Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001087-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001087-protein
Unique NameTCONS_00001087-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length796

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001087-protein ID=TCONS_00001087-protein|Name=TCONS_00001087-protein|organism=Clytia hemisphaerica|type=polypeptide|length=796bp
MVMLLLAIWFYGITATTIQNEFSSTFTSIELASISPSASSMKTNTLNEPS
RTPPTQRSYSSYEASSQPSNVDSFLTLQTTNFDASSILQQSTTSEKTALT
TESVVTSTLQLSSQPFHRSFDIFSSSLEHTSTVATNYLVTPNNLATSQSD
SPTSAKAMTTDSKSSSPKNIQPSTSTREIVSLTTSIISLPPSRKPSTTQQ
PTTTTTQPPLPAFKQNIDDTSIFVLLPLSYPVDSWEEITVYVVIPSLGYK
STGSWYRIFIKKEKHDRYPALVMKPKQLSNDPRRKRRSAAKFLNIKLGIS
KDCTKVDQEICNGPLTPSTNYSIQLEVFFTNGTSLTTPSSKPWSTLQKAV
IVPQEGVRSSVVIIILTVLLVFFIFLTIIITIIVCRKKRSRKYLRGQQDK
DSMGVSLMSTNYQRNGASRLKKKFSGPDILTERRKSLKGMTRPVFIRDFR
AWVERSASDSTFRFAEEFESIRDVGKFERHEVADMAENNGKNRYVNVLPY
DYTRVKLSSIDDEPGSDYINANYIHGYKQPRAYIATQGPLPSTTDHFWQM
VWEQKSRIIVMVTQCNEKNRVKCHQYWPASGSTRYGEIEVTLKHETIYPE
WTEREFLMTFEGESRLLRHFQYTAWPDHGVPRSSKEMLQFVTTVRFHQRP
DDGPVICHCSAGVGRTGTYLCVDILVNKLQTENNVDVYGVVCLMRTQRCS
MVQTEDQYIFIHRVILDYLKQRDEKQQIFSGYSTLEMRRKSKSESNPVEP
AAEALLKEEEKEDEEDENLDNDDDETKSDDFLSEEFENSDLETPPV
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000611XLOC_000611Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001087TCONS_00001087Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: Biological Process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
Vocabulary: Molecular Function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016311 dephosphorylation
biological_process GO:0006470 protein dephosphorylation
molecular_function GO:0016791 phosphatase activity
molecular_function GO:0004725 protein tyrosine phosphatase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 533..553
score: 64.4
coord: 654..672
score: 60.87
coord: 517..524
score: 79.71
coord: 685..700
score: 39.3
coord: 615..632
score: 52.58
coord: 701..711
score: 68.07
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 463..720
e-value: 6.1E-131
score: 451.0
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 488..716
e-value: 9.9E-84
score: 280.5
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 464..718
score: 57.909
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 616..717
e-value: 4.5E-37
score: 139.2
IPR029021Protein-tyrosine phosphatase-likeGENE3D3.90.190.10coord: 437..726
e-value: 1.1E-113
score: 378.9
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILY52799(Phosphotyrosine protein) phosphatases IIcoord: 444..720
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 739..796
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 39..66
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 188..212
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 144..176
NoneNo IPR availableCDDcd00047PTPccoord: 490..717
e-value: 4.60193E-121
score: 365.37
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 635..709
score: 20.051

Blast
BLAST of TCONS_00001087-protein vs. Swiss-Prot (Human)
Match: PTPRB (Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens GN=PTPRB PE=1 SV=3)

HSP 1 Score: 337.035 bits (863), Expect = 8.599e-99
Identity = 181/456 (39.69%), Postives = 263/456 (57.68%), Query Frame = 0
Query:  288 SAAKFLNIKLG-----ISKDCTKVDQEICNGPLTPSTNYSIQLEVF----------FTNGTSLTTPSSKPWSTLQKAVIVPQEGVRSSVVIIILTVLLVFFIFLTIIITIIVCRKKRSRKYLRGQQDKDSMGVSLMSTNYQRNGASRLKKKFSGPDILTERRKSLKGMTRPVFIRDFRAWVERSASDSTFRFAEEFESIRDVGKFERHEVADMAENNGKNRYVNVLPYDYTRVKLSSIDDEPGSDYINANYIHGYKQPRAYIATQGPLPSTTDHFWQMVWEQKSRIIVMVTQCNEKNRVKCHQYWPAS-GSTRYGEIEVTLKHETIYPEWTEREFLMTFEGE---SRLLRHFQYTAWPDHGVPRSSKEMLQFVTTVR--FHQRPDDGPVICHCSAGVGRTGTYLCVDILVNKLQTENNVDVYGVVCLMRTQRCSMVQTEDQYIFIHRVILDYLKQR 722
            S +K  NIKLG     +   C    Q+ C+GPL P T Y I +  F          FT      T  S P +T  + +    EGV + + +I +         L  ++ +++CR+K S       +++ S  +S+           R  +  S    L   +K  +  + P+ I  F     +  +DS +  ++E+E ++DVG+ +  ++A + EN GKNRY N+LPYD TRVKLS++DD+P SDYINA+YI G    R YI TQGPLP T D FW+MVWEQ    IVMVTQC EK RVKC  YWPA   S  YG++ + +  E++ PEWT REF +  E +    RL+RHF YT WPDHGVP +++ ++QFV TVR   ++ P  GP + HCSAGVGRTGT++ +D ++ +L ++++VD+YG V  +R  R  MVQTE QY+++H+ + D L+ R
Sbjct: 1539 SNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPITTESEPLFGAIEGVSAGLFLIGM---------LVAVVALLICRQKVSHG-----RERPSARLSI-----------RRDRPLSVH--LNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRAR 1967          
The following BLAST results are available for this feature:
BLAST of TCONS_00001087-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PTPRB8.599e-9939.69Receptor-type tyrosine-protein phosphatase beta OS... [more]
back to top