC
TATGACCACTGATTCAAAGAGTTCGTCTCCTAAGAACATTCAACCAAGCA
CATCTACGAGAGAAATAGTCTCATTGACAACCTCCATTATATCCCTACCA
CCATCAAGAAAACCCTCCACTACTCAACAACCAACCACAACCACAACGCA
ACCACCTTTGCCAGCATTTAAGCAAAATATTGATGATACCAGTATATTTG
TTTTGCTACCTTTGTCTTATCCTGTCGACAGCTGGGAAGAGATCACTGTT
TATGTCGTCATTCCTTCACTTGGGTATAACAGCAACAACGATACAGAATG
AATTTTCATCCACTTTTACATCCATCGAACTTGCTTCGATTTCTCCATCC
GCCAGTTCGATGAAAACCAACACCCTAAATGAACCTTCCCGAACACCACC
CACTCAAAGATGGTGATGCTTCTGCTTGCCATTTGGTTTTATCATTATTG
AAAGAAGAAGAAAAAGAAGACGAGGAAGATGAAAATCTGGATAATGATGA
TGATGAAACGAAATCTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCG
ATTTAGAAACACCTCCTGTATAAGACCAATACATCTTCATTCACCGAGTC
ATATTGGACTATTTGAAACAACGTGACGAAAAGCAACAAATCTTTTCCGG
ATATTCGACCTTAGAAATGCGAAGGAAAAGTAAAAGTGAATCCAATCCTG
TCGAACCTGCGGCTGAAGGGCGGGAGTTGGGCGCACAGGAACTTACTTGT
GTGTTGATATTCTGGTCAATAAACTACAGACCGAAAACAATGTAGATGTT
TATGGTGTAGTGTGTTTAATGAGGACTCAACGATGCTCCATGGTGCAGAC
TGAGGGCGAATCTCGATTACTCAGACATTTTCAATACACAGCATGGCCTG
ACCACGGCGTACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGACGACC
GTTCGGTTTCATCAACGGCCCGATGACGGCCCTGTCATCTGTCATTGCTC
GGTTACAAGCAACCACGAGCATACATAGCCACACAAGGACCCCTCCCAAG
TACCACAGACCACTTCTGGCAGATGGTCTGGGAACAAAAATCTCGAATCA
TTGTCATGGTTACGCAATGCAATGAGAAGAATCGTGTAAAATGTCATCAA
TATTGGCCTGCATCAGGTTCGACGCGATACGGAGAAATCGAAGTAACGCT
TAAGCACGAAACAATATATCCAGAATGGACCGAACGGGAATTTCTAATGA
CATTCGAGACGATTATACGCGAGTGAAACTATCGAGTATAGACGACGAAC
CTGGTTCGGACTATATCAACGCTAATTATATTCACTCTATACGGGATGTC
GGGAAATTTGAGAGGCATGAAGTTGCTGACATGGCAGAAAATAACGGCAA
AAACCGATACGTCAACGTCTTACCATACCTGTCTTCATCCGAGATTTTCG
TGCATGGGTTGAAAGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAG
AATTTGAGAGGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTC
CACCAACTATCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAG
GACCAGATATTCTCACTGAGCGACGAAAAAGTCTGAAAGGAATGACGAGC
GGTGATCGTGCCACAAGAAGGTGTTCGTTCATCTGTCGTCATCATCATCC
TCACCGTCCTTCTCGTCTTCTTCATCTTTCTCACCATCATCATCACAATC
ATCGTCTGCCGTAAGAAACGATCACGAAAATATCTCAGTATTCAGTTGGA
AGTCTTCTTCACCAATGGAACATCTTTGACAACCCCCTCCTCAAAACCCT
GGTCTACTTTACAAAAAGGTTACAAGTCAACGGGCTCATGGTACAGAATT
TTCATCAAGAAAGAAAAACACGACCGTTACCCTGCACTTGTCATGAAGCC
CAAGCAACTTTCGAACGATCCACGTCGAAAAAGAAGAAGTGCAGCCAAAT
TCTTGAACATCAAACTTGGCATCAGTAAAGACTGTACTAAAGTCGATCAA
GAGATTTGTAATGGTCCTCTAACTCCCTCAACTAACTACAGAAGCTACTC
GTCATATGAAGCTTCTTCGCAACCATCAAACGTTGACAGTTTTTTAACAT
TACAAACGACCAACTTTGACGCTTCTTCAATCTTACAACAATCAACAACA
TCAGAAAAGACAGCTTTAACGACTGAATCTGTGGTAACCTCTACCCTCCA
GTTATCCTCCCAACCCTTCCATAGATCCTTTGATATTTTTTCAAGCTCCC
TGGAGCACACGTCAACTGTTGCTACAAATTATTTGGTGACGCCCAACAAT
CTCGCAACATCGCAGTCAGACTCGCCAACATCCGCAAAAGCTATGACCAC
TGATTCAAAGAGTTCGTCTCCTAAGAACATTCAACCAAGCACATCTACGA
GAGAAATAGTCTCATTGACAACCTCCATTATATCCCTACCACCATCAAGA
AAACCCTCCACTACTCAACAACCAACCACAACCACAACGCAACCACCTTT
GCCAGCATTTAAGCAAAATATTGATGATACCAGTATATTTGTTTTGCTAC
CTTTGTCTTATCCTGTCGACAGCTGGGAAGAGATCACTGTTTATGTCGTC
ATTCCTTCACTTGGGTATAACAGCAACAACGATACAGAATGAATTTTCAT
CCACTTTTACATCCATCGAACTTGCTTCGATTTCTCCATCCGCCAGTTCG
ATGAAAACCAACACCCTAAATGAACCTTCCCGAACACCACCCACTCAAAG
ATGGTGATGCTTCTGCTTGCCATTTGGTTTTATCATTATTGAAAGAAGAA
GAAAAAGAAGACGAGGAAGATGAAAATCTGGATAATGATGATGATGAAAC
GAAATCTGACGATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTAGAAA
CACCTCCTGTATAAGACCAATACATCTTCATTCACCGAGTCATATTGGAC
TATTTGAAACAACGTGACGAAAAGCAACAAATCTTTTCCGGATATTCGAC
CTTAGAAATGCGAAGGAAAAGTAAAAGTGAATCCAATCCTGTCGAACCTG
CGGCTGAAGGGCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATA
TTCTGGTCAATAAACTACAGACCGAAAACAATGTAGATGTTTATGGTGTA
GTGTGTTTAATGAGGACTCAACGATGCTCCATGGTGCAGACTGAGGGCGA
ATCTCGATTACTCAGACATTTTCAATACACAGCATGGCCTGACCACGGCG
TACCTCGCTCATCTAAAGAAATGTTACAGTTCGTGACGACCGTTCGGTTT
CATCAACGGCCCGATGACGGCCCTGTCATCTGTCATTGCTCGGTTACAAG
CAACCACGAGCATACATAGCCACACAAGGACCCCTCCCAAGTACCACAGA
CCACTTCTGGCAGATGGTCTGGGAACAAAAATCTCGAATCATTGTCATGG
TTACGCAATGCAATGAGAAGAATCGTGTAAAATGTCATCAATATTGGCCT
GCATCAGGTTCGACGCGATACGGAGAAATCGAAGTAACGCTTAAGCACGA
AACAATATATCCAGAATGGACCGAACGGGAATTTCTAATGACATTCGAGA
CGATTATACGCGAGTGAAACTATCGAGTATAGACGACGAACCTGGTTCGG
ACTATATCAACGCTAATTATATTCACTCTATACGGGATGTCGGGAAATTT
GAGAGGCATGAAGTTGCTGACATGGCAGAAAATAACGGCAAAAACCGATA
CGTCAACGTCTTACCATACCTGTCTTCATCCGAGATTTTCGTGCATGGGT
TGAAAGAAGTGCATCGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGA
GGGCAGCAAGACAAGGACAGTATGGGTGTGTCCCTCATGTCCACCAACTA
TCAGAGGAATGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGGACCAGATA
TTCTCACTGAGCGACGAAAAAGTCTGAAAGGAATGACGAGCGGTGATCGT
GCCACAAGAAGGTGTTCGTTCATCTGTCGTCATCATCATCCTCACCGTCC
TTCTCGTCTTCTTCATCTTTCTCACCATCATCATCACAATCATCGTCTGC
CGTAAGAAACGATCACGAAAATATCTCAGTATTCAGTTGGAAGTCTTCTT
CACCAATGGAACATCTTTGACAACCCCCTCCTCAAAACCCTGGTCTACTT
TACAAAAAGGTTACAAGTCAACGGGCTCATGGTACAGAATTTTCATCAAG
AAAGAAAAACACGACCGTTACCCTGCACTTGTCATGAAGCCCAAGCAACT
TTCGAACGATCCACGTCGAAAAAGAAGAAGTGCAGCCAAATTCTTGAACA
TCAAACTTGGCATCAGTAAAGACTGTACTAAAGTCGATCAAGAGATTTGT
AATGGTCCTCTAACTCCCTCAACTAACTACAGAAGCTACTCGTCATATGA
AGCTTCTTCGCAACCATCAAACGTTGACAGTTTTTTAACATTACAAACGA
CCAACTTTGACGCTTCTTCAATCTTACAACAATCAACAACATCAGAAAAG
ACAGCTTTAACGACTGAATCTGTGGTAACCTCTACCCTCCAGTTATCCTC
CCAACCCTTCCATAGATCCTTTGATATTTTTTCAAGCTCCCTGGAGCACA
CGTCAACTGTTGCTACAAATTATTTGGTGACGCCCAACAATCTCGCAACA
TCGCAGTCAGACTCGCCAACATCCGCAAAAGCTATGACCACTGATTCAAA
GAGTTCGTCTCCTAAGAACATTCAACCAAGCACATCTACGAGAGAAATAG
TCTCATTGACAACCTCCATTATATCCCTACCACCATCAAGAAAACCCTCC
ACTACTCAACAACCAACCACAACCACAACGCAACCACCTTTGCCAGCATT
TAAGCAAAATATTGATGATACCAGTATATTTGTTTTGCTACCTTTGTCTT
ATCCTGTCGACAGCTGGGAAGAGATCACTGTTTATGTCGTCATTCCTTCA
CTTGGGTATAACAGCAACAACGATACAGAATGAATTTTCATCCACTTTTA
CATCCATCGAACTTGCTTCGATTTCTCCATCCGCCAGTTCGATGAAAACC
AACACCCTAAATGAACCTTCCCGAACACCACCCACTCAAAGATGGTGATG
CTTCTGCTTGCCATTTGGTTTTATCATTATTGAAAGAAGAAGAAAAAGAA
GACGAGGAAGATGAAAATCTGGATAATGATGATGATGAAACGAAATCTGA
CGATTTTCTTTCCGAAGAATTCGAGAACAGCGATTTAGAAACACCTCCTG
TATAAGACCAATACATCTTCATTCACCGAGTCATATTGGACTATTTGAAA
CAACGTGACGAAAAGCAACAAATCTTTTCCGGATATTCGACCTTAGAAAT
GCGAAGGAAAAGTAAAAGTGAATCCAATCCTGTCGAACCTGCGGCTGAAG
GGCGGGAGTTGGGCGCACAGGAACTTACTTGTGTGTTGATATTCTGGTCA
ATAAACTACAGACCGAAAACAATGTAGATGTTTATGGTGTAGTGTGTTTA
ATGAGGACTCAACGATGCTCCATGGTGCAGACTGAGGGCGAATCTCGATT
ACTCAGACATTTTCAATACACAGCATGGCCTGACCACGGCGTACCTCGCT
CATCTAAAGAAATGTTACAGTTCGTGACGACCGTTCGGTTTCATCAACGG
CCCGATGACGGCCCTGTCATCTGTCATTGCTCGGTTACAAGCAACCACGA
GCATACATAGCCACACAAGGACCCCTCCCAAGTACCACAGACCACTTCTG
GCAGATGGTCTGGGAACAAAAATCTCGAATCATTGTCATGGTTACGCAAT
GCAATGAGAAGAATCGTGTAAAATGTCATCAATATTGGCCTGCATCAGGT
TCGACGCGATACGGAGAAATCGAAGTAACGCTTAAGCACGAAACAATATA
TCCAGAATGGACCGAACGGGAATTTCTAATGACATTCGAGACGATTATAC
GCGAGTGAAACTATCGAGTATAGACGACGAACCTGGTTCGGACTATATCA
ACGCTAATTATATTCACTCTATACGGGATGTCGGGAAATTTGAGAGGCAT
GAAGTTGCTGACATGGCAGAAAATAACGGCAAAAACCGATACGTCAACGT
CTTACCATACCTGTCTTCATCCGAGATTTTCGTGCATGGGTTGAAAGAAG
TGCATCGGATAGTACCTTTCGTTTTGCCGAAGAATTTGAGAGGGCAGCAA
GACAAGGACAGTATGGGTGTGTCCCTCATGTCCACCAACTATCAGAGGAA
TGGGGCGAGCAGGTTGAAGAAGAAATTCTCAGGACCAGATATTCTCACTG
AGCGACGAAAAAGTCTGAAAGGAATGACGAGCGGTGATCGTGCCACAAGA
AGGTGTTCGTTCATCTGTCGTCATCATCATCCTCACCGTCCTTCTCGTCT
TCTTCATCTTTCTCACCATCATCATCACAATCATCGTCTGCCGTAAGAAA
CGATCACGAAAATATCTCAGTATTCAGTTGGAAGTCTTCTTCACCAATGG
AACATCTTTGACAACCCCCTCCTCAAAACCCTGGTCTACTTTACAAAAAG
GTTACAAGTCAACGGGCTCATGGTACAGAATTTTCATCAAGAAAGAAAAA
CACGACCGTTACCCTGCACTTGTCATGAAGCCCAAGCAACTTTCGAACGA
TCCACGTCGAAAAAGAAGAAGTGCAGCCAAATTCTTGAACATCAAACTTG
GCATCAGTAAAGACTGTACTAAAGTCGATCAAGAGATTTGTAATGGTCCT
CTAACTCCCTCAACTAACTACAGAAGCTACTCGTCATATGAAGCTTCTTC
GCAACCATCAAACGTTGACAGTTTTTTAACATTACAAACGACCAACTTTG
ACGCTTCTTCAATCTTACAACAATCAACAACATCAGAAAAGACAGCTTTA
ACGACTGAATCTGTGGTAACCTCTACCCTCCAGTTATCCTCCCAACCCTT
CCATAGATCCTTTGATATTTTTTCAAGCTCCCTGGAGCACACGTCAACTG
TTGCTACAAATTATTTGGTGACGCCCAACAATCTCGCAACATCGCAGTCA
GACTCGCCAACATCCGCAAAAGCTATGACCACTGATTCAAAGAGTTCGTC
TCCTAAGAACATTCAACCAAGCACATCTACGAGAGAAATAGTCTCATTGA
CAACCTCCATTATATCCCTACCACCATCAAGAAAACCCTCCACTACTCAA
CAACCAACCACAACCACAACGCAACCACCTTTGCCAGCATTTAAGCAAAA
TATTGATGATACCAGTATATTTGTTTTGCTACCTTTGTCTTATCCTGTCG
ACAGCTGGGAAGAGATCACTGTTTATGTCGTCATTCCTTCACTTGGGTAT
AACAGCAACAACGATACAGAATGAATTTTCATCCACTTTTACATCCATCG
AACTTGCTTCGATTTCTCCATCCGCCAGTTCGATGAAAACCAACACCCTA
AATGAACCTTCCCGAACACCACCCACTCAAAGATGGTGATGCTTCTGCTT
GCCATTTGGTTTTAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000611XLOC_000611Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001087-exon-sc0000007-1575043694:73129..73166TCONS_00001087-exon-sc0000007-1575043694:73129..73166Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:72510..72542TCONS_00001087-exon-sc0000007-1575043694:72510..72542Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:72057..72193TCONS_00001087-exon-sc0000007-1575043694:72057..72193Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:70900..71471TCONS_00001087-exon-sc0000007-1575043694:70900..71471Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:70487..70709TCONS_00001087-exon-sc0000007-1575043694:70487..70709Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:69663..69742TCONS_00001087-exon-sc0000007-1575043694:69663..69742Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:69103..69241TCONS_00001087-exon-sc0000007-1575043694:69103..69241Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:65140..65280TCONS_00001087-exon-sc0000007-1575043694:65140..65280Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:63521..63602TCONS_00001087-exon-sc0000007-1575043694:63521..63602Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:63149..63239TCONS_00001087-exon-sc0000007-1575043694:63149..63239Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:62896..62972TCONS_00001087-exon-sc0000007-1575043694:62896..62972Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:62500..62757TCONS_00001087-exon-sc0000007-1575043694:62500..62757Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:62216..62361TCONS_00001087-exon-sc0000007-1575043694:62216..62361Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:61482..61617TCONS_00001087-exon-sc0000007-1575043694:61482..61617Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:61212..61356TCONS_00001087-exon-sc0000007-1575043694:61212..61356Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1575043694:60040..60629TCONS_00001087-exon-sc0000007-1575043694:60040..60629Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:73129..73166TCONS_00001087-exon-sc0000007-1510915933:73129..73166Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:72510..72542TCONS_00001087-exon-sc0000007-1510915933:72510..72542Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:72057..72193TCONS_00001087-exon-sc0000007-1510915933:72057..72193Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:70900..71471TCONS_00001087-exon-sc0000007-1510915933:70900..71471Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:70487..70709TCONS_00001087-exon-sc0000007-1510915933:70487..70709Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:69663..69742TCONS_00001087-exon-sc0000007-1510915933:69663..69742Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:69103..69241TCONS_00001087-exon-sc0000007-1510915933:69103..69241Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:65140..65280TCONS_00001087-exon-sc0000007-1510915933:65140..65280Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:63521..63602TCONS_00001087-exon-sc0000007-1510915933:63521..63602Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:63149..63239TCONS_00001087-exon-sc0000007-1510915933:63149..63239Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:62896..62972TCONS_00001087-exon-sc0000007-1510915933:62896..62972Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:62500..62757TCONS_00001087-exon-sc0000007-1510915933:62500..62757Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:62216..62361TCONS_00001087-exon-sc0000007-1510915933:62216..62361Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:61482..61617TCONS_00001087-exon-sc0000007-1510915933:61482..61617Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:61212..61356TCONS_00001087-exon-sc0000007-1510915933:61212..61356Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1510915933:60040..60629TCONS_00001087-exon-sc0000007-1510915933:60040..60629Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:73129..73166TCONS_00001087-exon-sc0000007-1491911889:73129..73166Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:72510..72542TCONS_00001087-exon-sc0000007-1491911889:72510..72542Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:72057..72193TCONS_00001087-exon-sc0000007-1491911889:72057..72193Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:70900..71471TCONS_00001087-exon-sc0000007-1491911889:70900..71471Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:70487..70709TCONS_00001087-exon-sc0000007-1491911889:70487..70709Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:69663..69742TCONS_00001087-exon-sc0000007-1491911889:69663..69742Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:69103..69241TCONS_00001087-exon-sc0000007-1491911889:69103..69241Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:65140..65280TCONS_00001087-exon-sc0000007-1491911889:65140..65280Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:63521..63602TCONS_00001087-exon-sc0000007-1491911889:63521..63602Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:63149..63239TCONS_00001087-exon-sc0000007-1491911889:63149..63239Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:62896..62972TCONS_00001087-exon-sc0000007-1491911889:62896..62972Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:62500..62757TCONS_00001087-exon-sc0000007-1491911889:62500..62757Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:62216..62361TCONS_00001087-exon-sc0000007-1491911889:62216..62361Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:61482..61617TCONS_00001087-exon-sc0000007-1491911889:61482..61617Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:61212..61356TCONS_00001087-exon-sc0000007-1491911889:61212..61356Clytia hemisphaericaexon
TCONS_00001087-exon-sc0000007-1491911889:60040..60629TCONS_00001087-exon-sc0000007-1491911889:60040..60629Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001087-proteinTCONS_00001087-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:60040..73166 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.129334 0.00866324 0.00303882 2.25443 1.30145 3.31936 2.53504 1.63544 2.24144 1.28927 1.67371 0.76667 0.553925 0.0726328 1.05995 0.808049 3.6014 4.6129e-06 0.725846 0.159052 1.25346 5.66549e-06 0.0161587 0.479184 0.185457 1.73919e-09 0.000981417 0.336241 0.00154995
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: Biological Process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
Vocabulary: Molecular Function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016311 dephosphorylation
biological_process GO:0006470 protein dephosphorylation
molecular_function GO:0016791 phosphatase activity
molecular_function GO:0004725 protein tyrosine phosphatase activity
Blast
BLAST of TCONS_00001087 vs. Swiss-Prot (Human)
Match: PTPRB (Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens GN=PTPRB PE=1 SV=3)

HSP 1 Score: 315.079 bits (806), Expect = 3.628e-89
Identity = 182/456 (39.91%), Postives = 261/456 (57.24%), Query Frame = 3
Query:  900 SAAKFLNIKLG-----ISKDCTKVDQEICNGPLTPSTNYSIQLEVF----------FTNGTSLTTPSSKPWSTLQKAVIVPQEGVRSSXXXXXXXXXXXXXXXXXXXXXXXXCRKKRSRKYLRGQQDKDSMGVSLMSTNYQRNGASRLKKKFSGPDILTERRKSLKGMTRPVFIRDFRAWVERSASDSTFRFAEEFESIRDVGKFERHEVADMAENNGKNRYVNVLPYDYTRVKLSSIDDEPGSDYINANYIHGYKQPRAYIATQGPLPSTTDHFWQMVWEQKSRIIVMVTQCNEKNRVKCHQYWPAS-GSTRYGEIEVTLKHETIYPEWTEREFLMTFEGE---SRLLRHFQYTAWPDHGVPRSSKEMLQFVTTVR--FHQRPDDGPVICHCSAGVGRTGTYLCVDILVNKLQTENNVDVYGVVCLMRTQRCSMVQTEDQYIFIHRVILDYLKQR 2204
            S +K  NIKLG     +   C    Q+ C+GPL P T Y I +  F          FT      T  S P +T  + +    EGV + + +I + V +V  +          CR+K S       +++ S  +S+           R  +  S    L   +K  +  + P+ I  F     +  +DS +  ++E+E ++DVG+ +  ++A + EN GKNRY N+LPYD TRVKLS++DD+P SDYINA+YI G    R YI TQGPLP T D FW+MVWEQ    IVMVTQC EK RVKC  YWPA   S  YG++ + +  E++ PEWT REF +  E +    RL+RHF YT WPDHGVP +++ ++QFV TVR   ++ P  GP + HCSAGVGRTGT++ +D ++ +L ++++VD+YG V  +R  R  MVQTE QY+++H+ + D L+ R
Sbjct: 1539 SNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPITTESEPLFGAIEGVSAGLFLIGMLVAVVALLI---------CRQKVSHG-----RERPSARLSI-----------RRDRPLSVH--LNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRAR 1967          
The following BLAST results are available for this feature:
BLAST of TCONS_00001087 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PTPRB3.628e-8939.91Receptor-type tyrosine-protein phosphatase beta OS... [more]
back to top