Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001073 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001073
Unique NameTCONS_00001073
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1628

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001073 ID=TCONS_00001073|Name=TCONS_00001073|organism=Clytia hemisphaerica|type=transcript|length=1628bp
CTTTCATTTGCGTCTTGGTCTTGGTGGGAGCACATCATCCAACATCCAAA
AGCATTttacaaaaatctcaaaatttcctTGCCTTTTAATTCTTCAAAAA
TTCCTCCCAACAAATCTTTGAGGAGTGCGCGGCAGTTCGCAAGGAGTGGA
CTTGGCCTGAAAGCAACAAAGCTTCTGCCACCTGTTGAACTCTCCTGGGA
CAAAGCCTACGCTGGAATTAGCTGATATTTGCTAAGCTAACACAAGAACT
ACTGAGCCAAAATGAAGCAAGTAAAGCTACATACAGGATCAGTAATTGAC
GTCTGTGATGACGAATTGAATCTGACAGATTACATTCACACCAAACTGAA
CTCAGCAGGGCGAGAAGATAAAGATGATCCCTTTTTTGTCTGTGATCTTG
GTGATATTGTCAAGAAATGGAGACGATTCCAAAGAGTACTTCCAATGGTC
AAACcttattttgCCATGAAGTGCAACCCAGACCTAGAGATCATTAAACT
CATGATCAAATTAGGTTCAAACTTTGATTGTGCAAGCAAAATGGAGATCA
AGACCTTACTTGATTTAGGGGTGGCTGCTGATCGAATCATCTTTGCAAAC
CCCTGCAAACAAACATCATTTATCAAataTTCAGCAGCAAATAATGTCAA
ATTGATGACTTTTGATAATGAAATGGAACTGCGAAAAGTTAAGCAATTTT
ATCCTGATGCAGAGCTTGTTCTTCGAATCAGAGTTGATGATTCAAAATCA
CTTTGCAAGTTTGGAGTTAAGTTTGGGGCAGAACCTTGCAATACAATGCA
CCTTTTACAAACAGCCAAACAGCTTCACTTGAATGTTGTTGGTGTTAGct
TTCATGTTGGAAGTGGTTGTTATGACGCCTCTTTGTTTTATGATGCCGTC
AAGTTGTCAAGGAAAGTCTTTGATGAAGGACGTGAAGTTGGATATCAATT
TTCTATGTTAGATGTTGGTGGTGGCTTCCCTGGAGATGATTTAGCTAAAG
TCTCATTTGAAGAGACTGCTGAAAAGTTGAAGGATGGTTTCAATGCGTTT
TTCCCACCAGAAATGAATGTGAAATTTATTGCAGAGCCTGGTCGATATTT
TGTGGCATCTGCATGTACAAACGTCTGCAACATCACTTCTGTTCGGAAGT
TAGAATCAGGTAATGAAAGCAATTTCATGTACTACATCAATGACGGTGTT
TATGGATCATTCAACTGTGTCATGTTTGATCATTACAACCCAACCGCAAA
TGCCCTTCATGTCACCGATGGACCTGTCTTCAAATGTAGTGTTTGGGGAC
CAACTTGTGATTCTCTGGATTGTATCTCCAAGTCTACACTTCTACCAAGG
ATGAACATTGGCGATTGGATGTATTTCCAGAACATGGGAGCGTACACTAT
CGCGGCAGCATCTAAATTTAATGGCTTCAAACAACCCAAAGTCATTTATA
TGTGTCGTCGCAAATTTGCTGATACTGTCACTGCTGAATCAGTGAATATT
GACACCAAAATGGAATTGATATCTAAGAAAGTTTTACATCATCACCCTCA
AAGTGTTGTAAAAAGCGCTGCAGTAAACTGAATATATTGTCATGCAGTGC
CAAGTAGATTAAATATGAATATAGCCGT
Run BLAST on NCBI

protein sequence of TCONS_00001073-protein

>TCONS_00001073-protein ID=TCONS_00001073-protein|Name=TCONS_00001073-protein|organism=Clytia hemisphaerica|type=polypeptide|length=439bp
MKQVKLHTGSVIDVCDDELNLTDYIHTKLNSAGREDKDDPFFVCDLGDIV
KKWRRFQRVLPMVKPYFAMKCNPDLEIIKLMIKLGSNFDCASKMEIKTLL
DLGVAADRIIFANPCKQTSFIKYSAANNVKLMTFDNEMELRKVKQFYPDA
ELVLRIRVDDSKSLCKFGVKFGAEPCNTMHLLQTAKQLHLNVVGVSFHVG
SGCYDASLFYDAVKLSRKVFDEGREVGYQFSMLDVGGGFPGDDLAKVSFE
ETAEKLKDGFNAFFPPEMNVKFIAEPGRYFVASACTNVCNITSVRKLESG
NESNFMYYINDGVYGSFNCVMFDHYNPTANALHVTDGPVFKCSVWGPTCD
SLDCISKSTLLPRMNIGDWMYFQNMGAYTIAAASKFNGFKQPKVIYMCRR
KFADTVTAESVNIDTKMELISKKVLHHHPQSVVKSAAVN
Run BLAST on NCBI

transcript from alignment at sc0000007:1366046..1373423+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001073 ID=TCONS_00001073|Name=TCONS_00001073|organism=Clytia hemisphaerica|type=transcript|length=7378bp|location=Sequence derived from alignment at sc0000007:1366046..1373423+ (Clytia hemisphaerica)
CTTTCATTTGCGTCTTGGTCTTGGTGGGAGCACATCATCCAACATCCAAA AGCATTttacaaaaatctcaaaatttcctTGCCTTTTAATTCTTCAAAAA TTCCTCCCAACAAATCTTTGAGGAGTGCGCGGCAGTTCGCAAGGAGTGGA CTTGTAAGTATTTGAATGAATTATTCCCTTCATTTCTCAATGTTGAATAG ACCTCTGTCAGTAGCCATtccgggtttgcttgttttttatttgacgctta tcaaaatcttcaattttaggtcaaactttgacaagcaatttTTCTTTGGG TAGTTGAgctttaaaattaattatttttgagtaatttagagttttctttt agctttccaaccatatataatatgcaggtgtaatattctaTACTTTTGTT TANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNcgaaaatacctgagaaatccaat ggtgctactctctgaaattaattctttcattaaagttattaatttttact tttcatactttggcaagcattttcagcctgaaaatgaggactagaattat agagagtgataccactgaaaaatttgacccttttttagcctagaacagtt atttatatgccatggggaatttttccttcacagcgctttgattacaaaga taggtaggttcagcTATTTTAGCTTCCGCTTTAtaacatttttattgttt tttgcaatgcaatgtcttctttttcaaaaaaatgtctttccatttcttcc ttgaagtgttagcaagccattacaaaaagaatttgataaaagtctgcagt caaaatgaagatatctggaatatcttgattcaatacaaaagcttgaattt tcagGATATCTTCATtcaatacaaaagcttgaattttcaattttcgcagc atatttcggtgccatttcatatgccatttctgggctatattgtcaacctc aaatgtctaaaaaggtgctattttagcggaaccaaaatctcaatatctcc ggaaccgcttatcattaggaagtgtatgacccctcattttttttcttttt tgaagctctacaaggtgaactaggtttgattgccaccagaatagtttcaa tttgaccctggaatggctacGCTGTCattaatgtttttttcattattttg ttatGTGATCTTGACCCTATTATGTATTAGGGCCCTGTAGTAAGTGGCCA TTAACTTTGATTCCTGTACAGAAAAGAAATAGGTTTGATTATCATTTCAC TGGtcttcaatagaccttttttcaaagaggccaccctgttgaataattat gtagtccagcagaaaaacaatgataaatcCATGCATAATTAATACAATac gcatgatacagtaattgtgcatggctctatcattgtttttatggctgaac tacataattattcaacaggacgtcctctttgaaaaaaggtctatacccTG AAGTCAGGgtataacttgcatcagtagaaGGAAACTTACATAGCCAGtta gttacatcaatatgccaaaaacattttgttcaaccaccttcacttcaaga tagaccaccatgtggctttcagccttttCAGCCAGTTTTCACAACAAAAG CCAAGTATATTTTCAACAATTGTGCCTCTACATCCAGCTATGCACAATTT CTCGTAAATATTGTCTAACTAAAAAAATTCCATTAATACTCTAGTTGATG GAGGATCATCATCATAGAGCTTCCATAATTCAACACACAGGCTTTCTTCA CTTTATTTAACACTTGGGTCTTTAAatggatacatcattgaatattgaat atgccattgttcttcaaagtttgaagttttttttcacaaaaagttCATGT TCATCGATATAATAATGTAAGTTTGAGAATCAAGCCTTTGGTTTCAATAG GCTCAAGCTTTCTCAGTTGCCAATAATGACATAAAAATAATATCAGCCAA TGCAACACATCCAAGTTAAAGCAGGCTGCATAGTAAAAAACATTGCTGAC TGCCTCCAAAATATGTACGTTTAAAAAATATCCCTTCTTTGGTTACCATC TTTTCTTTAAGTGTGTTTTTGCTTTGGACAGCTATGCACTCCTAACTCTT CAAGGATTGAAGCCTCTGAGAATTATGTTGTCATCCCACAAGATATCAAA TTTGATACTTCCATAAAAAGTATCAAGAGCAATGGTATTTTCAGCCTCCA TGATTGTCCATAACTCCACAAATTTACCATTATTAGCATAACACACTTTT GATTATGGTTGGCTATCCGTGTAATTAGTCATTTTCACCATTTCGATGTA CACCAGAAAACCTGGAATCCTTGTTTGGTTTTTAAAAGATTAAGTCACAC TAGCTTCTGGCTAAAGTGTGTGTCAAAAATTAATGCTGCAAAAACGCTCT ATTGCTTACTTCAATCGCAAGCAAAACTTCTGAGTGAagggatttatgaa aaaataaatctgCATTTTCAATAAGATTTACAGAGAAGAAATCCTTAAGA AATTCCCTAAATTTTGAGCCAAAGATAAAGATTTGGCTGGAAAATTTGCA TGTGTGGAATTAGTTTTACTTAAGAGAGTACTCTAGGCCTTGAGAAATCG AAGTGCTATCTTGGGAATtaaataacaaattttggttggtttatTAGCTG GCTGCTGCACACTNGCAGTTAGTCAAACTAGCTTCTGGCTAAAGTGTGTG TCAAAAATTAATGCTGCGAAAATGCTCTATTGCTTACTTCAATCGCAAGC AAAACTTCTGAGTGAagggatttatgaaaaaataaatctgCATTTTCAAT AAGATTTACAGAGAAGAAATCCTTAAGAAATTCCCTAAATTTTGAGCCAA AGATAAAGATTTGGCTGGAAAATTTGCATGTGTGGAATTAGTTTTACTTA AGAGAGTACTCTAGGCCTTGAGAAATCGAAGTGCTATCTTGGGAATtaaa taacaaattttggttggtttatTAGCTGGCTGCTGCACACTAGCAATCAG taatttaagttttcaagtgttaattaattgtcttgggatctttaatttga ttcaggtaactctcatccttgttgttgcaaataNgaccaaacaaatgact gaactcaaaaggtactatgatgtagtttctaacctgatgtgtaacctaat tgttttttcgctgattttcgcgaaaaaccgcaaaaactggttatcacgtc ataatcgatgacgtcactaaaactaaaaattgaatttctcaagaatggtt tatcaaattgtcttcaaactttcaccaaatatgtatcttactaaagtcaa tcatttgaaaaaaaaattctttcgaaattttgatgacatcagcagaaatt agtaaaaaacgaaaaatcctattttctgctgacatcatcaaaattttgaa aaattatattgttcaaataATCGATGTTAGTAaaatacatctttggtgaa agtttgaagacaattggataaaccattcttgagaaattcaatttttagtt ttagtgacgtcatcgattattacgtaataatcagtttttgcggtttttcg cgaaaatcagcgaaaaaacaattaggttgcACAttaggttagaaactaca tcatagtacccttcatgttcagtcatttgtttggtcattttctgtcgact aatgcgatctaaaaattatggtaattttaagacatgccataacttacccg agtgtGTGGAATTAGTTTTACTTAAGAGAGTAATCTAGGCCTTGAGAAAT CGAAGTGCTATCTTGGGAATtaaataacaaattttggttggtttatTAGC TGGCTGCTGCACACTAGCAATCAGtaatttaagttttcaagtgttaatta attgtcttgggatcttgaatttgattcaggtaactctcgtccttgttgtt gcaaatacaacCATGATGTTGTTATTTTTGAAACCTTGAGATCCCTGTGT GACTAACTGTAAGGGATTTTATTCAGTGCAatgcaaatttttcttttcaa aagactttcacaatctaatttttttctcattgttTCATTCAGGGCCTGAA AGCAACAAAGCTTCTGCCACCTGTTGAACTCTCCTGGGACAAAGCCTACG CTGGAATTAGCTGATATTTGCTAAGCTAACAGTAAGAAAGTTTGGTTATT TTAATATCTCTTTTCatttaccttggaaaatttttttattctccTAGTAT CTCAAAAAACATGCTTAAATGATTCTTTTTCTCACGTTTGTAGCAAGAAC TACTGAGCCAAAATGAAGCAAGTAAAGCTACATACAGGATCAGTAATTGA CGTCTGTGATGACGAATTGAATCTGACAGATTACATTCACACCAAACTGA ACTCAGCAGGGCGAGAAGATAAAGATGATCCCTTTTTTGTCTGTGATCTT GGTGATATTGTCAAGAAATGGAGACGATTCCAAAGAGTACTTCCAATGGT CAAACcttattttggtaatttttttacatgttttCCTATGGTTCTCTTTT TGATGACAAAATTTACTTCACACTATAtaattctttttctaaaattctGG TCTCAATACTATATACCTTCATCATTTCTAAATTGTGTTTtagttttgaa ttaaaattgcATACAAATTGTTCTAATCATTGTAGCCATGAAGTGCAACC CAGACCTAGAGATCATTAAACTCATGATCAAATTAGGTTCAAACTTTGAT TGTGCAAGCAAAATGGAGATCAAGACCTTACTTGATTTAGGGGTGGCTGC TGATCGAATCATCTTTGCAAACCCCTGCAAACAAACATCATTTATCAAGT AAGTGTTTATTATTAGCATGGCTTTAACTCCTTTCAAAGGAATTGGaaag ggaaaatatttttagtcttTATTAAGGCTTAGGGNTTTTAACTCCTTTCA AAGGGATtggaaaagagaaaatatttttagtcttTATTAAGGCTtaggga cacgagaagttttttttgtgttgatgcaatgcaacatgcttcatctcacc aacctgaaacgctttctcgtgtctccaccccattttcttttaataacatt tgtgcttctctcacatttgtccctgggacaaaatcagcgtgtcttttggg catttccctcactttttgtctcataaaacaaaaaaaagaaaccacaAGAC ATGCTCTTTTTtccttgtgttggtgggatagagcatgttgcattgcacca acgcgaaaaaaacttctggtgtccccaagcctttactcttattttttttg aatttttatttattttcagataTTCAGCAGCAAATAATGTCAAATTGATG ACTTTTGATAATGAAATGGAACTGCGAAAAGTTAAGCAATTTTATCCTGA TGCAGAGCTTGTTCTTCGAATCAGAGTTGATGATTCAAAATCACTTTGCA AGGTAAACTCATTCCATCTCTCTAGGGTTGATGCTTTAGTGcttttttgt atatttatttttaagatattaTAATCAAATATTTCCATAATCAACTTATA TTTCCAATTTTCTAGTTTGGAGTTAAGTTTGGGGCAGAACCTTGCAATAC AATGCACCTTTTACAAACAGCCAAACAGCTTCACTTGAATGTTGTTGGTG TTAGGTAAGTCTTTATGTCACCCATTTCAGATATCTGGTACCCTGCAACT GCAAGCtattatgaaaaaatcatttgcaGATAGCTTGAATAATGATTTCA AGGGTAGGATAAGATGTccaattttagcttgaaaattttgatttgcaaaa tttgaagcAATCATCTTACTGTCCttgtaacattttcaaaaacgaaatgt tttttattgatTAGTAAGAAATTGTACAGCATTTCGTATCAATAAGGAAA ATATTTAAAGAAAActaaaactgatcaaaaagttAGCATCACCTGTAATA ACATGCTCTGAAAGTGTGAATGTTTGAATTGATtccattgttttattttc agctTTCATGTTGGAAGTGGTTGTTATGACGCCTCTTTGTTTTATGATGC CGTCAAGTTGTCAAGGAAAGTCTTTGATGAAGGAGTAAGTGAAAAACAGA AAACTTAATGATTCTGTACTTCTCCCTAATCGTTCTAAGCATTTTGAGCT GATCAGCTTGTTTATTTCCAAAGCTGATCTACTTTTAATCTttcgatttt cttttttagCGTGAAGTTGGATATCAATTTTCTATGTTAGATGTTGGTGG TGGCTTCCCTGGAGATGATTTAGCTAAAGTCTCATTTGAAGAGGTATTTT TAAGATTTCCTTTTAAATGAACAGATTTGACAAACCTGGTCCAGATCTAT TTGACAATACTCgctatcaaataaaaataaatattcttaGTAGGAAATCC TTGTTTATGTACTCAGAAATATTTGATAATAAGAGTGTTTGTATATTTCT TTAGACTGCTGAAAAGTTGAAGGATGGTTTCAATGCGTTTTTCCCACCAG AAATGAATGTGAAATTTATTGCAGAGCCTGGTCGATATTTTGTGGCATCT GCATGTACAAACGTCTGCAACATCACTTCTGTTCGGAAGTTAGAATCAGG TAATGAAAGCAATTTCATGTACTACATCAATGACGGTGTTTATGGATCAT TCAACTGTGTCATGTTTGATCATTACAACCCAACCGCAAATGCCCTTCAT GTCACCGATGGACCTGTCTTCAAATGTAGTGTTTGGGGACCAACTTGTGA TTCTCTGGATTGTATCTCCAAGTCTACACTTCTACCAAGGGTAAGTTTCt taaaacattattttcttgTATGTGTTTAAGAATCTCATCAGTCAATGATA CAGATATGTTCAGTAATCCCTTTTTAAAATCCTTTACATTGTCCCTTTAG ATGAACATTGGCGATTGGATGTATTTCCAGAACATGGGAGCGTACACTAT CGCGGCAGCATCTAAATTTAATGGCTTCAAACAACCCAAAGTCATTTATA TGTGTCGTCGCAAATTTGCTGATACTGTCACTGCTGAATCAGTGAATATT GACACCAAAATGGAATTGATATCTAAGAAAGTTTTACATCATCACCCTCA AAGTGTTGTAAAAAGCGCTGCAGTAAACTGAATATATTGTCATGCAGTGC CAAGTAGATTAAATATGAATATAGCCGT

Coding sequence (CDS) from alignment at sc0000007:1366046..1373423+

>TCONS_00001073 ID=TCONS_00001073|Name=TCONS_00001073|organism=Clytia hemisphaerica|type=CDS|length=10560bp|location=Sequence derived from alignment at sc0000007:1366046..1373423+ (Clytia hemisphaerica)
ATGAAGCAAGTAAAGCTACATACAGGATCAGTAATTGACGTCTGTGATGA
CGAATTGAATCTGACAGATTACATTCACACCAAACTGAACTCAGCAGGGC
GAGAAGATAAAGATGATCCCTTTTTTGTCTGTGATCTTGGTGATATTGTC
AAGAAATGGAGACGATTCCAAAGAGTACTTCCAATGGTCAAACcttattt
tgCCATGAAGTGCAACCCAGACCTAGAGATCATTAAACTCATGATCAAAT
TAGGTTCAAACTTTGATTGTGCAAGCAAAATGGAGATCAAGACCTTACTT
GATTTAGGGGTGGCTGCTGATCGAATCATCTTTGCAAACCCCTGCAAACA
AACATCATTTATCAAataTTCAGCAGCAAATAATGTCAAATTGATGACTT
TTGATAATGAAATGGAACTGCGAAAAGTTAAGCAATTTTATCCTGATGCA
GAGCTTGTTCTTCGAATCAGAGTTGATGATTCAAAATCACTTTGCAAGTT
TGGAGTTAAGTTTGGGGCAGAACCTTGCAATACAATGCACCTTTTACAAA
CAGCCAAACAGCTTCACTTGAATGTTGTTGGTGTTAGctTTCATGTTGGA
AGTGGTTGTTATGACGCCTCTTTGTTTTATGATGCCGTCAAGTTGTCAAG
GAAAGTCTTTGATGAAGGACGTGAAGTTGGATATCAATTTTCTATGTTAG
ATGTTGGTGGTGGCTTCCCTGGAGATGATTTAGCTAAAGTCTCATTTGAA
GAGACTGCTGAAAAGTTGAAGGATGGTTTCAATGCGTTTTTCCCACCAGA
AATGAATGTGAAATTTATTGCAGAGCCTGGTCGATATTTTGTGGCATCTG
CATGTACAAACGTCTGCAACATCACTTCTGTTCGGAAGTTAGAATCAGGT
AATGAAAGCAATTTCATGTACTACATCAATGACGGTGTTTATGGATCATT
CAACTGTGTCATGTTTGATCATTACAACCCAACCGCAAATGCCCTTCATG
TCACCGATGGACCTGTCTTCAAATGTAGTGTTTGGGGACCAACTTGTGAT
TCTCTGGATTGTATCTCCAAGTCTACACTTCTACCAAGGATGAACATTGG
CGATTGGATGTATTTCCAGAACATGGGAGCGTACACTATCGCGGCAGCAT
CTAAATTTAATGGCTTCAAACAACCCAAAGTCATTTATATGTGTCGTCGC
AAATTTGCTGATACTGTCACTGCTGAATCAGTGAATATTGACACCAAAAT
GGAATTGATATCTAAGAAAGTTTTACATCATCACCCTCAAAGTGTTGTAA
AAAGCGCTGCAGTAAACTGAATGAAGCAAGTAAAGCTACATACAGGATCA
GTAATTGACGTCTGTGATGACGAATTGAATCTGACAGATTACATTCACAC
CAAACTGAACTCAGCAGGGCGAGAAGATAAAGATGATCCCTTTTTTGTCT
GTGATCTTGGTGATATTGTCAAGAAATGGAGACGATTCCAAAGAGTACTT
CCAATGGTCAAACcttattttgCCATGAAGTGCAACCCAGACCTAGAGAT
CATTAAACTCATGATCAAATTAGGTTCAAACTTTGATTGTGCAAGCAAAA
TGGAGATCAAGACCTTACTTGATTTAGGGGTGGCTGCTGATCGAATCATC
TTTGCAAACCCCTGCAAACAAACATCATTTATCAAataTTCAGCAGCAAA
TAATGTCAAATTGATGACTTTTGATAATGAAATGGAACTGCGAAAAGTTA
AGCAATTTTATCCTGATGCAGAGCTTGTTCTTCGAATCAGAGTTGATGAT
TCAAAATCACTTTGCAAGTTTGGAGTTAAGTTTGGGGCAGAACCTTGCAA
TACAATGCACCTTTTACAAACAGCCAAACAGCTTCACTTGAATGTTGTTG
GTGTTAGctTTCATGTTGGAAGTGGTTGTTATGACGCCTCTTTGTTTTAT
GATGCCGTCAAGTTGTCAAGGAAAGTCTTTGATGAAGGACGTGAAGTTGG
ATATCAATTTTCTATGTTAGATGTTGGTGGTGGCTTCCCTGGAGATGATT
TAGCTAAAGTCTCATTTGAAGAGACTGCTGAAAAGTTGAAGGATGGTTTC
AATGCGTTTTTCCCACCAGAAATGAATGTGAAATTTATTGCAGAGCCTGG
TCGATATTTTGTGGCATCTGCATGTACAAACGTCTGCAACATCACTTCTG
TTCGGAAGTTAGAATCAGGTAATGAAAGCAATTTCATGTACTACATCAAT
GACGGTGTTTATGGATCATTCAACTGTGTCATGTTTGATCATTACAACCC
AACCGCAAATGCCCTTCATGTCACCGATGGACCTGTCTTCAAATGTAGTG
TTTGGGGACCAACTTGTGATTCTCTGGATTGTATCTCCAAGTCTACACTT
CTACCAAGGATGAACATTGGCGATTGGATGTATTTCCAGAACATGGGAGC
GTACACTATCGCGGCAGCATCTAAATTTAATGGCTTCAAACAACCCAAAG
TCATTTATATGTGTCGTCGCAAATTTGCTGATACTGTCACTGCTGAATCA
GTGAATATTGACACCAAAATGGAATTGATATCTAAGAAAGTTTTACATCA
TCACCCTCAAAGTGTTGTAAAAAGCGCTGCAGTAAACTGAATGAAGCAAG
TAAAGCTACATACAGGATCAGTAATTGACGTCTGTGATGACGAATTGAAT
CTGACAGATTACATTCACACCAAACTGAACTCAGCAGGGCGAGAAGATAA
AGATGATCCCTTTTTTGTCTGTGATCTTGGTGATATTGTCAAGAAATGGA
GACGATTCCAAAGAGTACTTCCAATGGTCAAACcttattttgCCATGAAG
TGCAACCCAGACCTAGAGATCATTAAACTCATGATCAAATTAGGTTCAAA
CTTTGATTGTGCAAGCAAAATGGAGATCAAGACCTTACTTGATTTAGGGG
TGGCTGCTGATCGAATCATCTTTGCAAACCCCTGCAAACAAACATCATTT
ATCAAataTTCAGCAGCAAATAATGTCAAATTGATGACTTTTGATAATGA
AATGGAACTGCGAAAAGTTAAGCAATTTTATCCTGATGCAGAGCTTGTTC
TTCGAATCAGAGTTGATGATTCAAAATCACTTTGCAAGTTTGGAGTTAAG
TTTGGGGCAGAACCTTGCAATACAATGCACCTTTTACAAACAGCCAAACA
GCTTCACTTGAATGTTGTTGGTGTTAGctTTCATGTTGGAAGTGGTTGTT
ATGACGCCTCTTTGTTTTATGATGCCGTCAAGTTGTCAAGGAAAGTCTTT
GATGAAGGACGTGAAGTTGGATATCAATTTTCTATGTTAGATGTTGGTGG
TGGCTTCCCTGGAGATGATTTAGCTAAAGTCTCATTTGAAGAGACTGCTG
AAAAGTTGAAGGATGGTTTCAATGCGTTTTTCCCACCAGAAATGAATGTG
AAATTTATTGCAGAGCCTGGTCGATATTTTGTGGCATCTGCATGTACAAA
CGTCTGCAACATCACTTCTGTTCGGAAGTTAGAATCAGGTAATGAAAGCA
ATTTCATGTACTACATCAATGACGGTGTTTATGGATCATTCAACTGTGTC
ATGTTTGATCATTACAACCCAACCGCAAATGCCCTTCATGTCACCGATGG
ACCTGTCTTCAAATGTAGTGTTTGGGGACCAACTTGTGATTCTCTGGATT
GTATCTCCAAGTCTACACTTCTACCAAGGATGAACATTGGCGATTGGATG
TATTTCCAGAACATGGGAGCGTACACTATCGCGGCAGCATCTAAATTTAA
TGGCTTCAAACAACCCAAAGTCATTTATATGTGTCGTCGCAAATTTGCTG
ATACTGTCACTGCTGAATCAGTGAATATTGACACCAAAATGGAATTGATA
TCTAAGAAAGTTTTACATCATCACCCTCAAAGTGTTGTAAAAAGCGCTGC
AGTAAACTGAATGAAGCAAGTAAAGCTACATACAGGATCAGTAATTGACG
TCTGTGATGACGAATTGAATCTGACAGATTACATTCACACCAAACTGAAC
TCAGCAGGGCGAGAAGATAAAGATGATCCCTTTTTTGTCTGTGATCTTGG
TGATATTGTCAAGAAATGGAGACGATTCCAAAGAGTACTTCCAATGGTCA
AACcttattttgCCATGAAGTGCAACCCAGACCTAGAGATCATTAAACTC
ATGATCAAATTAGGTTCAAACTTTGATTGTGCAAGCAAAATGGAGATCAA
GACCTTACTTGATTTAGGGGTGGCTGCTGATCGAATCATCTTTGCAAACC
CCTGCAAACAAACATCATTTATCAAataTTCAGCAGCAAATAATGTCAAA
TTGATGACTTTTGATAATGAAATGGAACTGCGAAAAGTTAAGCAATTTTA
TCCTGATGCAGAGCTTGTTCTTCGAATCAGAGTTGATGATTCAAAATCAC
TTTGCAAGTTTGGAGTTAAGTTTGGGGCAGAACCTTGCAATACAATGCAC
CTTTTACAAACAGCCAAACAGCTTCACTTGAATGTTGTTGGTGTTAGctT
TCATGTTGGAAGTGGTTGTTATGACGCCTCTTTGTTTTATGATGCCGTCA
AGTTGTCAAGGAAAGTCTTTGATGAAGGACGTGAAGTTGGATATCAATTT
TCTATGTTAGATGTTGGTGGTGGCTTCCCTGGAGATGATTTAGCTAAAGT
CTCATTTGAAGAGACTGCTGAAAAGTTGAAGGATGGTTTCAATGCGTTTT
TCCCACCAGAAATGAATGTGAAATTTATTGCAGAGCCTGGTCGATATTTT
GTGGCATCTGCATGTACAAACGTCTGCAACATCACTTCTGTTCGGAAGTT
AGAATCAGGTAATGAAAGCAATTTCATGTACTACATCAATGACGGTGTTT
ATGGATCATTCAACTGTGTCATGTTTGATCATTACAACCCAACCGCAAAT
GCCCTTCATGTCACCGATGGACCTGTCTTCAAATGTAGTGTTTGGGGACC
AACTTGTGATTCTCTGGATTGTATCTCCAAGTCTACACTTCTACCAAGGA
TGAACATTGGCGATTGGATGTATTTCCAGAACATGGGAGCGTACACTATC
GCGGCAGCATCTAAATTTAATGGCTTCAAACAACCCAAAGTCATTTATAT
GTGTCGTCGCAAATTTGCTGATACTGTCACTGCTGAATCAGTGAATATTG
ACACCAAAATGGAATTGATATCTAAGAAAGTTTTACATCATCACCCTCAA
AGTGTTGTAAAAAGCGCTGCAGTAAACTGAATGAAGCAAGTAAAGCTACA
TACAGGATCAGTAATTGACGTCTGTGATGACGAATTGAATCTGACAGATT
ACATTCACACCAAACTGAACTCAGCAGGGCGAGAAGATAAAGATGATCCC
TTTTTTGTCTGTGATCTTGGTGATATTGTCAAGAAATGGAGACGATTCCA
AAGAGTACTTCCAATGGTCAAACcttattttgCCATGAAGTGCAACCCAG
ACCTAGAGATCATTAAACTCATGATCAAATTAGGTTCAAACTTTGATTGT
GCAAGCAAAATGGAGATCAAGACCTTACTTGATTTAGGGGTGGCTGCTGA
TCGAATCATCTTTGCAAACCCCTGCAAACAAACATCATTTATCAAataTT
CAGCAGCAAATAATGTCAAATTGATGACTTTTGATAATGAAATGGAACTG
CGAAAAGTTAAGCAATTTTATCCTGATGCAGAGCTTGTTCTTCGAATCAG
AGTTGATGATTCAAAATCACTTTGCAAGTTTGGAGTTAAGTTTGGGGCAG
AACCTTGCAATACAATGCACCTTTTACAAACAGCCAAACAGCTTCACTTG
AATGTTGTTGGTGTTAGctTTCATGTTGGAAGTGGTTGTTATGACGCCTC
TTTGTTTTATGATGCCGTCAAGTTGTCAAGGAAAGTCTTTGATGAAGGAC
GTGAAGTTGGATATCAATTTTCTATGTTAGATGTTGGTGGTGGCTTCCCT
GGAGATGATTTAGCTAAAGTCTCATTTGAAGAGACTGCTGAAAAGTTGAA
GGATGGTTTCAATGCGTTTTTCCCACCAGAAATGAATGTGAAATTTATTG
CAGAGCCTGGTCGATATTTTGTGGCATCTGCATGTACAAACGTCTGCAAC
ATCACTTCTGTTCGGAAGTTAGAATCAGGTAATGAAAGCAATTTCATGTA
CTACATCAATGACGGTGTTTATGGATCATTCAACTGTGTCATGTTTGATC
ATTACAACCCAACCGCAAATGCCCTTCATGTCACCGATGGACCTGTCTTC
AAATGTAGTGTTTGGGGACCAACTTGTGATTCTCTGGATTGTATCTCCAA
GTCTACACTTCTACCAAGGATGAACATTGGCGATTGGATGTATTTCCAGA
ACATGGGAGCGTACACTATCGCGGCAGCATCTAAATTTAATGGCTTCAAA
CAACCCAAAGTCATTTATATGTGTCGTCGCAAATTTGCTGATACTGTCAC
TGCTGAATCAGTGAATATTGACACCAAAATGGAATTGATATCTAAGAAAG
TTTTACATCATCACCCTCAAAGTGTTGTAAAAAGCGCTGCAGTAAACTGA
ATGAAGCAAGTAAAGCTACATACAGGATCAGTAATTGACGTCTGTGATGA
CGAATTGAATCTGACAGATTACATTCACACCAAACTGAACTCAGCAGGGC
GAGAAGATAAAGATGATCCCTTTTTTGTCTGTGATCTTGGTGATATTGTC
AAGAAATGGAGACGATTCCAAAGAGTACTTCCAATGGTCAAACcttattt
tgCCATGAAGTGCAACCCAGACCTAGAGATCATTAAACTCATGATCAAAT
TAGGTTCAAACTTTGATTGTGCAAGCAAAATGGAGATCAAGACCTTACTT
GATTTAGGGGTGGCTGCTGATCGAATCATCTTTGCAAACCCCTGCAAACA
AACATCATTTATCAAataTTCAGCAGCAAATAATGTCAAATTGATGACTT
TTGATAATGAAATGGAACTGCGAAAAGTTAAGCAATTTTATCCTGATGCA
GAGCTTGTTCTTCGAATCAGAGTTGATGATTCAAAATCACTTTGCAAGTT
TGGAGTTAAGTTTGGGGCAGAACCTTGCAATACAATGCACCTTTTACAAA
CAGCCAAACAGCTTCACTTGAATGTTGTTGGTGTTAGctTTCATGTTGGA
AGTGGTTGTTATGACGCCTCTTTGTTTTATGATGCCGTCAAGTTGTCAAG
GAAAGTCTTTGATGAAGGACGTGAAGTTGGATATCAATTTTCTATGTTAG
ATGTTGGTGGTGGCTTCCCTGGAGATGATTTAGCTAAAGTCTCATTTGAA
GAGACTGCTGAAAAGTTGAAGGATGGTTTCAATGCGTTTTTCCCACCAGA
AATGAATGTGAAATTTATTGCAGAGCCTGGTCGATATTTTGTGGCATCTG
CATGTACAAACGTCTGCAACATCACTTCTGTTCGGAAGTTAGAATCAGGT
AATGAAAGCAATTTCATGTACTACATCAATGACGGTGTTTATGGATCATT
CAACTGTGTCATGTTTGATCATTACAACCCAACCGCAAATGCCCTTCATG
TCACCGATGGACCTGTCTTCAAATGTAGTGTTTGGGGACCAACTTGTGAT
TCTCTGGATTGTATCTCCAAGTCTACACTTCTACCAAGGATGAACATTGG
CGATTGGATGTATTTCCAGAACATGGGAGCGTACACTATCGCGGCAGCAT
CTAAATTTAATGGCTTCAAACAACCCAAAGTCATTTATATGTGTCGTCGC
AAATTTGCTGATACTGTCACTGCTGAATCAGTGAATATTGACACCAAAAT
GGAATTGATATCTAAGAAAGTTTTACATCATCACCCTCAAAGTGTTGTAA
AAAGCGCTGCAGTAAACTGAATGAAGCAAGTAAAGCTACATACAGGATCA
GTAATTGACGTCTGTGATGACGAATTGAATCTGACAGATTACATTCACAC
CAAACTGAACTCAGCAGGGCGAGAAGATAAAGATGATCCCTTTTTTGTCT
GTGATCTTGGTGATATTGTCAAGAAATGGAGACGATTCCAAAGAGTACTT
CCAATGGTCAAACcttattttgCCATGAAGTGCAACCCAGACCTAGAGAT
CATTAAACTCATGATCAAATTAGGTTCAAACTTTGATTGTGCAAGCAAAA
TGGAGATCAAGACCTTACTTGATTTAGGGGTGGCTGCTGATCGAATCATC
TTTGCAAACCCCTGCAAACAAACATCATTTATCAAataTTCAGCAGCAAA
TAATGTCAAATTGATGACTTTTGATAATGAAATGGAACTGCGAAAAGTTA
AGCAATTTTATCCTGATGCAGAGCTTGTTCTTCGAATCAGAGTTGATGAT
TCAAAATCACTTTGCAAGTTTGGAGTTAAGTTTGGGGCAGAACCTTGCAA
TACAATGCACCTTTTACAAACAGCCAAACAGCTTCACTTGAATGTTGTTG
GTGTTAGctTTCATGTTGGAAGTGGTTGTTATGACGCCTCTTTGTTTTAT
GATGCCGTCAAGTTGTCAAGGAAAGTCTTTGATGAAGGACGTGAAGTTGG
ATATCAATTTTCTATGTTAGATGTTGGTGGTGGCTTCCCTGGAGATGATT
TAGCTAAAGTCTCATTTGAAGAGACTGCTGAAAAGTTGAAGGATGGTTTC
AATGCGTTTTTCCCACCAGAAATGAATGTGAAATTTATTGCAGAGCCTGG
TCGATATTTTGTGGCATCTGCATGTACAAACGTCTGCAACATCACTTCTG
TTCGGAAGTTAGAATCAGGTAATGAAAGCAATTTCATGTACTACATCAAT
GACGGTGTTTATGGATCATTCAACTGTGTCATGTTTGATCATTACAACCC
AACCGCAAATGCCCTTCATGTCACCGATGGACCTGTCTTCAAATGTAGTG
TTTGGGGACCAACTTGTGATTCTCTGGATTGTATCTCCAAGTCTACACTT
CTACCAAGGATGAACATTGGCGATTGGATGTATTTCCAGAACATGGGAGC
GTACACTATCGCGGCAGCATCTAAATTTAATGGCTTCAAACAACCCAAAG
TCATTTATATGTGTCGTCGCAAATTTGCTGATACTGTCACTGCTGAATCA
GTGAATATTGACACCAAAATGGAATTGATATCTAAGAAAGTTTTACATCA
TCACCCTCAAAGTGTTGTAAAAAGCGCTGCAGTAAACTGAATGAAGCAAG
TAAAGCTACATACAGGATCAGTAATTGACGTCTGTGATGACGAATTGAAT
CTGACAGATTACATTCACACCAAACTGAACTCAGCAGGGCGAGAAGATAA
AGATGATCCCTTTTTTGTCTGTGATCTTGGTGATATTGTCAAGAAATGGA
GACGATTCCAAAGAGTACTTCCAATGGTCAAACcttattttgCCATGAAG
TGCAACCCAGACCTAGAGATCATTAAACTCATGATCAAATTAGGTTCAAA
CTTTGATTGTGCAAGCAAAATGGAGATCAAGACCTTACTTGATTTAGGGG
TGGCTGCTGATCGAATCATCTTTGCAAACCCCTGCAAACAAACATCATTT
ATCAAataTTCAGCAGCAAATAATGTCAAATTGATGACTTTTGATAATGA
AATGGAACTGCGAAAAGTTAAGCAATTTTATCCTGATGCAGAGCTTGTTC
TTCGAATCAGAGTTGATGATTCAAAATCACTTTGCAAGTTTGGAGTTAAG
TTTGGGGCAGAACCTTGCAATACAATGCACCTTTTACAAACAGCCAAACA
GCTTCACTTGAATGTTGTTGGTGTTAGctTTCATGTTGGAAGTGGTTGTT
ATGACGCCTCTTTGTTTTATGATGCCGTCAAGTTGTCAAGGAAAGTCTTT
GATGAAGGACGTGAAGTTGGATATCAATTTTCTATGTTAGATGTTGGTGG
TGGCTTCCCTGGAGATGATTTAGCTAAAGTCTCATTTGAAGAGACTGCTG
AAAAGTTGAAGGATGGTTTCAATGCGTTTTTCCCACCAGAAATGAATGTG
AAATTTATTGCAGAGCCTGGTCGATATTTTGTGGCATCTGCATGTACAAA
CGTCTGCAACATCACTTCTGTTCGGAAGTTAGAATCAGGTAATGAAAGCA
ATTTCATGTACTACATCAATGACGGTGTTTATGGATCATTCAACTGTGTC
ATGTTTGATCATTACAACCCAACCGCAAATGCCCTTCATGTCACCGATGG
ACCTGTCTTCAAATGTAGTGTTTGGGGACCAACTTGTGATTCTCTGGATT
GTATCTCCAAGTCTACACTTCTACCAAGGATGAACATTGGCGATTGGATG
TATTTCCAGAACATGGGAGCGTACACTATCGCGGCAGCATCTAAATTTAA
TGGCTTCAAACAACCCAAAGTCATTTATATGTGTCGTCGCAAATTTGCTG
ATACTGTCACTGCTGAATCAGTGAATATTGACACCAAAATGGAATTGATA
TCTAAGAAAGTTTTACATCATCACCCTCAAAGTGTTGTAAAAAGCGCTGC
AGTAAACTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000606XLOC_000606Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001073-exon-sc0000007-1491911889:1366046..1366198TCONS_00001073-exon-sc0000007-1491911889:1366046..1366198Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1366046..1366198TCONS_00001073-exon-sc0000007-1510915933:1366046..1366198Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1366046..1366198TCONS_00001073-exon-sc0000007-1575043694:1366046..1366198Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1370338..1370426TCONS_00001073-exon-sc0000007-1491911889:1370338..1370426Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1370338..1370426TCONS_00001073-exon-sc0000007-1510915933:1370338..1370426Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1370338..1370426TCONS_00001073-exon-sc0000007-1575043694:1370338..1370426Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1370539..1370759TCONS_00001073-exon-sc0000007-1491911889:1370539..1370759Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1370539..1370759TCONS_00001073-exon-sc0000007-1510915933:1370539..1370759Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1370539..1370759TCONS_00001073-exon-sc0000007-1575043694:1370539..1370759Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1370931..1371093TCONS_00001073-exon-sc0000007-1491911889:1370931..1371093Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1370931..1371093TCONS_00001073-exon-sc0000007-1510915933:1370931..1371093Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1370931..1371093TCONS_00001073-exon-sc0000007-1575043694:1370931..1371093Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1371565..1371697TCONS_00001073-exon-sc0000007-1491911889:1371565..1371697Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1371565..1371697TCONS_00001073-exon-sc0000007-1510915933:1371565..1371697Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1371565..1371697TCONS_00001073-exon-sc0000007-1575043694:1371565..1371697Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1371811..1371899TCONS_00001073-exon-sc0000007-1491911889:1371811..1371899Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1371811..1371899TCONS_00001073-exon-sc0000007-1510915933:1371811..1371899Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1371811..1371899TCONS_00001073-exon-sc0000007-1575043694:1371811..1371899Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1372248..1372329TCONS_00001073-exon-sc0000007-1491911889:1372248..1372329Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1372248..1372329TCONS_00001073-exon-sc0000007-1510915933:1372248..1372329Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1372248..1372329TCONS_00001073-exon-sc0000007-1575043694:1372248..1372329Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1372455..1372538TCONS_00001073-exon-sc0000007-1491911889:1372455..1372538Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1372455..1372538TCONS_00001073-exon-sc0000007-1510915933:1372455..1372538Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1372455..1372538TCONS_00001073-exon-sc0000007-1575043694:1372455..1372538Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1372700..1373035TCONS_00001073-exon-sc0000007-1491911889:1372700..1373035Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1372700..1373035TCONS_00001073-exon-sc0000007-1510915933:1372700..1373035Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1372700..1373035TCONS_00001073-exon-sc0000007-1575043694:1372700..1373035Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1491911889:1373146..1373423TCONS_00001073-exon-sc0000007-1491911889:1373146..1373423Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1510915933:1373146..1373423TCONS_00001073-exon-sc0000007-1510915933:1373146..1373423Clytia hemisphaericaexon
TCONS_00001073-exon-sc0000007-1575043694:1373146..1373423TCONS_00001073-exon-sc0000007-1575043694:1373146..1373423Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001073-proteinTCONS_00001073-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1366046..1373423 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
10.0258 9.411 7.64329 7.06233 81.83 65.7022 83.6707 87.0283 114.045 89.382 81.4369 105.685 166.247 144.709 69.0254 75.6441 152.253 128.776 83.0816 89.5532 165.998 171.38 96.1769 112.693 53.0158 53.4245 121.086 89.1999 357.534 203.905
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002433Orn_de-COase
IPR000183Orn/DAP/Arg_de-COase
IPR029066PLP-binding_barrel
IPR009006Ala_racemase/Decarboxylase_C
IPR022644De-COase2_N
IPR022643De-COase2_C
IPR022653De-COase2_pyr-phos_BS
Vocabulary: Biological Process
TermDefinition
GO:0006596polyamine biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006596 polyamine biosynthetic process
molecular_function GO:0003824 catalytic activity
Blast
BLAST of TCONS_00001073 vs. Swiss-Prot (Human)
Match: DCOR (Ornithine decarboxylase OS=Homo sapiens GN=ODC1 PE=1 SV=2)

HSP 1 Score: 394.43 bits (1012), Expect = 2.857e-131
Identity = 193/394 (48.98%), Postives = 260/394 (65.99%), Query Frame = 1
Query:  307 DDELNLTDYIHTKLNSAGREDKDDPFFVCDLGDIVKKWRRFQRVLPMVKPYFAMKCNPDLEIIKLMIKLGSNFDCASKMEIKTLLDLGVAADRIIFANPCKQTSFIKYSAANNVKLMTFDNEMELRKVKQFYPDAELVLRIRVDDSKSLCKFGVKFGAEPCNTMHLLQTAKQLHLNVVGVSFHVGSGCYDASLFYDAVKLSRKVFDEGREVGYQFSMLDVGGGFPGDDLAKVSFEETAEKLKDGFNAFFPPEMNVKFIAEPGRYFVASACTNVCNITS---VRKLESG-------NESNFMYYINDGVYGSFNCVMFDHYN--PTANALHVTDGPVFKCSVWGPTCDSLDCISKSTLLPRMNIGDWMYFQNMGAYTIAAASKFNGFKQPKVIYM 1452
            D+     D +  K+N     D  D F+V DLGDI+KK  R+ + LP V P++A+KCN    I+K +   G+ FDCASK EI+ +  LGV  +RII+ANPCKQ S IKY+A N V++MTFD+E+EL KV + +P A+LVLRI  DDSK++C+  VKFGA    +  LL+ AK+L+++VVGVSFHVGSGC D   F  A+  +R VFD G EVG+   +LD+GGGFPG +  K+ FEE    +    + +FP +  V+ IAEPGRY+VASA T   NI +   V K ++G       +E  FMYY+NDGVYGSFNC+++DH +  P        D   +  S+WGPTCD LD I +   LP M++GDWM F+NMGAYT+AAAS FNGF++P + Y+
Sbjct:   15 DEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYV 408          
The following BLAST results are available for this feature:
BLAST of TCONS_00001073 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DCOR2.857e-13148.98Ornithine decarboxylase OS=Homo sapiens GN=ODC1 PE... [more]
back to top