Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001056 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001056
Unique NameTCONS_00001056
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1248

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001056 ID=TCONS_00001056|Name=TCONS_00001056|organism=Clytia hemisphaerica|type=transcript|length=1248bp
CTCACGCGTGTCTATATcgtatcaaaaaaaattatttttcaattctcTTA
TGAATCGAACCTTCTTCAATAAGATTTTCGACCTTCTTTGTTCTTCCTTT
ATGGCTCGTAGTAAAGGAGGTGGATTTTATGCTGTTAAGCGTGGCAGGAA
TATTGGAATTTACATGACATGGGCAGAATGTGAAAGTCAAGTAAAGGGTT
TTCATGGCGCAAGGTTTCATCCAGCAATTCTTCACTTGGTGTTAGAAGAA
CACAGACTTTTAAAGCAAAGTCACAAAACACTGcctTTCCAGGATCTGTT
ACAGCTCTATCTAAAAGAACCAAATTGATAGAAGCTAGAAGTTTGTCAAC
ACAAGCCTCGTCCAGCTCCACATCCTCCAAGCCCGTTGTTTATACAGATG
GTTGCTGCCGTGGTAACGGTAGAAGTGGAGCCATCGGTGGAATCGGTGTT
TATTGGGGACCAGATCATCCTAGgaatATAAGTGAACCGTTACTAGTAGA
CGAGCCAACTAACCAGAAAGCTGAACTGGAGGCCGCCATCAGAGCGATTG
ATTGTGCGATAGGAATGGGTCTGGATGATCTTGAATTACGAACAGATAGT
ACATACACCATCAAATCAATGACGGAATGGATTCCACGTTGGGAGCGGAA
CGGATGGAAAACTTCCAAAGGAACTGATGTTCTGAACAAAGAACAAATGA
TCCGGTTGAACGATTTATGTAAACGGATTGATATAAAATGGACGCACGTT
CGCGGACACAAAGGTATCCATGGCAACGAAGAAGCAGATCGATTGGCCAA
TGAAGGAGCAATGAAAACTTGAAAACGAAGCGTGGTTGTAAAACGGCGAC
TAACGAACGTGGGATTTTCCTTAGTGTCACTCATGGTGTAATGTTGGAAA
TTCTGTCaaattccaaataaataaatgaagaaGGACTCGCCTACTTTCAG
TTATGTTACCTGACAGCTTCAAATGACAATGTTAAAGacaatttaaacag
tattactTGTAAAAGGACATTACAGTGTGCCCGAAAGAAAATGGGACGGA
TTTTATAAATTTAGTatctttatttatttaaattttgttcGACTTACCTA
CCTAGAAACACTGTAGTTTTTGTTAATGTTTACCATTTGCAATACGGTGT
TTTGTCCTCGTTGTGGACAATTGTATATCATCCACAAATGCTCTGCtgag
aaagaaaaacttttaaataacaATAATATAGGAACTTTAGCATCATCG
Run BLAST on NCBI

transcript from alignment at sc0000007:1106757..1116755+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001056 ID=TCONS_00001056|Name=TCONS_00001056|organism=Clytia hemisphaerica|type=transcript|length=9999bp|location=Sequence derived from alignment at sc0000007:1106757..1116755+ (Clytia hemisphaerica)
CTCACGCGTGTCTATATcgtatcaaaaaaaattatttttcaattctcTTA TGAATCGAACCTTCTTCAATAAGATTTTCGACCTTCTTTGTTCTTCCTTT ATGGCTCGTAGTAAAGGAGGTGGATTTTATGCTGTTAAGCGTGGCAGGAA TATTGGAATTTACATGACATGGTAAGGAATTTTCTATTGGTTATCCTACT ACAGTCTTAGATTAAGAAGGAGGTAGGCTACGtccatatcttccttcgtt ttttcaaaaactcctactctttgagagtaaggcctaaaagcctggagctg tctattgtgtagaatAAGAAGGAGGGAGATCAGAGATAAATAAGTGTTTG Gttaataccgtgagatcgggtaacttgcatcagtggaggaggctaacatg catagggccattccagaatttgtctatAACAGAGGGCGGCgaacgacaca ggatttccgagggcaaaagttttcaccaaaattcaaaatttctaaggcga gagaagaaaatgtatgaatttcctaggcaattgaattagaaaaggcaaaa aagagtggaatttccgatgcattttgcaaaagtatatggatttttatcgg aatttctgaccaccactggaaaagaaaagttatttccaaggctagaaaaa atttaaaaatgcacgtcgtccgacggggggtaacaaaaattttctggaat ggcccataatagccctcaaatgaatgacctgtctgttcattaaaatacaa aagttaacatcaaaacaaaaatattagaGCAGAGccgcgagcggagctgc gtaccgtaagttggtctaatgtcgacatccgtcttctaataggatgatag gaacaatagaaactgaggaaggtcggaatagctgattgacttttttgact agcGAGCGCGATGAGAGGAAAAATCTTtagtctatcagtgatttcgacct tcttattattcctatctataaagaaggatgtcgaaattagaagacggatg tcgacattagaccaacttacggtagttcatttgttttaaaattttgctgc tttgattggtcagtcatttgatccGGCTATGCATGTTTCTCTCCACTGAT TCAAGTTACCTTACTTCACGGTAAGATTGTCTGATTTTGTATGTGAAGTT TGGCtattcaatatatttttcaaccaTAACAGGtatataccgtaagttgg tctaatatcgacatccctcgtctaatttcgacaccattctttagagacag gaataatatgaaagcttgaatcactgattgaaaaaggattattcctcccT GActactaagcaaagaaaaacagtttcaacctttctatcaatttcagctg ataaaaagggtgtcagaattagaggaggggtgtcgacattagaccaagtt acggtagccTATTGACCTTACTTTTTCTCATCAATAACCCTCTGGAGATT AAGAACAGTCAGGGAactccctcaattgcggtatacttCAATTACAGTAT ACTGCAATAATTGCAGTAGTTTTCATTTGTGgttagcctacaaaggctta ggcagccatcgaaaaattgttctgctCCCGCGCGCGTCATCGTATTGGTT GTAAAAAATACATGTGGGCGGGCAGGCGGTTGGTCAGAAAGATTTCAggg tttttgaaaaacttcttcTGATCAGTCTTTTTTGTGTGATTTCTTCCTAC TTCTCTGCATTGGAAAGTCAATGGAAAATATGATGCAGGTCGGTTGACAT GAacactcgggtaacttaatgcatgtcccagaattgcattaatttttccg ccccagttccagtccctaaaccataacaaactatacattttcgcaagcgt atttggatgtagaataccgtattcggtgtaacttaaattccttctcagta taattagagatatgttaaaaaaacctgattatgacgtcatgattaatgac gtcataaatacaaaaagttgaatatctcgagaaatataaatcaaaacttt atgaaatttggaccagtgataaagtacattgagatgtttcaaaaactTTN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNTTGaaagtatttcccaaaattaat gacgtcagcaaaaattgcaagaattcgaatttttgcgataaaatgctgac atcagcaaattttcaaattttttaaaaataattctcctcctcttgatgag ttctatcattggtcaaaatttcataaagctttgagtattagttcttgaga tattcaatttttaaaaattatgacgtcataaatagtgacgtcataatcat gttttcttaaaaaaactcaaattctgttgagaaagaatttaagttacacc aaatacggtattctacatccaaatacgcttccaaaaatgtatagtttgtt atggtttagggactggaactggggcggaaaaattaatgcaattctgggac atgcattaagttacccgagcagaaaaatattttaatggcCGCCTTATGAC GGGTACATATAGTGCTGagtcgacaaagataaacaaagatcaACTGTAAA AAAACTTATAAGAAGAAAGCTTgtctttttaaaaagaatctgATCTGAGT ACTTGCTACAAAAAATAAGAGGGTGATGGAagcaataaaattataaaaaa ataagaaatacagAGGCCCCATAGTGCCATTCAAATTCACATTCATTATT CTAAAAATAGGAAACCAACAAATTGACTatgaaattaaaaaaggcaagCC AGGTTTTCGGaggcaaaaatccaaaattttgtgGCTTGAACTTAGCTCGA TCATCAATGTTGGGCTAAGATAATGTTTTGCTAtttccagacggtactaa tcgataaattcgattatcgaagtaatcgaacgaccacttatcgattaaca atcaaatgtcaagtaccaaaatttcaaaaaaattgtgagtattcgatcaa tttcttaacaacccttcgaACACTCGATAACCGTTTGAAGACTTTAtatg ttattgattactttcgataactttgacaactttgataaccaattactatg atatatctttaagaaaaaccaaaaaaaatgacctaaattttcgccctggg tttcctcaagtaactcatattgcgcgttctgattggtcggagaaaacgaa agtggttttcgcGCATGAATCGAGTGTTTTAATTAGCCGAAATAaacttg gtttcagattattATGACACGGTGCTactggaaacatatttgataaaatc gaaggCTGGAAGGTACTCAATACaatcgaaggtattcaatatgattgaAG GTTATCAAAAAGTAatcgaaatgattgaacaaatcgaaaaatggtcgaag aaaatgccataacctggagtcgagtgagtattcgatcaccgataaaatcg ataggtggtcactgactaccttcgattattatcgatcattattgattact tcgatcacaatcgaacgttcgattagtaccgtctgttTATTTTGGCCCAA ACATGACCCCGAAATGTTCAGGGTATGTTTGGGCAAAATTGTAGGTTGTG AGTCAtcttatattattttttgaacttttgattatttttcctATTTCTAT AAATTAATCCAAAGGCTACATATGTACATTTTCCTAGatactaaaaaata aaataaaaaatagcacTAGCCGGTACCAGGCGttgcacgccggttaagct gtagctgaacgcactaaaagtcctttgggtgttgaagctggcttaaaaaa acgatcaaataaaaaatagaaatctctAGAACAtttaactctaaccttcc ccgcgtgtcttatcttttaaccatatttggatcgtgtcccccgtgacata attttttgtttaggtcaaaagttatcagaaagagcatcgtttactgtacc agtgtcgtttgaaacgactcagcaggtagttatttttctcgcttcgctcg cgttaaatatgccgtccagtttaaatgacaatttttcaggaaaaagtggg aaggtcaGAAAGAATATTGCAACTCTTTGTTTTTATCAGATcgaaaaaaa agaagacaattctaagttgcttttttaaacccttgtcataacttttcgaa tttaaacataaaaaatgacgtacacactttttaacagtaacaacgacttg aatatttttataagaagaaagaagttaactaattttttcttatgctttat atcaccctttgaagttttgaatgctgttgttgtccacaaactttttgatt tttggcccagctagctttagcgtactgggcctttcattagcattctgccc NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCAGATTG tgaaggatttgattggctgttagaacatgattgacagaataaaaaacaat tgaaatcgtctttattggttaaaaacataaaaggagaaaatttaattaac tattaaaactataagaacataacagATGTAGtgtgttttaagaaaaacaa tgtaacaaaccgtaacaaaccttcttctctttaggaagatgttcttttaN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGCAAgggacta aaagtcataattttaaaacacaaacaaagcgaaaacgaaagtggtgacac acagacacacaaagcaccgctattaatatatagaatcTAAAAACACTGAT AAAAAACAACATAActaattatatatattttaagaTTATCCAGAGACATC TTGGACAATCTTGCCTGAGGGTAACACCAATGATTCATGTTCACATACTT GACTGACTTTAGGCTCAAAATATTTGTATATTGCTGTTTGGATGACATCA GGTAGAATGGCTACCTGATGTCATCCAAACAGCAATatacaaatattttg agattcgtTGTTGtagcatttttttttctttcactgtcaattttttgttt tgccatTGAAATAAGGaggatttgaaaaattatcaaagatGCTTATGAAT GCTGAGAAAGCACTTTATCGTTTATTTCACTCTCAGGCAAAAGAATGCGC tccaaaacttctaaagggatttatgaaaaaatatgaaaaactggtgcttt ttaatgaaatttaaacaTATATATTCGAAAACTATgaaaaattacctaaa ttttgagccatagatgaaaaaatttgacctGACCCAACCTGaaccaacct tgaaaactaatttgaagaacaGCTTCCAAAGAAAAAGATCAATGAGAGAA CACCCATTTATATGTGtgggaattttttttactttacgtGTAATTAAAGC CTAACAAATCAAAGCGCTATCTTGGGAatcaaaatgacaaattttggttg gttgattttggctgctgcacaaatattttgtttcaagctttcaagtttta attatatATAACTGTCTTTGGAACTTGATTGAGGTAACTCTCTTCTTTGA TGCTGCAAATaaatcctgtagatgactgatgttgtttttattgatagctt gatttcctagtttGACTAACTGACAAGTAGTCATTATCTTTTGTTGGCAA AGGAAGGTCGACGTTTGAAAATACTTTATCATGCAGACTGAAGACACTTC TCCTATGGACAAAAAACATGTTGTAAGAGACATTGTAAGGCTACATATCG GTGTCAGACACAAAGAACTTACTTAAAAATAATAGAGATGCTCAAAATTG AGACACAGGTAAATTCCAAAAGAAATAACCATCATTGCTCTGAAAATGAT CATAAAATAAATTGGgggttgaaaaaaattaaaagatgtTAAATCTCTCT AATGTAGCTAAACATAAATCTTGCAATCCAAGCCACAATAATCTTCCAAC GTGAATATCACTGAGTCAATAAACACAACaatttatttagatattatatg AACTTTTTAAAACACTTTAAACTTTAGAGTTAAGGAAAAATCACCTACAA TTAAAATAATTCTTTCCTTTTTTAGGGCAGAATGTGAAAGTCAAGTAAAG GGTTTTCATGGCGCAAGGTACAAAAAGTTTGGCTCAGAACAAGAAGCACA AAGTTTCATAGATGAGGTGACGAATTAAACTAAAACCTCTTTTTATCAGG GAGGCtcttgatattttttaaattataacTGACTACTTGATAATTGAGTT GCTATTAGTGGGGTTACAGGTTTTGAACTTGTTTTGAAGGTTGTGGAGAG GAACAAGGGGTTATTTAAAGCTCAAAGGAATTCTTTATTTTaaatagatt taaaaagatatGTCATATTAAAATACTCCTTTTCAAAGGTTTCATCCAGC AATTCTTCACTTGGTGTTAGAAGAACACAGACTTTTAAAGCAAAGTCACA AAACACTGGTAAGAATTTTCTCCTCCATACATCTGTTGATAGTTCTGTTG GTATGCTCAAGAGAAACATTGTAGCAAAGGTTTGGCATGctatcttctca aaaatattagAAAGTTATAtcttgatgggttaaaatcaaccttcttccca aatATAATTTTCGCTGTcgaagaattcttattcagttGCTCTTCATAACT TTCTGTTTACGATAGCGGCTTCCtgtcactttcaaaacttttcaaagtct tcCAAAGTCACACTCGAATGTCCAGCCACGATGGCCAGCCACGATGGCTA AATAGATCTTATTTATAATTCTTCTAAGCCATTTacttaattgtggttaa aaattgcaataCAATGTTATCTTCTTTCTCCTTTCTTTCATAGAATGAAA ATCGTATCATTATTTCGGCAGCTATCTTTTTTCCTTTAGAGTTTTTTATA TGTATAGTGATTCGCTGGATTGGGACATGCAGCGTGCAACACTGCGCATA CGGCTATAGATAATGcttctttcaaattcaatttgtGTTCTACACCATTA TATGTAATGTCTTTACAATAGTACATAATATTatgaattgaaagaaaaat aatcacaatcaaattttattttttagcctTTCCAGGATCTGTTACAGCTC TATCTAAAAGAACCAAATGTAGGTACTCAAAAAATTTGCATTCCCTATAA GGATACCCTTATTAAGCTCGACcaatatatataaaaataaaaattagaaa atatttaGATGTTGGAATATTTGAATATTTAGTTGGGATTTCTTCGTTCA TGACTATACAATAAGTAGCtaattttaaagctattttctcCTTTCAGTGA TAGAAGCTAGAAGTTTGTCAACACAAGCCTCGTCCAGCTCCACATCCTCC AAGCCCGTTGTTTATACAGATGGTTGCTGCCGTGGTAACGGTAGAAGTGG AGCCATCGGTGGAATCGGTGTTTATTGGGGACCAGATCATCCTAGGTACG CAATAATGTGATAATATTTTGGTTGAATGTATCCAGGAGTTGATTCTTTG CGTTTGTTTTGTTACCATATCGTGTTTTGTGTTGACATTTAAAAATAAAC TATTTCCTTTTCTTAGGGGtttccttttttgatttttttcaggaatATAA GTGAACCGTTACTAGTAGACGAGCCAACTAACCAGAAAGCTGAACTGGAG GTTAGATGAGTACTGACATTATTTAATTCACGAATAGACCTTGTTCTCCA CGTCAATGTGTAGAAATCATTATTTCAATGGATATGGCgatgtcaatatt ttttataggggtcagtagcgtagacaggcgTGAAGGAACAATTgcttagg agagcagatttttacgaCGAAGCACTTACCTACCActtacttgtggtata aaaacaTAGTTACTGTGCTGTTTAAATCTCCTCTCCTAAACAAATATTCC TTCatccctgtctacgctactagGGGTAATTAATTGTTTGATTGCATGAT AAATTGCGTGGTGGATTTTAATCGTAGCTGTTTAGAACATGCGGATCTTC ACACTCCCCTGTATGTATGAGAAAGGAGTTGTCAGCCCAAGTCCGCCATA ACTTTTCAGGCTTTAAGCTTTTAGGGGGTTAACAAAGTTTAAGTTAAAAC ATGTAGTATATCTGATATTGGTTACAGAATGTGGTATCTTCTAACATAAA TGTCAATGCAATGAGTCGGGGGTTTTTATAGGGAGATTAGGGAGGCTTTT CACACTATGGCTGTTATATAATATTCCATTACTTTGTATCCTTCTTTTGC AATATCCAGGCCGCCATCAGAGCGATTGATTGTGCGATAGGAATGGGTCT GGATGATCTTGAATTACGAACAGATAGTACATACACCATCAAATGTAAGA AAATCTCATCATATTTATGACAGTGAAAGTCCTTATGAATTGCTTCAAAC TCATCAAAACTCAATCTCAAATTGTTGCTGCTAAATTGTACCACGTTGAT CTCGACATCATAAGGTAGTATGAAACACCTTAAGatattgataatttgat aaGCTGTAGACCTTTGGTTTAACAAATGGTATAGACTTCTTCAAAAGTAC AAAGGTTTTGTATCTCTTCTTTCCAGCAATGACGGAATGGATTCCACGTT GGGAGCGGAACGGATGGAAAACTTCCAAAGGAACTGATGTTCTGAACAAA GAACAAATGATCCGGTTGAACGATTTATGTAAACGGATTGATATAAAATG GGTGAGGAGTTTTgcataaaaacaattattctacaaaaattcaaaattcc aaAGGGGTTTAAACCTGCATTTCCAGCCACACAGGGATGGACCTcatcaa cagggggtatacggtttttttctggNGGgtttacagcatttccagccaca cagtgatggacctcctcaacaggggtatacgttttttttctgcaaaagcc caagttgaaaaattgaaagaaccAGGACTCTTGGCATGATGCTTGGGTTC AGTTGCACACCCTTtcgatttccttttttttaatcaaaaagcCCTGACCA GGACTTATTAGGACCTCCTATTAGCTAACTTTGAAGCAGATTCACACTAT TTTTATGGTTCGTTTGCTGACTTTAATACACCGTTCATTTAGACGCACGT TCGCGGACACAAAGGTATCCATGGCAACGAAGAAGCAGATCGATTGGCCA ATGAAGGAGCAATGAAAACTTGAAAACGAAGCGTGGTTGTAAAACGGCGA CTAACGAACGTGGGATTTTCCTTAGTGTCACTCATGGTGTAATGTTGGAA ATTCTGTCaaattccaaataaataaatgaagaaGGACTCGCCTACTTTCA GTTATGTTACCTGACAGCTTCAAATGACAATGTTAAAGacaatttaaaca gtattactTGTAAAAGGACATTACAGTGTGCCCGAAAGAAAATGGGACGG ATTTTATAAATTTAGTatctttatttatttaaattttgttcGACTTACCT ACCTAGAAACACTGTAGTTTTTGTTAATGTTTACCATTTGCAATACGGTG TTTTGTCCTCGTTGTGGACAATTGTATATCATCCACAAATGCTCTGCtga gaaagaaaaacttttaaataacaATAATATAGGAACTTTAGCATCATCG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000598XLOC_000598Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001056-exon-sc0000007-1491911889:1106757..1106927TCONS_00001056-exon-sc0000007-1491911889:1106757..1106927Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1106757..1106927TCONS_00001056-exon-sc0000007-1510915933:1106757..1106927Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1106757..1106927TCONS_00001056-exon-sc0000007-1575043694:1106757..1106927Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1491911889:1113232..1113273TCONS_00001056-exon-sc0000007-1491911889:1113232..1113273Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1113232..1113273TCONS_00001056-exon-sc0000007-1510915933:1113232..1113273Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1113232..1113273TCONS_00001056-exon-sc0000007-1575043694:1113232..1113273Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1491911889:1113545..1113614TCONS_00001056-exon-sc0000007-1491911889:1113545..1113614Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1113545..1113614TCONS_00001056-exon-sc0000007-1510915933:1113545..1113614Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1113545..1113614TCONS_00001056-exon-sc0000007-1575043694:1113545..1113614Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1491911889:1114233..1114274TCONS_00001056-exon-sc0000007-1491911889:1114233..1114274Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1114233..1114274TCONS_00001056-exon-sc0000007-1510915933:1114233..1114274Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1114233..1114274TCONS_00001056-exon-sc0000007-1575043694:1114233..1114274Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1491911889:1114454..1114601TCONS_00001056-exon-sc0000007-1491911889:1114454..1114601Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1114454..1114601TCONS_00001056-exon-sc0000007-1510915933:1114454..1114601Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1114454..1114601TCONS_00001056-exon-sc0000007-1575043694:1114454..1114601Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1491911889:1114749..1114806TCONS_00001056-exon-sc0000007-1491911889:1114749..1114806Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1114749..1114806TCONS_00001056-exon-sc0000007-1510915933:1114749..1114806Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1114749..1114806TCONS_00001056-exon-sc0000007-1575043694:1114749..1114806Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1491911889:1115416..1115500TCONS_00001056-exon-sc0000007-1491911889:1115416..1115500Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1115416..1115500TCONS_00001056-exon-sc0000007-1510915933:1115416..1115500Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1115416..1115500TCONS_00001056-exon-sc0000007-1575043694:1115416..1115500Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1491911889:1115733..1115857TCONS_00001056-exon-sc0000007-1491911889:1115733..1115857Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1115733..1115857TCONS_00001056-exon-sc0000007-1510915933:1115733..1115857Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1115733..1115857TCONS_00001056-exon-sc0000007-1575043694:1115733..1115857Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1491911889:1116249..1116755TCONS_00001056-exon-sc0000007-1491911889:1116249..1116755Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1510915933:1116249..1116755TCONS_00001056-exon-sc0000007-1510915933:1116249..1116755Clytia hemisphaericaexon
TCONS_00001056-exon-sc0000007-1575043694:1116249..1116755TCONS_00001056-exon-sc0000007-1575043694:1116249..1116755Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1106757..1116755 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
4.83923 5.52339 16.0585 10.5026 0 2.3628e-06 2.39325e-08 0 0.441096 1.96976 0 0 0 0 0 0.737149 0 0 0 0.38803 3.77452e-08 0 6.94001 0 3.63914 1.54266 0 0.595 1.12447 2.50882
Blast
BLAST of TCONS_00001056 vs. Swiss-Prot (Human)
Match: RNH1 (Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 9.382e-39
Identity = 76/142 (53.52%), Postives = 94/142 (66.20%), Query Frame = 1
Query:  385 VVYTDGCCXXXXXXXXXXXXXVYWGPDHPRNISEPLLVDEPTNQKAELEAAIRAIDCAIGMGLDDLELRTDSTYTIKSMTEWIPRWERNGWKTSKGTDVLNKEQMIRLNDLCKRIDIKWTHVRGHKGIHGNEEADRLANEGA 810
            VVYTDGCC  NGR     GIGVYWGP HP N+    L    TNQ+AE+ AA +AI+ A    ++ L L TDS +TI  +T W+  W++NGWKTS G +V+NKE  + L  L + +DI+W HV GH G  GNEEADRLA EGA
Sbjct:  141 VVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVG-IRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGA 281          
The following BLAST results are available for this feature:
BLAST of TCONS_00001056 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RNH19.382e-3953.52Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV... [more]
back to top