Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001030 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001030
Unique NameTCONS_00001030
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3916

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001030 ID=TCONS_00001030|Name=TCONS_00001030|organism=Clytia hemisphaerica|type=transcript|length=3916bp
AAGAGATTTGTCAATGATTTGTTAAGTGCTCTAGAATCAAATCATCCTGC
AATAGCCTTGGAGTATGTCAATATGATAAAGTAAAAAGatacttacattt
tttttggttttaataGAAAATTTCCTAAATTCACAAAATGTGATCTTGAT
CTGTCGAAAATTCAATATGGGTCAAATTAGAACATTTGAATACGGGTGCG
GGTAGAtgtagaaaatcaaaacattgcttAGAAACTGACCGTTTCAGTTG
CGTGTTTAAAGTCTGCCTTATTATCATATGCTTAGTTGGTCATTATTTTA
AAACTAACATCACGTGACCTGTTCTTGAAGAAGGCTAGTTAACATGGCGG
CGACGTCGGAAAACAATTTATCTAACATTGCAAGAATTTCTGGAGGAGAT
TTGACGAGAGAACATCGTTCTCTGACTATCGACAACCTTAATTGTGGAGC
AGAAGTAGATACAGGGCACTTTCAAAGCAATGGCATCAGGGCTTCGCAGA
TACTTAGCGAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAA
CAACTTCAAGAAATGACAAATATGTACAATACTGGAAACTTCGCCCATCC
ACCTTCCATCTTGTTTGAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAA
CCATCAGCAAGCAACGAGATGAATACTCAGATGCAATGAAAAATGGCACC
GCCCCTCCACCCGTACCGCCCCAACAACAAACTTCCACAAACTCTAATAA
TTCAGATTCTGACAGTCAACCATCCTCACCTAACTTAACAAGAAGCACAT
TAAACTCGTTCAGCGATGGAAGTTACAACCAAAGCAATGGAAATTCCCCT
CATTCTTCGCTAAGAGCGCACATTCGTGCTTTTCTACCAAATAATCAAAG
GACTATGATTAAATATAAGCTTGGACAAACGGTGAGAGAAGCACTTTACA
AAGCAATGTCGCGTCGTTCACTGACCACTGATTCCTATAGAGTTTACAAC
AAAGCAAATCGAGAATTAATCGCTTGGGATTCGGACGTCTCACTTCTAGA
TGGAGCAGAGGTGATTGTCGAGATGATAGACGAGGAAGATCCAAGCACCC
AAAATATTTCACATAATTTTGTGCGAAAGACATTCTTCCGGTTAGCGTTT
TGTGATAAATGCACGAAGCTTCTAATCACGGGATTCAGatGCACAACATG
CAATTATCGGTTTCACCAGAAATGTGCTCAGGGGATACCTCCTCTTTGTG
AGCAAGCTGAACATTCACAGATTTACAAGAGGCTACTAGCAAAACAGAAT
CCAAACAGTAACACGAATATCCCTTCAACACCTCGACCAATCTCTCAACG
CGAACGTTCCATATCTGCTCCCAACGTTAATATGATCGGACAACCTGACT
CGGGACTCATTGAGGCGGTTCTtgaaaaacattacaaaaacCGAACCAAT
CAAGAAACGGCAACTATATCAGgtGGTCTCACACGTCAAATGTCAAGTGG
ACCAAGTAGCGGGCGTGGACGGATAACCAATACTCTCTTCACGCCCACTA
GCGTTAGTGCGCCCAATAGCGGCGAAAATTACTTCGATTTCAACACTGCT
AACAGTTTGCCCGCACCAGGAAATTCCAAGGCACAACAAATCTCCGGcat
tcctgactcgctaatacaCCCGGCACGCGACCGTAAAAACCGGATACGAT
CGTCTTCGGAAGAACACAAAAAGCCTCGCCGTCGCGATTCGAACGATGAT
TGGGAGATTTACGCAGACGACTTGAAGATCGGAGAGAGGATAGGATCAGG
CTCTTATGGAACTGTCTATAAGGGATACTGGCATGGCACAGTGGCGGTAA
AAACGTTGAATGTGAAAGACCCCAATCCTCAACAACTATTAGCATTTCAA
AACGAAGTCGGAGTTTTGCGAAAGACTCGTCATGTCAACGTTCTACTATT
CATGGGTTGTCTCTCCTCACCTAACCTAGCTATCGTTACTCAATGGTGCG
AAGGTTCCAGTCTCTACAGACATTTACACGTTTTGGAGAAGAAGTTTCCT
ATGCATAACTTGATAGAAATTGCGAGACAAACTGCTCAAGGGATAGACTA
TCTTCACGCAAAACAAATTATACATCGTGACTTGAAGTCAAACAACATCT
TTCTACAGCAGGATTTAACAGTGAAAATTGGAGATTTTGGGCTTGCTACC
GTCAAAACAAGGTGGAGTGGTGACCATGGCTGTGAACAACCTTCTGGATC
CATCTTATGGATGGCGCCGGAAGTCATCAAGATGCAAGACCCAAACCCAT
ACACTTTCTTCTCAGATGCTTATGCATTCGGCATTTGTATTTACGAGTTG
ATCACCGGCTCATTGCCTTATTGTAACATCGGGAATAAAGATATTCTTAT
ATATAGAATTGGGCGTGGTTTTATCCGCCCCGATCAAAGCAAGATTCGTT
CGGATTGTCCGAAAGCTTTGAAACGATTATACCTGGATTGTATTAAGTAC
AACCGAGACGAAAGGCCGCTTTTCAAACAGATCGTGAATTCTTTGGAAAC
CATATTGATGGCACTACCTAAGATTACGAGGAGTACTTCTGAGCCTATTT
TAGGGCGTGCAAAACCGAGCACAGATGTTGAAATTGCTTACCCATGCCCC
ACCCCTCATACGCCCATCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGG
CCAACCGCAACCTGTGTATTAGAGTGCTTTTGAGTGAATCTAGAATGAAT
CACGAAAATggaatgaatgaatggatgaaatgaatgaatgaatgaaaatt
caaaGGAAAGTTGATTAACGTagcaatcaaccaatcaaagaAATGCCAGT
GCCAAATAATCTGGTTTCAGAATGATCccaaatcttaaaccaatcttTTT
TTGTCAATCTTTTTATAACTATACTTCATATGGCATAAGTGTAAATTAAT
TCAggtgaatttatttatttatttaaagtaaaaaaaaacactaaaattcc
tgcataaaattttgattttgacaacaGTCTGAACAGATTCGAAAATTAAG
GTTTCAGTATGGTTAATATGCATCAAAATATTAAATTCTTTTCGAAGCGC
AACCCTTTGAAAGTAGTATCATTTTATGGAAAGTCTCTTTTCCGTTGTTT
GAAAGGAGTGTCATGGGTGTTCCACTTTAAGTACTTAACTTGGTTTTCGT
AGCTTCCATTTTTGAACACTTCCATAAATTCACGATTATGAAAAGTTGCA
ACTTTCTCACGACCCCCTGTGTCAGCTAAATTTAACTTTCATCATAAATT
TTATGTTATCACTTTTTTATTATGATAGTAAACTTCactgatttttttcc
ttttttaagtGCTTTTAGTTTCAGATGAgaaatttttattgtaatttttg
tCAATTCCTTAATTTTATACTTTAGAATCATTAGAATTATTGTTTTAACT
TCAACattttaaaagtgaaattttatgCCGTAACTCAGGCCCCATCTTAC
TTCGACTAGGCTAGACTAGAAGTTATACGGTTAAAACTCAAAGAATGGCT
TATCAGCaaagccttttagaaaaaatagatttaaatTTGTTATTATTTAG
TTTCTAATTATTTGgtatttgttttttgtttactttattacttttttgtg
tAAATAACAACATGTTTTGGAAACAGGGTGATGGAATTTAATATGTAGAT
ATCAAAAATTTACCCCTTCTATAAAAAAACTAacataaatctttttttta
tagattagttttattaactgttcttCTGTTCTGTTCTTTATCGGTTAATT
CTCCTACAGACGTTCTTGACTGATACCAAATTGCTTCGAATGATTACCAA
TTATCTAATAAACGCCCTTCAAAGGATTGAGCCTCCTTCTGGATTAACTT
GGTCCACCATTAAGGT
Run BLAST on NCBI

protein sequence of TCONS_00001030-protein

>TCONS_00001030-protein ID=TCONS_00001030-protein|Name=TCONS_00001030-protein|organism=Clytia hemisphaerica|type=polypeptide|length=792bp
MAATSENNLSNIARISGGDLTREHRSLTIDNLNCGAEVDTGHFQSNGIRA
SQILSEAQNVEELFQLTSEQLQEMTNMYNTGNFAHPPSILFEEIEELKTK
LGTISKQRDEYSDAMKNGTAPPPVPPQQQTSTNSNNSDSDSQPSSPNLTR
STLNSFSDGSYNQSNGNSPHSSLRAHIRAFLPNNQRTMIKYKLGQTVREA
LYKAMSRRSLTTDSYRVYNKANRELIAWDSDVSLLDGAEVIVEMIDEEDP
STQNISHNFVRKTFFRLAFCDKCTKLLITGFRCTTCNYRFHQKCAQGIPP
LCEQAEHSQIYKRLLAKQNPNSNTNIPSTPRPISQRERSISAPNVNMIGQ
PDSGLIEAVLEKHYKNRTNQETATISGGLTRQMSSGPSSGRGRITNTLFT
PTSVSAPNSGENYFDFNTANSLPAPGNSKAQQISGIPDSLIHPARDRKNR
IRSSSEEHKKPRRRDSNDDWEIYADDLKIGERIGSGSYGTVYKGYWHGTV
AVKTLNVKDPNPQQLLAFQNEVGVLRKTRHVNVLLFMGCLSSPNLAIVTQ
WCEGSSLYRHLHVLEKKFPMHNLIEIARQTAQGIDYLHAKQIIHRDLKSN
NIFLQQDLTVKIGDFGLATVKTRWSGDHGCEQPSGSILWMAPEVIKMQDP
NPYTFFSDAYAFGICIYELITGSLPYCNIGNKDILIYRIGRGFIRPDQSK
IRSDCPKALKRLYLDCIKYNRDERPLFKQIVNSLETILMALPKITRSTSE
PILGRAKPSTDVEIAYPCPTPHTPIQGQDVFSFLSGQPQPVY
Run BLAST on NCBI

transcript from alignment at sc0000007:790173..815156+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001030 ID=TCONS_00001030|Name=TCONS_00001030|organism=Clytia hemisphaerica|type=transcript|length=24984bp|location=Sequence derived from alignment at sc0000007:790173..815156+ (Clytia hemisphaerica)
AAGAGATTTGTCAATGATTTGTTAAGTGCTCTAGAATCAAATCATCCTGC AATAGCCTTGGAGTATGTCAATATGATAAAGTAAAAAGatacttacattt tttttggttttaataGAAAATTTCCTAAATTCACAAAATGTGATCTTGAT CTGTCGAAAATTCAATATGGGTCAAATTAGAACATTTGAATACGGGTGCG GGTAGAtgtagaaaatcaaaacattgcttAGAAACTGACCGTTTCAGTTG CGTGTTTAAAGTCTGCCTTATTATCATATGCTTAGTTGGTCATTATTTTA AAACTAACATCACGTGACCTGTTCTTGAAGAAGGCTAGTTAACATGGCGG CGACGTCGGAAAACAATTTATCTAACATTGCAAGAATTTCTGGAGGAGAT TTGACGAGAGAACATCGTTCTCTGACTATCGACAACCTTAATTGTGGAGC AGAAGTAGATACAGGGCACTTTCAAAGCAATGGCATCAGGGCTTCGCAGA TACTTAGCGAGGTTAGTTAAACCAAAGGGGAAACCCCCATATTTTTTATT CTGCATATCTTTACACACAGCTCATTTGCTGTATGATCATTATTGCATTA TTGAGAAATCAGATACCAAAATCTACTGATCAAGAAAAGTATGATAGTTT CATATGTTTGAATTTTTCACTTGTAGGGGCTTGTAAAATGGGGAGAAGTT AGTATACATGGCATAATCTCCGATTGGGGAAAATAAACTGGAAATTGAAG GTACATTGgggggccattccagaaaactttttttacccCCCGTCGGACAA Tgtgcatttttgaattttttctagccttggaaataatttttcttttccag tggtggtcggaaatacacctttcccgtaattcgtaaaactaatgcgcgcg cattattttgatgctctccaccgtttggtctctggaggtaaacaaacctg cttttgcctgcgttcccttagggaaagttggttttttgagattttcttaa GTTTGgtcgaacaaaatcccctcaaattttagtatgttcaatctatttat gatattataccaccctgaaaatattttgccaaaagaaggtcgctgtcaaa agttagaggctcaaatcccactttccctaacccctcgcaggcaaaaacgc gttttttacctcccaaacaattttatacacaacggcggagcgcacatttt cccggccatttctgagaaatttgaattacgggaaaggtgtattctgataa aaatccatgtacttttgcaaaatgcatcggaaataaTTCCACTCTTTTTC CAAAACATGACCCTAACCTGTCCCACACATGTACTGGCCAGGTTTTCGGA GTTGAAAATCCAAAGTTTTTGTGGCCCGAACTTGGCTAGATCATCAATAT GTTCAGCGAACTGAGAGAATGTTCTGATATTTTGGCCTGAAAATATTGGT AGTATATGTCATTTATGCTGCAAAACCTCGCGGCCATTAATTCACCCCTG ACCGTTGCACTTTTCTAACGGgcagtctaagcttaaactcctatatcagg attagaaactaggctagacTTACGTGAAATCGGGTAActtacatcagtgg aggcaaaaatgcatagccctcaatcaaatgaatgacctgtctggtcatta aaatacacaaagttaaatcaaaacaaaaatgatagagtagatctgcatag ttcatttgttttgaaattttgctgctcacattggtcagtcatttgaaggc tatgcatgttacacaagtgttacgcgtgaGCCAAATCGCATTaagaacaa cctctaaattgctgagtacaggagaaaaaaaatcgaaattcaaaatggcg gcaaagcccacgctgataactatcaaaaatctctgctcaataaatcaata aaataatttgaaataaaaagtaaacaaaccttgaacctttcaggaatcca aataaataaaagtacaATATAAAAGTACAAATAGTAAGTACAAACAGTAA GTacaaatataaaagttttttttttaagaaactagttttaccaagcagcc tcaatgtttcttaagaaatcggccttttgagccttaaatgtttcttacat gtttctaaactttttgacgtaATCAGCCttatggaaggctggattggaag gttcttaaaaaagcTGAATTAgaattattttctcattctcagtcTCAGCa tgtttattagtttttaggcattctgagcctcgtgtttcttaaaagtgtgt ttcttaaaaaaaaacaatgtgtgttcatctaaagtgaagattacatttca aaataaaacgatttccaaaccaacctaaagtcagtgtctgccaactaaaa atttctctgcggggtcactgccaaggagttacgacttcagactttagatt ccaattcttgtataggctgcaactacacagccaaaatgatctgtattaca aatacttccaaatgggtccataagttaagaaaatgaaattatcatctagc agggggttttgtttttaaaaacaaacttcaaaataaaattgttaatgaac tttttactttaaaaaatatcacttacttacataatttatttatgatataa catataAATGGTATAAAtggccgcaagaagggagaaaaatttaattcgac CCCCGgttttatctttctttttctatctggttcccgcgtgttagtgtaga cacaactttaatccagggaaatgaagcgttttcattggtctaaaatcacg gatggtcacgtgaccagaatttttatccagggaaatgccgtggccgcaat gttttgctttagttaGATTGagcattttgttgttttggatttgagcgggc gaaatttctgtacaaaccaaaatattcattggaataccggttgaaacact tgtggtTAGCCTCTACTACTGATGCAAGTCACCCTTTATTACGGTACCTC TTATCTTTCcctttaaaacaataaaatgcttacaagttgacacaacacat tgacaagtaatcaagtttatatcaaaatcttcaacaaaaacgaaagtggt ctcttctactgattgcttcctggCGCTCCTTTGCagttgtttatcaaatt tccactaATGAGATTGCCACATTTCACacagcccttctttttggcacctg tggcctctcagtgccttgcaaaATGAGTGGCTGTAAAATTCCACCCTTCA CATATTgctttcaatccgtgatcctaaTGCTTcggttttttctcattttc gatttactgaagaaagcaagaatttgatgcaagagttagattgtcaacaa agtgccatacGAAATCATGTaagaaatcattgaataaaagaagaacttaa atcttaaatactttcattttgaagaattggtgcaaaaagtgaaacatgga aaagctTCATCTTTTATTGGTTCAATTGAATTAGGGGATTTAGAAAACTt tgtatgtttgtttttttgcccAAACCCCTGTATTTATGGGCTAGCACCCG TTGCTAAGATattggcttgaaattgaaagtgaaagcactgaaaacgaaag taaaatcgacCCGCACTCcgaatcccgtaatcttgataaaGGATAGGAGT TTAAAAAGTAAGACTGctgggtgcgccacaaaaaggtttctttttttgaa aacttgattttctcgagttaTATTAACTAGATAACTTTCAAGAGAAAGAA ATCCTTTTCTGTGCCTGTGTTGCGTTCATTAAAAAAGGAAGGCAAACTTG AATCGCTCAATGAAATTTAGTGCATAGAAACCACCCCCGCGTGAAGTTAA CAGATCTGGAAATACAACGCTagatttttatggatttttgtAGATATTTG TGTTGCAGAGCGCGCATGTTTCATTGCagaattattttcatatttcaatt ttaaaaagccTACTTGGTGTGAAAGTATAATTgggtattttttaatacgc cattcattaactcaaatcaaacgactttggaggttcagtgaaatggtgga cgaaatgaaaaaaataaatgctcaaaaacattcaaaatcataaaatatca aatttttaaatAGAAACATGATCACATTATATCAGTATTGTTGTTTTAGT CCTAAAGAtaataattagctgtctaactGACCTTTTGTTTTACAAGGGTT CGCTGACAAATCAATTTTTGGGATAGAAAAACATCAATTGACTCACATCC ACCCACCCACACCCTAAAACATCAAACACctgaaaatcaatgaaaaactg CCTTTATcgctgtttcgtcagccatcttgattttcgCTACAGCTCACATA GTTTATatgtatttgaaaaataacagacataatttctaaacttgttcaca aaattccTGTAATTCATTATCTCAGCAGTAtatagcaaaagaaaaaaatg ccatctgcaaaaattcaagggcTGTGCGAGTCTTCAAGCAAAGAGAAGAC CTTTTTGGGCTGTTTGTTTTGGAGTTGTTTTGAGGCGATCAAACAGAAAC ATGGTGAGAAGTAACATATGGCGTGAAATGAAAAATCAATGTTTctggat ttgaaaaaaaacaacgtcaACAACCTTCAACCCACCCGCCCACTAACGTC AATTGAtgtttttctaacctaaaatcgatttgtgagtgacccctgaagga aagttgaatttctactaaaggaagaaaatttgtcagaaaatgccaaaaat tctGGTGTTTGTCTGGTGTCAAAATTCATGTAATGTAACAACGGACTGTT TTATCCGAcataatttaataaaatcttttctgTGCATCGTAAAGGTAGCA CTTTTCTGAGAGATGGGCCATTAAGTGTTTTTGATAACCAAATTGCACGT ACGTGATTTGAACCAACATCATATCAAAGAAAGACCCAAATTTTCTAATG AGGTTGGCAGAATTtagtaaaaacattttttggctgaaaaaagaCGACAA NctttttagcttgaaatagaAACATTGAGCaatctcgctggggttatttt gtctttttatgttgaatattagtacaagacaccatttagaaaccattttg accctttactgggctttcatagtcttaaaatgggcaaaaaatgccatttt tactcattctttgctttagtgcgaatcaaagacccccctggggaatgctg gattttttacctaTGAGGTATATAGCCttcagtaattagttcttacaaag taaacaagggatggcgcacattATGAGCatagttatttttcttataagca tctactttttaagaatcttatcaataactcttgatagacggtgatatagc cttcggtaattagttcttacaaagtaaacaagggatggcgcacaatatga gcatagttatttttcttaccgggtgacccacgaaaaagttcagatgTTTC Ccaacgtcttgaggccgaacaaatgtcccaaagtgcttgaagttttgata tttaaaaagtagatatcctaacttaaaatttgagctatcattgtttaaat ttgaccaaattgttctctgcttatgagcttttaaagtcaaaattcacttt acggaaagtgtaaaaaacacgtaaaaaaggggtatcaaatttggtatttt tagacgtttttgatNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNgaatttaatacctcttttttacgtgttttttacacttttcgaaaagt gaattttgactttaaaagctcataagtagagaacaagttggtcaaattta aaaagtgacggctcaaattttaagttaggatatctactttctaaatacca aaactccaagcactttgggatatttgttcggcctcaagacgtcgggaaac gtctgaactttttcgtgggtcacccggtataagaaaaatttttttctttc ttatttttcttttctcttgtgagaagggggtgtttaatTTATGACCAAAA ACTTTCAATCTTTTCCTTGTAGTAGTAGATCTTGAATTAGCTTTCATCTC AACTACTTGTTTTTCTATGCAGTTTGAAtactaggcgaaattttcgactt aaaGTCGTCTTGTTGCTTTTATTATtacctttttttaattctagTTCAAG TGGATAAATgtctttcaaatgttttttggacctacctaaggtagtccttt aaattaacccttgtccgttcgtccgttcgtccgttcgtctgttgccagct tttctcgggatcggctcattattcttttttctttttttgtacaatgatac aaaatagcaatgcctaaaaagtgacggagcccgattttgaaaaaaaaatt tggggtaaatttgggccaaaaactacctaaaaNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNtagttttttctgattttttgctcaaacatgcgtattaacaatgccca aaacatggtctagtccgatttctgagaaaaaattttttccggccgaaaat gccggaaatatgccggaaatcgccgtttttctggattttcattggacttt tccatataattggttgttttttcattcaaNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNtttgaagccggaactttctaaaaatcgc cggaacagccgattttcgccggaaaaacggtatttcttgaatttcttgag ctgtacttcatattttttcatgaaactttgcacactgatgcaaaatgtca atacctaaattgtgacggagcccgattttcgaaataattcatttccggcc gaaaatgccagaaatatgccggaaaaactggttttttggcattttctcga gattttgtcattagttttttctgattttttgctcaaagatgcgtattaac aatgctcaaaacatggccgagtNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNACAACAATCAACACaggagaaaa aacaattttccattgagAACTTTATAGCTGATTCAACTTGATTTAACAGA ATCGATATTGGAagacaataaatttttttgatttaattaCCCATCCCACA CCAGATTTAGAAACCGACGAAAGCTGGCTAGGGTAACTCGAAAACAGGAG TCGACTTTGGttgactatcttttttaaaactgaGATAGGTTTATGAGGTA TTTTTGTATAAAGCCTAGAAAAGTCAAAGATTGAAATTGACATAACTTta gatttttaaagtttttgaattgctGAAACAAGGGGTAACGGTGACTTTGC ATTATAAAGATCGATTTgatggtgaaattttgaaaatggttttgTTTCAC AGACTGGAGCAGCGATAATAAAACGAAACTTTATGGgctttttatgcatt tttggcAACCAAGAAATATGGGGAATGCACTGATTCTCTTCTAAACGatt aatttgaaattcattCTTCAGTGTACCTAGCTGTCTCTGAATATGGTCAT CTTGAGTACTATAATGTTGCTTTTATCTATTATTGGTGTCCTCTTATAGt ccaagttttttttaaagtactAATGCGCAAAATATTTAGCAAACGAAAGC AATAATACCAGTGGGATAACTTTCCCCCTTCAGCCCAAAAATTATCCATC ATCATTGTTCTTCCTACACCAGTCCTTACGGAAGAATAAATTCTGGCACA AAACTATTGAATTATCTATTCTGGACGAAATAGGAGGAAGCAAGTTGAAA ACAATAACAGGCAATTCAAAAACCTCATCGTCAGATGGAATAGACTATCA CACTCTTGATTGCAATATATGACCAACaattataaataaaactttacaaa tattttgAGGATGGTATTTTTAGACCTCTTTTGTTGTTTGCTTAATCAGG GACACAATAATTGTAGGTTAGATAGCTCACACCCAGAGAGCATTAAAGTT GAAATGAGCTTTCAATTTATCTGAATTTTTGCCTACTTGGTTCTTGCTTA ACTCTTACTGTCTTTTCTCTAATTTAATGCGTCCTCTAATAAATGCAGAT AACTTATTTAGATAAGTTCTGGTTTTAAtatactttctttaaagaagtat ataaaaaatatatataaagagTGGGGGATTTAGGGAGATCAAAAGGGGAT ACTCCTTCTATGCTTTGCACATGCAATATGATAAGCAATTGGTAAATTTT TTCATGTAGGATATTTTAATTTGGAATTCAACTGACGCTGTCTTCATCTT TTAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAACAACTTC AAGAAATGACAAATATGTACAATACTGGAAACTTCGCCCATCCACCTTCC ATCTTGTTTGAGGTAAACTTCACTTTTGAAAATTAGTAAGTGAACGTCTT CAGTGCTTAGACGAATATATCTTTGGAATTTTGACATcttcaattttatc attttagttGAGAATCATATAACTAGAATTTGTAACTTTCTGCTATCTAA CTAGCCCCTTCTTAAAGGTTGTTGATATTCttctatttctattattttgt GAGGGAGTTCCATGTGCCAAATACATAACAATTAAGGGTTCTAGTATTTT CTAAattaagaaaaaagattttccttcTTCAGACTgtagtttcttgattt ttataaTTATCATGGACGGTTTAGATAGACTAATCACCCACACACggaag tttgttttttattgtttgtgTTATAGCATGAGTGGGATTAGGTGGGATCG TACGTTGGGCTTTCAGAGAtattagatttaaaaaaagattagtTTGTATT TCCAGTGACGGTGAAACTTTCCACAAGTTTGGCATAATCAGATAGCTCGA GATTTTTGGGCTTTGAATTCCATCTATATTCCTGATTCAAACTGACATAA CACATTGTGAAAATCTATACTATTGTACTCTTGCTAAACGAGAATTGGCT TAGGACCATAGGAGGGGGATTTAAACGATCTCAAATCCATTTGATTATTA CTacatatttttcaagttttgatcGCACATTCTGTGACCATTTCATTTTC TTAGAATTAAAACTCTTTTTGGTGTTATGAATAaaagacctctacaaaac cctcTTTAGGTAGTGTAAAAAGGTTAGAGGTTATCGGTTAGAGGTTGCTA GCAGCATCGTTTTGGTCGTTTGTTTCGTCTTGTATTTTCCTTGTATTGTA ATCTTTACAATATTCTCTTCATTCATACGATTGATCACTTGTACATTATA CTTATATAAAGAAATTTCCATATAAAGAAGCTTCTCTTGTTTTGTGGGTG CACCAGGAAAATAAGACAACGAGAGACGAATAACTACAGATTGTGAAATA ATTTGGTTTTATACTTTGGTTTTGACCCTTCTTTCAAATGATATTGTCTT TAATCGTGAATCTGTTTCATATAAAGTATTTATATAGTCGTATGATGAGA TGAAAGAGAAGATGAAAACTGATTATCGTCTGTTGTGTTTCGtttcttta ctttcttttcCACACTccaatattttttgaataattccCCTTCATTGTTT GGTACCATTGTATTGTTCTTTACATTATTATCATGATCGATAGAGTTTTG ATAGATGTGCGATTCAACCTTTCAGAGAAGAGGAAGGGAACAAAAGACCT CTTTTTGTTTGCTTCAGAAACACTGAAGAACGATGTTGTTAAAGAGACTG AAGAGATAGAGAAGAAGTGCAATCATGAATtgataatatatattttattc ttcatttttcactGTTTGTGATCTAACTTAGCTGGAGCAGTTTTTCTTTT GCATTAAGTGGAGATGGAAAGGTTATAAAAAGCATCAACCTTCAAATGGA TTTGATTTGCGCGAGACTCTGTATCATGTAATCCACTATTAGGTTTGCGA TTCCTTGGATGCATAGCTCTTCTGGAGATatctctctttaaaaatttcat atttatgTTTGGAAAGATTTAAGTTTTTAACCGAATTAAGAAATACTtgg atgaaaaatttgaaattatgcttttttGGAATTGTTTTGAAGCTTTTTGC ATAAAGGGCCACTCCTTCCTGCTCCTTCATTCATTCATATTATTTCTTCA GTGCATAGTATCATTTTGCATTTTACATCTTATTTTTCTTGCAAAAATGT GCGAAGAAGCCTGACTCATACTCTTTCTGCAGGCGAGAAAATATAAAACC CTTTCAAAAAACCCTTCTTTATTTGTTTACGATTATTAGTACAgcttttg aattattttattcaatatCTATTTTACTCGCAGGTAAATGAAGCCTGTTT TAAAGTGTTTCTTTCATCGAATCTGCACGAAATAGAAGTATTGTAAAAAG AGTTGTTTGGAATAATATTTCTGCTTTTTGtcgaacaaaaaaatgaaaaa ctttctatGGAACATTCTCATATGACCTGCTTAGAGACCTTTGCGAGATA TAGAGCTGGAACTTTTGTATTTTGCATAAGATTTTGCAAATTTCATCTTA GtttgattgaaaaataaaaagtcgCAGTTGAAAAAGATTGTTGCAGCTAG ATACGAAGAGAACAGTTTGTGTCATAGTCGAAAACTTTATGACTTCTTGG AGTGAAACCAAGATATCGTCATCATTATGCTAGAgacattttatttcaaa atctcCCATCAACAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAACCAT CAGCAAGCAACGAGATGAATACTCAGATGCAATGAAAAATGGCACCGCCC CTCCACCCGTACCGCCCCAACAACAAACTTCCACAAACTCTAATAATTCA GATTCTGACAGTCAACCATCCTCACCTAACTTAACAAGAAGCACATTAAA CTCGTTCAGCGATGGAAGTTACAACCAAAGCAATGGAAATTCCCCTCATT CTTCGCTAAGAGCGCACATTCGTGCTTTTCTACCAAATAATCAAAGGACT ATGGTAAGTAGAACATATTAGATAATGTAGATATCATTAAGAATGCTTGC TTGATCATGGACATACTTTTACATAATTTTTTGATCCATTTATCTATCTG CTACACTTCTTTTTGCTTAATCTTCCTTCTAAAACCTTTACAGATTAAAT ATAAGCTTGGACAAACGGTGAGAGAAGCACTTTACAAAGCAATGTCGCGT CGTTCACTGACCACTGATTCCTATAGAGTTTACAACAAAGCAAATCGGTG AGTTTTGGGATTTGGAAATTACCTGCAGGTTGACCAGACAGTTAATAAAA ACATCGACGATTATCGACGCCTTCAAGTTTCAAATCATATGTTAATGGTG TTCTAACTATTAATAGGTTCTCTTATCCGATTTCTATTTCAGAGAATTAA TCGCTTGGGATTCGGACGTCTCACTTCTAGATGGAGCAGAGGTAGGAATC GAATAATGTAAACTCGTCAACTTCAACGACTCACGTATATGGCTATCCTC CATAGTGGATTATTTTGGTTTTCTTCTTCAGAAAATGAATTCCTTTTATC TTCTGCCCCGAAAAGAACAATTAAAGAAGCAGAAACTTCTGGGTTCTTTA TATTCACTTTTTACTTTTCTAATCAGGTGATTGTCGAGATGATAGACGAG GAAGATCCAAGCACCCAAAATATTTCACATAATTTTGTAAGTTATTCAGT TTCCTTCCATTGTCATATCCCTGACCTTACTTCATATGCTGCAACCTCGT TTAGTGTTACCCAATACTACGGGTGCATTGCAATCCAGATTCCGTACACC TATTTCATCTCTAGCCATTGATGAATGTTGTCTTTGATTATATTTTCTTC ACTAGGTGCGAAAGACATTCTTCCGGTTAGCGTTTTGTGATAAATGCACG AAGCTTCTAATCACGGGATTCAGGTGAGCACTGTCATTCCatatttttta cccttttttaccctcaacaaaacaaaaaagtcgtAGGTGATAATTGCTTT TAGTTTATTGAAAATGCATtcactttttcgatttttcagatGCACAACAT GCAATTATCGGTTTCACCAGAAATGTGCTCAGGGGATACCTCCTCTTTGT GAGCAAGCTGAACATTCACAGATTTACAAGAGGTAAGAAAGAAGCTTATC GAAGGCTCTTCCGGCTCTTCAGAACAATTCGATTTGAATTGTTCTGAAGT CTTTTAACGAGATTACCCCATCGAAACATATATTCGTTCAATGATTAATT CTTGTTTTTTCCACCATCTTACTAGGCTACTAGCAAAACAGAATCCAAAC AGTAACACGAATATCCCTTCAACACCTCGACCAATCTCTCAACGCGAACG TTCCATATCTGCTCCCAACGTTAATATGATCGGACAACCTGACTCGGGAC TCATTGAGGTATGAACTTCTGTTTCAAAAATCTTGGTACCTTGTATGACG TATTCATTGCCGTTGAAGCCCGAGAAAACGCCTTTATTTATTACAAATAC GCACTGATATAAATTATCTTCTCCATCttcaataatttattttttcattc cttTCAGGCGGTTCTtgaaaaacattacaaaaacCGAACCAATCAAGAAA CGGCAACTATATCAGGTACACATGTACTGTATATTCGTTTTAATCCGTTT TAAATCGAACTTTAActtgtgaaatttttttaattattttagagAGTTGG TTTTTTCATAACactttttcccaaaatattAGATCCGGTCTGAATGGGGA GGCCAGTTTAGCaataatttttctcttttattaattttttaggtGGTCTC ACACGTCAAATGTCAAGTGGACCAAGTAGCGGGCGTGGACGGATAACCAA TACTCTCTTCACGCCCACTAGCGTTAGTGCGCCCAATAGCGGCGAAAATT ACTTCGATTTCAACACTGCTAACAGTTTGCCCGCACCAGGAAATTCCAAG GCACAACAAATCTCCGGcattcctgactcgctaatacaCCCGGCACGCGA CCGTAAAAACCGGATACGATCGTCTTCGGAAGAACACAAAAAGGTTTCTT ATTGATTGAGttattaatgtttttttgttttttttgatcaatttttacGT GTTTACTGCGAAATGTGTGTTTTTCACGTACAAGTATTTATTGACCAAGA CTAAAACTTTGTCAATGATTCATAGATAGATGTTAGACATTTCCGGACCA CCAGACAGCTTCATTTCATATACGAAAAATGTCATTTCTTGTCGTCTTAG ATTCAAAACATAGCGTCGAATAGATGTAAATAAACCTCAGTCTTTATGTT ATCgcgaaagtcagaaaaaaaggaaaaccaaagccaaaacaagtttttct ttGATAAAATGTCTCCAAAGCTTTCAAATTCGAGTGACAGGAGATTCTTT AGACTATTTACCCCTTCATTCTGAAACTCAACTTTATTTGGCTCACAGTA AAGAGGGAGACGTTGTCACTTCATCAGCttgaaaaaggagaaaaagctGA ATGTTAGTTCTTTTCTTGGCTAGTTAACCCCTCCTCCTGAAAGTTATGCA AGGTGTTTTCTGCACTCTTCAAACGTTTCTTCTTGCTTTGCTTTGTAGCC TCGCCGTCGCGATTCGAACGATGATTGGGAGATTTACGCAGACGACTTGA AGATCGGAGAGAGGATAGGATCAGGCTCTTATGGAACTGTCTATAAGGGA TACTGGCATGGTAAGTACTGAAGCAATGAGTTTTTTGAATAAGTGAAAAC TTaatcaaaatattattaaatttcTTTGTAACTCAAACCTCGATAAGCTT GAATGTTTCAttaacttgaacaagttttTCTGTTAGTAAACTCTTTAAAA CCAGTGTCGAAATCTTTATTGCTAGAACAAATTCGCTTTCCCCGTCCTCG TTCGAGCTGAATAAGAGACTTTATAGACGCTATACCATCGATAAGTTAAA GttgatttattttataagagagtagtgaataaatagtttattttAGATTT CATCATTTCTTATTTTTGTAGGCACAGTGGCGGTAAAAACGTTGAATGTG AAAGACCCCAATCCTCAACAACTATTAGCATTTCAAAACGAAGTCGGAGT TTTGCGAAAGACTCGTCATGTCAACGTTCTACTATTCATGGGTTGTCTCT CCTCACCTAACCTAGCTATCGTTACTCAATGGTGCGAAGGTTCCAGTCTC TACAGACATTTACACGTTTTGGAGAAGAAGTTTCCTATGCATAACTTGAT AGAAATTGCGAGACAAACTGCTCAAGGGATAGAGTgagtcttttttcatt tttcgatcaaaactaaaaaatgaaagtttgtacCACGCTGGCAGGGCTCG AAATATTTCTCATAGAGAAGTCAGTTTTCCGGATAAAGATATGAAAAATA ACTAGTGAAGGAATTCCTTTTTCACACTTTCGTTGCCAGTCAAATCACGT CAATGGCCTTCTGCCTGCTTCTGCCGCCTTTTGCTTTTCCTAGCGAAATT TGGGAACTTTGACCTAGAAACTGCGTTTGCTTACGTGCTTGTACCCTGTT GGTGTTGGCGTCGCCTAAATTTCTATTATTAGCCACATGTAAAATTTGCG AAATTTGCGAAATTCTTGCTTTTCTTTCCTGTACCGAACCATATCACCGA GCGGCagcttttttatttccaaaatagGGTTACATTTGGCTTGTACGCCA TACGCCCGTGTGAATTGACAACTTCAAAAAACTTGATAACTATAATGATC GTAAACAGGCTTAACGAGCCATGGTTTGGTAAACAAATACATTGCAAAAA CAGGAAATGTTTTTGGGATTCCTCATCCGGGCTTGTTAATCCTTAATAGT GATCTTGCAAGTAGATGATATGAACTTTCCTTTGTTTATTTATCTTTAGT ATTTTTAGTTCGAATGTTTGTTTTCTATTTGACGTACTTTTTCCATAGTA GTGGTGAAGCCTCAGCAACCAATGGTCATGTGCTGGTTTGGACGCcaata aaatgtttattttctctTTCCTTTTTTACAGCTATCTTCACGCAAAACAA ATTATACATCGTGACTTGAAGTCAAACAGTATCCTTTTCTTATCATTCGT TTGCCAAAAACACAACAATCAAGCCCTTTCATTCATTATTGGCCAATTAT TGGTCAAGATTGGCCAATTTTTGACAGGCCTGCTTTATTTTGAACAACCC ACTAAACCACTAGACGTGAGGCTCTAAGTCTACTAATGCCAACAAAATGC CATTGCAAGAGCATCCTCAGACCAATCACATTTCACGTTTAATTGATAGA AATTTCAATGGGTACATTTCTAagaatatcaaatgataaccTTTTCAGTG GTTCTTCGCTGAATACAGTCTCAGATGAAAAGGGGAGTTAGATTCTTCCT TAATTTTGTATAGGGATCATGCTATAATCAAAAAGGCAACATAGGAAATT TCCTGAGATCCGAAATcctaatatttgaaaaatatgtaaaaGCACTTTTC ACTGTCGAATACAAAAACTTCACAATGTTTTTGGAATCGTTGATACAGTG AAGAAATtatttaggcgtacaaactttcgcgagcagaaaatTTCGGCCTT Ttccgcgaaagtaaatgtctttatcggatttaaggaatatttttcacttt tatccaacgattcgcgaaagtttatgctcgcgaaaaacattttttcctca aattcgcgaaagtaaatgtcgtaaatttcgctatttttcgacctcgcgaa agtttctgctcgtgaacgtttgtacgcctaaagtagtatcaagaaaattt tgaattaaaattgagCGAACTATTGAGAAATGAGAACTGACTTACAATAA AAGCAACTCTTCGACGTAAAAAACTGCGCGGATCAGCAGCGCCAGGACAG CGCATTGTATGTATGAAAAAAAGTAGATCTACTATGTCGTAAGGAGAAGG GCCCATTCTTCAATGAGAAGGATTCATAACCATGGTAGTCTCTCGAACTT TGATTTTACGGGTCATAGTATCACTCAGTCAACTGACATTTAGCCCTTTC TCTTGTGAAACACGAATCTTTTTATTTGACGCAAGTGATACAAAAAATGT TATGAAAGAGAGTGCTGGAGGGTTTAAACTTCGTGTAGGAACACCTATTA TAGTACCATCAAGATGCACGAAGGTTCTTGGCGACATTTATGTGTTCACT TAAGTAGCCCAAGATCTCTCTTAAGCTACACGAGAAACCAAAACCTTTTC ACTTGCACAACTTTCGAGCGCTCTGTTTATGTAATGTAGTCCGTGCAAAA ATAGCCTTCTTGAACTCTCTCTAGTGTGAACATATTTCTCTCTCAGCAAA CAAAAGGAAGTAAACTTAACCAGAATGTCAAGGGCTTGGTCATTTTTGGC AAACCTTTTTACAACTTATTCATTTACGTGAGCCAAAAATTGCCTAATCC GTTGGAGTGTCGTCTTTGCGTAAGCCGTTCACTTTTCtacttatttttct cttttcctctctatttttctttcaaatcttACGTGTTTAAAGGTTTGCAA ACAAGaaggtttttgttttgcttgttaTTTGGTGCCAAACAGAGATTAAT CTGGCGCCATACCACTtatcgaaaaatatcaacattatgATACAACTCAT GATTTAAGTGAATTGGCCTAATTGTCAATCGCGaattttttggataattt tctCCATGATGTTGTTGAGCTTAAGTCGTGCTCACATCACCACATTTTTC GTCATTGGGTGAAAAACAAATCACGTGTTCACACACTTTCATTATTCGCA TCATTTGACTGTCAAACGCTTTCCAACTTCCTTATTTCCCAAAACAAtaa tttcatttataaaaaatgatcATCATTTTACGACCGTTTTGTTTCAACCA GCAAAAACATCCCATTGGTCAGTTTAGCGGAAATCATTTGTTTCTACTAA TCTCTTACAGTGGATAATTTTTCACGTTTTGATTGTTAACTGGTACATTA AACCAATTTAACAACACGTTGAAAGCCCAAAGGCCAAATTTCTAGCTAGC CATTGTATCGCTATGCTCACTGCATACCATTAGTATTTTACTAACTGAAA CAATATCTTCCTTAACTTGCCAACACCTTTTCTAGACATCTTTCTACAGC AGGATTTAACAGTGAAAATTGGAGATTTTGGGCTTGCTACCGTCAAAACA AGGTGGAGTGGTGACCATGGCTGTGAACAACCTTCTGGATCCATCTTATG GATGGTACGTAAAAACAAGTTCTCTAAAAACGGAATTTTCATGATTACTT TATAATTCTGATGCTGATCTTAAGAACAGGAAATGTTTACTCTTGAATTT TCTGGGAGAAAATCCTCGCTGCCAATTTTGTATCATCAAAGGTGGCGCTT TAAAGTACCATTGAGTTATTTTCCGTTTTTGGCTATCTGATGGGAAATCG TAATTCGACTATCAATGTTACAAAATTCCTCATTCgtgataaaatatttc taaatctGAACTTTTACCATTTAGTCAGTGATTATGCAAAACAGTGAGTA ATTTAGAATTGCTAGGGAACTTTTTCTTGATGATTGGGTAACGGTTCTAC ATCTGACGCCTCTCCACCATTTTGTGGGTGGTTACCATGGGTTACCTGCC ACAAATCACATTAATAAATATTTTCCGGAGCTAGGTTTAACGTTTTACGA TAATTGAATATTACAACATACTCACCGTTATCATTCTTGAACAATGACTA TTTTACTGTAGTCTGTACACACTCTAACACTGTAGACTCTCTCTAACATA GCAACCTGATGAATATTACATAAAAATTCTTGAGATAAAATTGCTTGGTA ACCCATATCCTTCGAGGTGTAGCCTTAAGTAATCAATTCTCAGGGATGAG CTTTTTAACTTGTCAAGTTTTAAATATAAGTGATCTTTTACTACAAAACC TTGAATATAATCTGTTCCTCTTCTACTTGATCAGGCGCCGGAAGTCATCA AGATGCAAGACCCAAACCCATACACTTTCTTCTCAGATGCTTATGCATTC GGCATTTGTATTTACGAGTTGATCACCGGCTCATTGCCTTATTGTAACAT CGGGAATAAAGATATTGTAAGTACTACAACGAATTCTATGCTTATTCGAC CTAATAATCTCCAACAAACTATACAAATCTTGTTTATTTTCTACAGGTTT TCTTTGCGCGCAGTTTGGTTTAAAAGCAGATTGCAATAATCCTTCAACAG TGCTTTTCAATTCAATACTCCATTTTTCTTTCAGCTTATATATAGAATTG GGCGTGGTTTTATCCGCCCCGATCAAAGCAAGATTCGTTCGGATTGTCCG AAAGCTTTGAAACGATTATACCTGGATTGTATTAAGTNaaataaatattt tctggaGCTAGGTTTAACGTTTTACGATAATTGAATATTACAACATACTC ACCGTTATCATTCTTGAACAATGACTATTTTAACTGTAGTCTGTACACAC TCTAACACTGTAGACTCTCTAACATAGCAACCTGATGAATATTACATAAA AATTCTTCGAGATGAAATTGCTTGGTAACCCATATCCTTCGAGGTGTAGC CTTAAGTAATCAATTCTCAGGGATGAGCTTTTTAACTTGTCAAGTTTTAA ATATAAGTGATCTTTTACTACAAAACCTTGAATATAATCTGTTCCTCTTC TACTTGATCAGGCGCCGGAAGTCATCAAGATGCAAGACCCAAACCCATAC ACTTTCTTCTCAGATGCTTATGCATTCGGCATTTGTATTTACGAGTTGAT CACCGGCTCATTGCCTTATTGTAACATCGGGAATAAAGATATTGTAAGTA CTACAACGAATTCTATGCTTATTCGACCTAATAATCTCCAACAAACTATA CAAATCTTGTTTATTTTCTACAGGTTTTCTTTGCGCGCAGTTTGGTTTAA AAGCAGATTGCAATAATCCTTCAACAGTGCTTTTCAATTCAATACTCCAT TTTTCTTTCAGCTTATATATAGAATTGGGCGTGGTTTTATCCGCCCCGAT CAAAGCAAGATTCGTTCGGATTGTCCGAAAGCTTTGAAACGATTATACCT GGATTGTATTAAGTACAACCGAGACGAAAGGCCGCTTTTCAAACAGGTAT TTTTGTAAATAGCTGATAGTTCCCACTAGTTTTCGTCATACATTCCTTCG GAGAATGAAGAAGAACTCTTGCAAGAATAGTTTCCTTGTTCAAAACAATA ATTTCATCTGCCAAATATTTTGATGGTATTTCTAATAATGGCGAGGGTGA TGGCGTTAGTTACGTTATCATTGGAAGGTGCTGTATTGTTTACGTCCCTG GCTAAAAACTAAGGTGCCTTTCTCATTCTTGTTTGTCAATCAATATTTTT GCTGTATAAGCAATCCATTCATTCTGTCATCATCAATGCTgagaaagtta tttttgatgTGACTTTCCTTTGGTAACATGTACACGCCAAGAATGAGTAA CTATCATCACTATCAATCAATTAATATTTGTGTATAAATGTTATTTAGCA ACATTTGACGTCTTTCCCACTGACGTtctttttctacactatacacCTTC TCCAAATTTTACTGTCACGTCACCTCATTAAATTagtttcatcaattttt gttaCCTTTTAAGTATTTCATTCTTTCGAACtcataaaaataacaattcA GAAAAATCTACTTAGTTTTTATTTGTATACCTTGTTTTCCCTACAGATCG TGAATTCTTTGGAAACCATATTGATGGCACTACCTAAGATTACGAGGAGT ACTTCTGAGCCTATTTTAGGGCGTGCAAAACCGAGCACAGATGTTGAAAT TGCTTACCCATGCCCCACCCCTCATACGCCCATCCAAGGGCAAGATGTAT TCAGCTTTTTGTCTGGCCAACCGCAACCTGTGTATTAGAGTGCTTTTGAG TGAATCTAGAATGAATCACGAAAATggaatgaatgaatggatgaaatgaa tgaatgaatgaaaattcaaaGGAAAGTTGATTAACGTagcaatcaaccaa tcaaagaAATGCCAGTGCCAAATAATCTGGTTTCAGAATGATCccaaatc ttaaaccaatcttTTTTTGTCAATCTTTTTATAACTATACTTCATATGGC ATAAGTGTAAATTAATTCAggtgaatttatttatttatttaaagtaaaaa aaaacactaaaattcctgcataaaattttgattttgacaacaGTACGATG GCCCGGAGATGTCACTGTTTTGTCACAAAATTTTTTAgtttcatcacaaa actttttggtttcatcacaaaatttttagtttcgtcACAAAAATTCTTAG TTTCATCACacaaatttttagtttcatcacaAAAACTTTTAGTTTCATCA CAATTTTTCAGTGTTTCATCACAGATTTTCAGTGTTTCGTCACAAATTTA TAGGACTTTTCAGTGTTTCATTATTAATATATTTCTttatgaaactaaaa aaaactttttttcttgtggcGGTAGNTATTTTTGCTGTATAAGCAATCCA TTCATTCTGTCATCATCAATGCTgagaaagttatttttgatgTGACTTTC CTTTGGTAACATGTACACGCCAAGAATGAGTAACTATCATCACTATCAAT CAATTAATATTTGTGTATAAATGTTATTTAGCAACATTTGACGTCTTTCC CACTGACGTtctttttctacactatacacCTTCTCCAAATTTTACTGTCA CGTCACCTCATTAAATTagtttcatcaatttttgttaCCTTTTAAGTATT TCATTCTTTCGAACtcataaaaataacaattcAGAAAAATCTACTTAGTT TTTATTTGTATACCTTGTTTTCCCTACAGATCGTGAATTCTTTGGAAACC ATATTGATGGCACTACCTAAGATTACGAGGAGTACTTCTGAGCCTATTTT AGGGCGTGCAAAACCGAGCACAGATGTTGAAATTGCTTACCCATGCCCCA CCCCTCATACGCCCATCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGGC CAACCGCAACCTGTGTATTAGAGTGCTTTTGAGTGAATCTAGAATGAATC ACGAAAATggaatgaatgaatggatgaaatgaatgaatgaatgaaaattc aaaGGAAAGTTGATTAACGTagcaatcaaccaatcaaagaAATGCCAGTG CCAAATAATCTGGTTTCAGAATGATCccaaatcttaaaccaatcttTTTT TGTCAATCTTTTTATAACTATACTTCATATGGCATAAGTGTAAATTAATT CAggtgaatttatttatttatttaaagtaaaaaaaaacactaaaattcct gcataaaattttgattttgacaacaGTACGATGGCCCGGAGATGTCACTG TTTTGTCACAAAATTTTTTAgtttcatcacaaaactttttggtttcatca caaaatttttagtttcgtcACAAAAATTCTTAGTTTCATCACacaaattt ttagtttcatcacaAAAACTTTTAGTTTCATCACAATTTTTCAGTGTTTC ATCACAGATTTTCAGTGTTTCGTCACAAATTTATAGGACTTTTCAGTGTT TCATTATTAATATATTTCTttatgaaactaaaaaaaactttttttcttgt ggcGGTAGAATCAGGCGAAAACTGGATAAGGCGCAAGATCCTGTTTTCAT ATTATTTTGCGaaaaagaaatacaaagaaaactGAGAAGCTCGTTTTTCA TAGGAATTAGTTTTCGGGAATCAGCACATCTCTCTGGTCAGccgaaagat ttttttctcgccatttaatttcgcgaattaagGGGTCATTCGCAAATATG TCTAgacgcaaaattttctgacattGAAGTAGGGAATATTAGGCTATACC AAGGAGGCTTTCTAAATTAGCTGCATGAAATCTTTCTCttaagtaaattt ttttattgtgaacactctataaaaaataattcaaacgAGAAAAGAGTGGT GGACACTACTACACCTAATAGAACGAATAAATTCGTTTGCATCAGATtaa aagaattataaatttgaaaaccgaGTCGAAAGGCTCAAAACCATGTACCA TGGATTTTAACTTATCTTGGTAACTGCGTTTTGAAAAGGaggcctgaaat atttttcaatatctcAAGAAATGAGTATCGAAGAGTATCGCAGTGGGAAA ATACTAATCACGTTTTCATCAACACCCTTGATCACTGGTGGCAAAAATAT CGTCTTTTGAAATATGGATCCTTCATGCCTGTATTCAAaagcaagaaaga aaattttatttttagtttcataAAGAAATATATTAATAATGAAACACTGA AAGTTTCGTGATGAAACACTGAAAAGTCCTGGAAAATTGTGACGAAACAC TGAAATTCtgtgatgaaactaaaaatttcatGTGACAAAACTAAAAACTT TGTGACGAACTTCtgtgatgaaactaaaaattttgtGACAAAACACTGAA ATTTTGTGACGAAACAGTGACATCTCAGGGCCATCGTACAACAGGTCTGA ACAGATTCGAAAATTAAGGTTTCAGTATGGTTAATATGCATCAAAATATT AAATTCTTTTCGAAGCGCAACCCTTTGAAAGTAGTATCATTTTATGGAAA GTCTCTTTTCCGTTGTTTGAAAGGAGTGTCATGGGTGTTCCACTTTAAGT ACTTAACTTGGTTTTCGTAGCTTCCATTTTTGAACACTTCCATAAATTCA CGATTATGAAAAGTTGCAACTTTCTCACGACCCCCTGTGTCAGCTAAATT TAACTTTCATCATAAATTTTATGTTATCACTTTTTTATTATGATAGTAAA CTTCactgatttttttccttttttaagtGCTTTTAGTTTCAGATGAgaaa tttttattgtaatttttgtCAATTCCTTAATTTTATACTTTAGAATCATT AGAATTATTGTTTTAACTTCAACattttaaaagtgaaattttatgCCGTA ACTCAGGCCCCATCTTACTTCGACTAGGCTAGACTAGAAGTTATACGGTT AAAACTCAAAGAATGGCTTATCAGCaaagccttttagaaaaaatagattt aaatTTGTTATTATTTAGTTTCTAATTATTTGgtatttgttttttgttta ctttattacttttttgtgtAAATAACAACATGTTTTGGAAACAGGGTGAT GGAATTTAATATGTAGATATCAAAAATTTACCCCTTCTATAAAAAAACTA acataaatcttttttttatagattagttttattaactgttcttCTGTTCT GTTCTTTATCGGTTAATTCTCCTACAGACGTTCTTGACTGATACCAAATT GCTTCGAATGATTACCAATTATCTAATAAACGCCCTTCAAAGGATTGAGC CTCCTTCTGGATTAACTTGGTCCACCATTAAGGT

Coding sequence (CDS) from alignment at sc0000007:790173..815156+

>TCONS_00001030 ID=TCONS_00001030|Name=TCONS_00001030|organism=Clytia hemisphaerica|type=CDS|length=42822bp|location=Sequence derived from alignment at sc0000007:790173..815156+ (Clytia hemisphaerica)
ATGGCGGCGACGTCGGAAAACAATTTATCTAACATTGCAAGAATTTCTGG
AGGAGATTTGACGAGAGAACATCGTTCTCTGACTATCGACAACCTTAATT
GTGGAGCAGAAGTAGATACAGGGCACTTTCAAAGCAATGGCATCAGGGCT
TCGCAGATACTTAGCGAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGAC
GTCAGAACAACTTCAAGAAATGACAAATATGTACAATACTGGAAACTTCG
CCCATCCACCTTCCATCTTGTTTGAGGAGATCGAGGAGCTAAAGACAAAG
CTGGGAACCATCAGCAAGCAACGAGATGAATACTCAGATGCAATGAAAAA
TGGCACCGCCCCTCCACCCGTACCGCCCCAACAACAAACTTCCACAAACT
CTAATAATTCAGATTCTGACAGTCAACCATCCTCACCTAACTTAACAAGA
AGCACATTAAACTCGTTCAGCGATGGAAGTTACAACCAAAGCAATGGAAA
TTCCCCTCATTCTTCGCTAAGAGCGCACATTCGTGCTTTTCTACCAAATA
ATCAAAGGACTATGATTAAATATAAGCTTGGACAAACGGTGAGAGAAGCA
CTTTACAAAGCAATGTCGCGTCGTTCACTGACCACTGATTCCTATAGAGT
TTACAACAAAGCAAATCGAGAATTAATCGCTTGGGATTCGGACGTCTCAC
TTCTAGATGGAGCAGAGGTGATTGTCGAGATGATAGACGAGGAAGATCCA
AGCACCCAAAATATTTCACATAATTTTGTGCGAAAGACATTCTTCCGGTT
AGCGTTTTGTGATAAATGCACGAAGCTTCTAATCACGGGATTCAGatGCA
CAACATGCAATTATCGGTTTCACCAGAAATGTGCTCAGGGGATACCTCCT
CTTTGTGAGCAAGCTGAACATTCACAGATTTACAAGAGGCTACTAGCAAA
ACAGAATCCAAACAGTAACACGAATATCCCTTCAACACCTCGACCAATCT
CTCAACGCGAACGTTCCATATCTGCTCCCAACGTTAATATGATCGGACAA
CCTGACTCGGGACTCATTGAGGCGGTTCTtgaaaaacattacaaaaacCG
AACCAATCAAGAAACGGCAACTATATCAGgtGGTCTCACACGTCAAATGT
CAAGTGGACCAAGTAGCGGGCGTGGACGGATAACCAATACTCTCTTCACG
CCCACTAGCGTTAGTGCGCCCAATAGCGGCGAAAATTACTTCGATTTCAA
CACTGCTAACAGTTTGCCCGCACCAGGAAATTCCAAGGCACAACAAATCT
CCGGcattcctgactcgctaatacaCCCGGCACGCGACCGTAAAAACCGG
ATACGATCGTCTTCGGAAGAACACAAAAAGCCTCGCCGTCGCGATTCGAA
CGATGATTGGGAGATTTACGCAGACGACTTGAAGATCGGAGAGAGGATAG
GATCAGGCTCTTATGGAACTGTCTATAAGGGATACTGGCATGGCACAGTG
GCGGTAAAAACGTTGAATGTGAAAGACCCCAATCCTCAACAACTATTAGC
ATTTCAAAACGAAGTCGGAGTTTTGCGAAAGACTCGTCATGTCAACGTTC
TACTATTCATGGGTTGTCTCTCCTCACCTAACCTAGCTATCGTTACTCAA
TGGTGCGAAGGTTCCAGTCTCTACAGACATTTACACGTTTTGGAGAAGAA
GTTTCCTATGCATAACTTGATAGAAATTGCGAGACAAACTGCTCAAGGGA
TAGACTATCTTCACGCAAAACAAATTATACATCGTGACTTGAAGTCAAAC
AACATCTTTCTACAGCAGGATTTAACAGTGAAAATTGGAGATTTTGGGCT
TGCTACCGTCAAAACAAGGTGGAGTGGTGACCATGGCTGTGAACAACCTT
CTGGATCCATCTTATGGATGGCGCCGGAAGTCATCAAGATGCAAGACCCA
AACCCATACACTTTCTTCTCAGATGCTTATGCATTCGGCATTTGTATTTA
CGAGTTGATCACCGGCTCATTGCCTTATTGTAACATCGGGAATAAAGATA
TTCTTATATATAGAATTGGGCGTGGTTTTATCCGCCCCGATCAAAGCAAG
ATTCGTTCGGATTGTCCGAAAGCTTTGAAACGATTATACCTGGATTGTAT
TAAGTACAACCGAGACGAAAGGCCGCTTTTCAAACAGATCGTGAATTCTT
TGGAAACCATATTGATGGCACTACCTAAGATTACGAGGAGTACTTCTGAG
CCTATTTTAGGGCGTGCAAAACCGAGCACAGATGTTGAAATTGCTTACCC
ATGCCCCACCCCTCATACGCCCATCCAAGGGCAAGATGTATTCAGCTTTT
TGTCTGGCCAACCGCAACCTGTGTATTAGATGGCGGCGACGTCGGAAAAC
AATTTATCTAACATTGCAAGAATTTCTGGAGGAGATTTGACGAGAGAACA
TCGTTCTCTGACTATCGACAACCTTAATTGTGGAGCAGAAGTAGATACAG
GGCACTTTCAAAGCAATGGCATCAGGGCTTCGCAGATACTTAGCGAGGCT
CAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAACAACTTCAAGAAAT
GACAAATATGTACAATACTGGAAACTTCGCCCATCCACCTTCCATCTTGT
TTGAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAACCATCAGCAAGCAA
CGAGATGAATACTCAGATGCAATGAAAAATGGCACCGCCCCTCCACCCGT
ACCGCCCCAACAACAAACTTCCACAAACTCTAATAATTCAGATTCTGACA
GTCAACCATCCTCACCTAACTTAACAAGAAGCACATTAAACTCGTTCAGC
GATGGAAGTTACAACCAAAGCAATGGAAATTCCCCTCATTCTTCGCTAAG
AGCGCACATTCGTGCTTTTCTACCAAATAATCAAAGGACTATGATTAAAT
ATAAGCTTGGACAAACGGTGAGAGAAGCACTTTACAAAGCAATGTCGCGT
CGTTCACTGACCACTGATTCCTATAGAGTTTACAACAAAGCAAATCGAGA
ATTAATCGCTTGGGATTCGGACGTCTCACTTCTAGATGGAGCAGAGGTGA
TTGTCGAGATGATAGACGAGGAAGATCCAAGCACCCAAAATATTTCACAT
AATTTTGTGCGAAAGACATTCTTCCGGTTAGCGTTTTGTGATAAATGCAC
GAAGCTTCTAATCACGGGATTCAGatGCACAACATGCAATTATCGGTTTC
ACCAGAAATGTGCTCAGGGGATACCTCCTCTTTGTGAGCAAGCTGAACAT
TCACAGATTTACAAGAGGCTACTAGCAAAACAGAATCCAAACAGTAACAC
GAATATCCCTTCAACACCTCGACCAATCTCTCAACGCGAACGTTCCATAT
CTGCTCCCAACGTTAATATGATCGGACAACCTGACTCGGGACTCATTGAG
GCGGTTCTtgaaaaacattacaaaaacCGAACCAATCAAGAAACGGCAAC
TATATCAGgtGGTCTCACACGTCAAATGTCAAGTGGACCAAGTAGCGGGC
GTGGACGGATAACCAATACTCTCTTCACGCCCACTAGCGTTAGTGCGCCC
AATAGCGGCGAAAATTACTTCGATTTCAACACTGCTAACAGTTTGCCCGC
ACCAGGAAATTCCAAGGCACAACAAATCTCCGGcattcctgactcgctaa
tacaCCCGGCACGCGACCGTAAAAACCGGATACGATCGTCTTCGGAAGAA
CACAAAAAGCCTCGCCGTCGCGATTCGAACGATGATTGGGAGATTTACGC
AGACGACTTGAAGATCGGAGAGAGGATAGGATCAGGCTCTTATGGAACTG
TCTATAAGGGATACTGGCATGGCACAGTGGCGGTAAAAACGTTGAATGTG
AAAGACCCCAATCCTCAACAACTATTAGCATTTCAAAACGAAGTCGGAGT
TTTGCGAAAGACTCGTCATGTCAACGTTCTACTATTCATGGGTTGTCTCT
CCTCACCTAACCTAGCTATCGTTACTCAATGGTGCGAAGGTTCCAGTCTC
TACAGACATTTACACGTTTTGGAGAAGAAGTTTCCTATGCATAACTTGAT
AGAAATTGCGAGACAAACTGCTCAAGGGATAGACTATCTTCACGCAAAAC
AAATTATACATCGTGACTTGAAGTCAAACAACATCTTTCTACAGCAGGAT
TTAACAGTGAAAATTGGAGATTTTGGGCTTGCTACCGTCAAAACAAGGTG
GAGTGGTGACCATGGCTGTGAACAACCTTCTGGATCCATCTTATGGATGG
CGCCGGAAGTCATCAAGATGCAAGACCCAAACCCATACACTTTCTTCTCA
GATGCTTATGCATTCGGCATTTGTATTTACGAGTTGATCACCGGCTCATT
GCCTTATTGTAACATCGGGAATAAAGATATTCTTATATATAGAATTGGGC
GTGGTTTTATCCGCCCCGATCAAAGCAAGATTCGTTCGGATTGTCCGAAA
GCTTTGAAACGATTATACCTGGATTGTATTAAGTACAACCGAGACGAAAG
GCCGCTTTTCAAACAGATCGTGAATTCTTTGGAAACCATATTGATGGCAC
TACCTAAGATTACGAGGAGTACTTCTGAGCCTATTTTAGGGCGTGCAAAA
CCGAGCACAGATGTTGAAATTGCTTACCCATGCCCCACCCCTCATACGCC
CATCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGGCCAACCGCAACCTG
TGTATTAGATGGCGGCGACGTCGGAAAACAATTTATCTAACATTGCAAGA
ATTTCTGGAGGAGATTTGACGAGAGAACATCGTTCTCTGACTATCGACAA
CCTTAATTGTGGAGCAGAAGTAGATACAGGGCACTTTCAAAGCAATGGCA
TCAGGGCTTCGCAGATACTTAGCGAGGCTCAAAATGTGGAAGAGCTGTTT
CAGTTGACGTCAGAACAACTTCAAGAAATGACAAATATGTACAATACTGG
AAACTTCGCCCATCCACCTTCCATCTTGTTTGAGGAGATCGAGGAGCTAA
AGACAAAGCTGGGAACCATCAGCAAGCAACGAGATGAATACTCAGATGCA
ATGAAAAATGGCACCGCCCCTCCACCCGTACCGCCCCAACAACAAACTTC
CACAAACTCTAATAATTCAGATTCTGACAGTCAACCATCCTCACCTAACT
TAACAAGAAGCACATTAAACTCGTTCAGCGATGGAAGTTACAACCAAAGC
AATGGAAATTCCCCTCATTCTTCGCTAAGAGCGCACATTCGTGCTTTTCT
ACCAAATAATCAAAGGACTATGATTAAATATAAGCTTGGACAAACGGTGA
GAGAAGCACTTTACAAAGCAATGTCGCGTCGTTCACTGACCACTGATTCC
TATAGAGTTTACAACAAAGCAAATCGAGAATTAATCGCTTGGGATTCGGA
CGTCTCACTTCTAGATGGAGCAGAGGTGATTGTCGAGATGATAGACGAGG
AAGATCCAAGCACCCAAAATATTTCACATAATTTTGTGCGAAAGACATTC
TTCCGGTTAGCGTTTTGTGATAAATGCACGAAGCTTCTAATCACGGGATT
CAGatGCACAACATGCAATTATCGGTTTCACCAGAAATGTGCTCAGGGGA
TACCTCCTCTTTGTGAGCAAGCTGAACATTCACAGATTTACAAGAGGCTA
CTAGCAAAACAGAATCCAAACAGTAACACGAATATCCCTTCAACACCTCG
ACCAATCTCTCAACGCGAACGTTCCATATCTGCTCCCAACGTTAATATGA
TCGGACAACCTGACTCGGGACTCATTGAGGCGGTTCTtgaaaaacattac
aaaaacCGAACCAATCAAGAAACGGCAACTATATCAGgtGGTCTCACACG
TCAAATGTCAAGTGGACCAAGTAGCGGGCGTGGACGGATAACCAATACTC
TCTTCACGCCCACTAGCGTTAGTGCGCCCAATAGCGGCGAAAATTACTTC
GATTTCAACACTGCTAACAGTTTGCCCGCACCAGGAAATTCCAAGGCACA
ACAAATCTCCGGcattcctgactcgctaatacaCCCGGCACGCGACCGTA
AAAACCGGATACGATCGTCTTCGGAAGAACACAAAAAGCCTCGCCGTCGC
GATTCGAACGATGATTGGGAGATTTACGCAGACGACTTGAAGATCGGAGA
GAGGATAGGATCAGGCTCTTATGGAACTGTCTATAAGGGATACTGGCATG
GCACAGTGGCGGTAAAAACGTTGAATGTGAAAGACCCCAATCCTCAACAA
CTATTAGCATTTCAAAACGAAGTCGGAGTTTTGCGAAAGACTCGTCATGT
CAACGTTCTACTATTCATGGGTTGTCTCTCCTCACCTAACCTAGCTATCG
TTACTCAATGGTGCGAAGGTTCCAGTCTCTACAGACATTTACACGTTTTG
GAGAAGAAGTTTCCTATGCATAACTTGATAGAAATTGCGAGACAAACTGC
TCAAGGGATAGACTATCTTCACGCAAAACAAATTATACATCGTGACTTGA
AGTCAAACAACATCTTTCTACAGCAGGATTTAACAGTGAAAATTGGAGAT
TTTGGGCTTGCTACCGTCAAAACAAGGTGGAGTGGTGACCATGGCTGTGA
ACAACCTTCTGGATCCATCTTATGGATGGCGCCGGAAGTCATCAAGATGC
AAGACCCAAACCCATACACTTTCTTCTCAGATGCTTATGCATTCGGCATT
TGTATTTACGAGTTGATCACCGGCTCATTGCCTTATTGTAACATCGGGAA
TAAAGATATTCTTATATATAGAATTGGGCGTGGTTTTATCCGCCCCGATC
AAAGCAAGATTCGTTCGGATTGTCCGAAAGCTTTGAAACGATTATACCTG
GATTGTATTAAGTACAACCGAGACGAAAGGCCGCTTTTCAAACAGATCGT
GAATTCTTTGGAAACCATATTGATGGCACTACCTAAGATTACGAGGAGTA
CTTCTGAGCCTATTTTAGGGCGTGCAAAACCGAGCACAGATGTTGAAATT
GCTTACCCATGCCCCACCCCTCATACGCCCATCCAAGGGCAAGATGTATT
CAGCTTTTTGTCTGGCCAACCGCAACCTGTGTATTAGATGGCGGCGACGT
CGGAAAACAATTTATCTAACATTGCAAGAATTTCTGGAGGAGATTTGACG
AGAGAACATCGTTCTCTGACTATCGACAACCTTAATTGTGGAGCAGAAGT
AGATACAGGGCACTTTCAAAGCAATGGCATCAGGGCTTCGCAGATACTTA
GCGAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAACAACTT
CAAGAAATGACAAATATGTACAATACTGGAAACTTCGCCCATCCACCTTC
CATCTTGTTTGAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAACCATCA
GCAAGCAACGAGATGAATACTCAGATGCAATGAAAAATGGCACCGCCCCT
CCACCCGTACCGCCCCAACAACAAACTTCCACAAACTCTAATAATTCAGA
TTCTGACAGTCAACCATCCTCACCTAACTTAACAAGAAGCACATTAAACT
CGTTCAGCGATGGAAGTTACAACCAAAGCAATGGAAATTCCCCTCATTCT
TCGCTAAGAGCGCACATTCGTGCTTTTCTACCAAATAATCAAAGGACTAT
GATTAAATATAAGCTTGGACAAACGGTGAGAGAAGCACTTTACAAAGCAA
TGTCGCGTCGTTCACTGACCACTGATTCCTATAGAGTTTACAACAAAGCA
AATCGAGAATTAATCGCTTGGGATTCGGACGTCTCACTTCTAGATGGAGC
AGAGGTGATTGTCGAGATGATAGACGAGGAAGATCCAAGCACCCAAAATA
TTTCACATAATTTTGTGCGAAAGACATTCTTCCGGTTAGCGTTTTGTGAT
AAATGCACGAAGCTTCTAATCACGGGATTCAGatGCACAACATGCAATTA
TCGGTTTCACCAGAAATGTGCTCAGGGGATACCTCCTCTTTGTGAGCAAG
CTGAACATTCACAGATTTACAAGAGGCTACTAGCAAAACAGAATCCAAAC
AGTAACACGAATATCCCTTCAACACCTCGACCAATCTCTCAACGCGAACG
TTCCATATCTGCTCCCAACGTTAATATGATCGGACAACCTGACTCGGGAC
TCATTGAGGCGGTTCTtgaaaaacattacaaaaacCGAACCAATCAAGAA
ACGGCAACTATATCAGgtGGTCTCACACGTCAAATGTCAAGTGGACCAAG
TAGCGGGCGTGGACGGATAACCAATACTCTCTTCACGCCCACTAGCGTTA
GTGCGCCCAATAGCGGCGAAAATTACTTCGATTTCAACACTGCTAACAGT
TTGCCCGCACCAGGAAATTCCAAGGCACAACAAATCTCCGGcattcctga
ctcgctaatacaCCCGGCACGCGACCGTAAAAACCGGATACGATCGTCTT
CGGAAGAACACAAAAAGCCTCGCCGTCGCGATTCGAACGATGATTGGGAG
ATTTACGCAGACGACTTGAAGATCGGAGAGAGGATAGGATCAGGCTCTTA
TGGAACTGTCTATAAGGGATACTGGCATGGCACAGTGGCGGTAAAAACGT
TGAATGTGAAAGACCCCAATCCTCAACAACTATTAGCATTTCAAAACGAA
GTCGGAGTTTTGCGAAAGACTCGTCATGTCAACGTTCTACTATTCATGGG
TTGTCTCTCCTCACCTAACCTAGCTATCGTTACTCAATGGTGCGAAGGTT
CCAGTCTCTACAGACATTTACACGTTTTGGAGAAGAAGTTTCCTATGCAT
AACTTGATAGAAATTGCGAGACAAACTGCTCAAGGGATAGACTATCTTCA
CGCAAAACAAATTATACATCGTGACTTGAAGTCAAACAACATCTTTCTAC
AGCAGGATTTAACAGTGAAAATTGGAGATTTTGGGCTTGCTACCGTCAAA
ACAAGGTGGAGTGGTGACCATGGCTGTGAACAACCTTCTGGATCCATCTT
ATGGATGGCGCCGGAAGTCATCAAGATGCAAGACCCAAACCCATACACTT
TCTTCTCAGATGCTTATGCATTCGGCATTTGTATTTACGAGTTGATCACC
GGCTCATTGCCTTATTGTAACATCGGGAATAAAGATATTCTTATATATAG
AATTGGGCGTGGTTTTATCCGCCCCGATCAAAGCAAGATTCGTTCGGATT
GTCCGAAAGCTTTGAAACGATTATACCTGGATTGTATTAAGTACAACCGA
GACGAAAGGCCGCTTTTCAAACAGATCGTGAATTCTTTGGAAACCATATT
GATGGCACTACCTAAGATTACGAGGAGTACTTCTGAGCCTATTTTAGGGC
GTGCAAAACCGAGCACAGATGTTGAAATTGCTTACCCATGCCCCACCCCT
CATACGCCCATCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGGCCAACC
GCAACCTGTGTATTAGATGGCGGCGACGTCGGAAAACAATTTATCTAACA
TTGCAAGAATTTCTGGAGGAGATTTGACGAGAGAACATCGTTCTCTGACT
ATCGACAACCTTAATTGTGGAGCAGAAGTAGATACAGGGCACTTTCAAAG
CAATGGCATCAGGGCTTCGCAGATACTTAGCGAGGCTCAAAATGTGGAAG
AGCTGTTTCAGTTGACGTCAGAACAACTTCAAGAAATGACAAATATGTAC
AATACTGGAAACTTCGCCCATCCACCTTCCATCTTGTTTGAGGAGATCGA
GGAGCTAAAGACAAAGCTGGGAACCATCAGCAAGCAACGAGATGAATACT
CAGATGCAATGAAAAATGGCACCGCCCCTCCACCCGTACCGCCCCAACAA
CAAACTTCCACAAACTCTAATAATTCAGATTCTGACAGTCAACCATCCTC
ACCTAACTTAACAAGAAGCACATTAAACTCGTTCAGCGATGGAAGTTACA
ACCAAAGCAATGGAAATTCCCCTCATTCTTCGCTAAGAGCGCACATTCGT
GCTTTTCTACCAAATAATCAAAGGACTATGATTAAATATAAGCTTGGACA
AACGGTGAGAGAAGCACTTTACAAAGCAATGTCGCGTCGTTCACTGACCA
CTGATTCCTATAGAGTTTACAACAAAGCAAATCGAGAATTAATCGCTTGG
GATTCGGACGTCTCACTTCTAGATGGAGCAGAGGTGATTGTCGAGATGAT
AGACGAGGAAGATCCAAGCACCCAAAATATTTCACATAATTTTGTGCGAA
AGACATTCTTCCGGTTAGCGTTTTGTGATAAATGCACGAAGCTTCTAATC
ACGGGATTCAGatGCACAACATGCAATTATCGGTTTCACCAGAAATGTGC
TCAGGGGATACCTCCTCTTTGTGAGCAAGCTGAACATTCACAGATTTACA
AGAGGCTACTAGCAAAACAGAATCCAAACAGTAACACGAATATCCCTTCA
ACACCTCGACCAATCTCTCAACGCGAACGTTCCATATCTGCTCCCAACGT
TAATATGATCGGACAACCTGACTCGGGACTCATTGAGGCGGTTCTtgaaa
aacattacaaaaacCGAACCAATCAAGAAACGGCAACTATATCAGgtGGT
CTCACACGTCAAATGTCAAGTGGACCAAGTAGCGGGCGTGGACGGATAAC
CAATACTCTCTTCACGCCCACTAGCGTTAGTGCGCCCAATAGCGGCGAAA
ATTACTTCGATTTCAACACTGCTAACAGTTTGCCCGCACCAGGAAATTCC
AAGGCACAACAAATCTCCGGcattcctgactcgctaatacaCCCGGCACG
CGACCGTAAAAACCGGATACGATCGTCTTCGGAAGAACACAAAAAGCCTC
GCCGTCGCGATTCGAACGATGATTGGGAGATTTACGCAGACGACTTGAAG
ATCGGAGAGAGGATAGGATCAGGCTCTTATGGAACTGTCTATAAGGGATA
CTGGCATGGCACAGTGGCGGTAAAAACGTTGAATGTGAAAGACCCCAATC
CTCAACAACTATTAGCATTTCAAAACGAAGTCGGAGTTTTGCGAAAGACT
CGTCATGTCAACGTTCTACTATTCATGGGTTGTCTCTCCTCACCTAACCT
AGCTATCGTTACTCAATGGTGCGAAGGTTCCAGTCTCTACAGACATTTAC
ACGTTTTGGAGAAGAAGTTTCCTATGCATAACTTGATAGAAATTGCGAGA
CAAACTGCTCAAGGGATAGACTATCTTCACGCAAAACAAATTATACATCG
TGACTTGAAGTCAAACAACATCTTTCTACAGCAGGATTTAACAGTGAAAA
TTGGAGATTTTGGGCTTGCTACCGTCAAAACAAGGTGGAGTGGTGACCAT
GGCTGTGAACAACCTTCTGGATCCATCTTATGGATGGCGCCGGAAGTCAT
CAAGATGCAAGACCCAAACCCATACACTTTCTTCTCAGATGCTTATGCAT
TCGGCATTTGTATTTACGAGTTGATCACCGGCTCATTGCCTTATTGTAAC
ATCGGGAATAAAGATATTCTTATATATAGAATTGGGCGTGGTTTTATCCG
CCCCGATCAAAGCAAGATTCGTTCGGATTGTCCGAAAGCTTTGAAACGAT
TATACCTGGATTGTATTAAGTACAACCGAGACGAAAGGCCGCTTTTCAAA
CAGATCGTGAATTCTTTGGAAACCATATTGATGGCACTACCTAAGATTAC
GAGGAGTACTTCTGAGCCTATTTTAGGGCGTGCAAAACCGAGCACAGATG
TTGAAATTGCTTACCCATGCCCCACCCCTCATACGCCCATCCAAGGGCAA
GATGTATTCAGCTTTTTGTCTGGCCAACCGCAACCTGTGTATTAGATGGC
GGCGACGTCGGAAAACAATTTATCTAACATTGCAAGAATTTCTGGAGGAG
ATTTGACGAGAGAACATCGTTCTCTGACTATCGACAACCTTAATTGTGGA
GCAGAAGTAGATACAGGGCACTTTCAAAGCAATGGCATCAGGGCTTCGCA
GATACTTAGCGAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAG
AACAACTTCAAGAAATGACAAATATGTACAATACTGGAAACTTCGCCCAT
CCACCTTCCATCTTGTTTGAGGAGATCGAGGAGCTAAAGACAAAGCTGGG
AACCATCAGCAAGCAACGAGATGAATACTCAGATGCAATGAAAAATGGCA
CCGCCCCTCCACCCGTACCGCCCCAACAACAAACTTCCACAAACTCTAAT
AATTCAGATTCTGACAGTCAACCATCCTCACCTAACTTAACAAGAAGCAC
ATTAAACTCGTTCAGCGATGGAAGTTACAACCAAAGCAATGGAAATTCCC
CTCATTCTTCGCTAAGAGCGCACATTCGTGCTTTTCTACCAAATAATCAA
AGGACTATGATTAAATATAAGCTTGGACAAACGGTGAGAGAAGCACTTTA
CAAAGCAATGTCGCGTCGTTCACTGACCACTGATTCCTATAGAGTTTACA
ACAAAGCAAATCGAGAATTAATCGCTTGGGATTCGGACGTCTCACTTCTA
GATGGAGCAGAGGTGATTGTCGAGATGATAGACGAGGAAGATCCAAGCAC
CCAAAATATTTCACATAATTTTGTGCGAAAGACATTCTTCCGGTTAGCGT
TTTGTGATAAATGCACGAAGCTTCTAATCACGGGATTCAGatGCACAACA
TGCAATTATCGGTTTCACCAGAAATGTGCTCAGGGGATACCTCCTCTTTG
TGAGCAAGCTGAACATTCACAGATTTACAAGAGGCTACTAGCAAAACAGA
ATCCAAACAGTAACACGAATATCCCTTCAACACCTCGACCAATCTCTCAA
CGCGAACGTTCCATATCTGCTCCCAACGTTAATATGATCGGACAACCTGA
CTCGGGACTCATTGAGGCGGTTCTtgaaaaacattacaaaaacCGAACCA
ATCAAGAAACGGCAACTATATCAGgtGGTCTCACACGTCAAATGTCAAGT
GGACCAAGTAGCGGGCGTGGACGGATAACCAATACTCTCTTCACGCCCAC
TAGCGTTAGTGCGCCCAATAGCGGCGAAAATTACTTCGATTTCAACACTG
CTAACAGTTTGCCCGCACCAGGAAATTCCAAGGCACAACAAATCTCCGGc
attcctgactcgctaatacaCCCGGCACGCGACCGTAAAAACCGGATACG
ATCGTCTTCGGAAGAACACAAAAAGCCTCGCCGTCGCGATTCGAACGATG
ATTGGGAGATTTACGCAGACGACTTGAAGATCGGAGAGAGGATAGGATCA
GGCTCTTATGGAACTGTCTATAAGGGATACTGGCATGGCACAGTGGCGGT
AAAAACGTTGAATGTGAAAGACCCCAATCCTCAACAACTATTAGCATTTC
AAAACGAAGTCGGAGTTTTGCGAAAGACTCGTCATGTCAACGTTCTACTA
TTCATGGGTTGTCTCTCCTCACCTAACCTAGCTATCGTTACTCAATGGTG
CGAAGGTTCCAGTCTCTACAGACATTTACACGTTTTGGAGAAGAAGTTTC
CTATGCATAACTTGATAGAAATTGCGAGACAAACTGCTCAAGGGATAGAC
TATCTTCACGCAAAACAAATTATACATCGTGACTTGAAGTCAAACAACAT
CTTTCTACAGCAGGATTTAACAGTGAAAATTGGAGATTTTGGGCTTGCTA
CCGTCAAAACAAGGTGGAGTGGTGACCATGGCTGTGAACAACCTTCTGGA
TCCATCTTATGGATGGCGCCGGAAGTCATCAAGATGCAAGACCCAAACCC
ATACACTTTCTTCTCAGATGCTTATGCATTCGGCATTTGTATTTACGAGT
TGATCACCGGCTCATTGCCTTATTGTAACATCGGGAATAAAGATATTCTT
ATATATAGAATTGGGCGTGGTTTTATCCGCCCCGATCAAAGCAAGATTCG
TTCGGATTGTCCGAAAGCTTTGAAACGATTATACCTGGATTGTATTAAGT
ACAACCGAGACGAAAGGCCGCTTTTCAAACAGATCGTGAATTCTTTGGAA
ACCATATTGATGGCACTACCTAAGATTACGAGGAGTACTTCTGAGCCTAT
TTTAGGGCGTGCAAAACCGAGCACAGATGTTGAAATTGCTTACCCATGCC
CCACCCCTCATACGCCCATCCAAGGGCAAGATGTATTCAGCTTTTTGTCT
GGCCAACCGCAACCTGTGTATTAGATGGCGGCGACGTCGGAAAACAATTT
ATCTAACATTGCAAGAATTTCTGGAGGAGATTTGACGAGAGAACATCGTT
CTCTGACTATCGACAACCTTAATTGTGGAGCAGAAGTAGATACAGGGCAC
TTTCAAAGCAATGGCATCAGGGCTTCGCAGATACTTAGCGAGGCTCAAAA
TGTGGAAGAGCTGTTTCAGTTGACGTCAGAACAACTTCAAGAAATGACAA
ATATGTACAATACTGGAAACTTCGCCCATCCACCTTCCATCTTGTTTGAG
GAGATCGAGGAGCTAAAGACAAAGCTGGGAACCATCAGCAAGCAACGAGA
TGAATACTCAGATGCAATGAAAAATGGCACCGCCCCTCCACCCGTACCGC
CCCAACAACAAACTTCCACAAACTCTAATAATTCAGATTCTGACAGTCAA
CCATCCTCACCTAACTTAACAAGAAGCACATTAAACTCGTTCAGCGATGG
AAGTTACAACCAAAGCAATGGAAATTCCCCTCATTCTTCGCTAAGAGCGC
ACATTCGTGCTTTTCTACCAAATAATCAAAGGACTATGATTAAATATAAG
CTTGGACAAACGGTGAGAGAAGCACTTTACAAAGCAATGTCGCGTCGTTC
ACTGACCACTGATTCCTATAGAGTTTACAACAAAGCAAATCGAGAATTAA
TCGCTTGGGATTCGGACGTCTCACTTCTAGATGGAGCAGAGGTGATTGTC
GAGATGATAGACGAGGAAGATCCAAGCACCCAAAATATTTCACATAATTT
TGTGCGAAAGACATTCTTCCGGTTAGCGTTTTGTGATAAATGCACGAAGC
TTCTAATCACGGGATTCAGatGCACAACATGCAATTATCGGTTTCACCAG
AAATGTGCTCAGGGGATACCTCCTCTTTGTGAGCAAGCTGAACATTCACA
GATTTACAAGAGGCTACTAGCAAAACAGAATCCAAACAGTAACACGAATA
TCCCTTCAACACCTCGACCAATCTCTCAACGCGAACGTTCCATATCTGCT
CCCAACGTTAATATGATCGGACAACCTGACTCGGGACTCATTGAGGCGGT
TCTtgaaaaacattacaaaaacCGAACCAATCAAGAAACGGCAACTATAT
CAGgtGGTCTCACACGTCAAATGTCAAGTGGACCAAGTAGCGGGCGTGGA
CGGATAACCAATACTCTCTTCACGCCCACTAGCGTTAGTGCGCCCAATAG
CGGCGAAAATTACTTCGATTTCAACACTGCTAACAGTTTGCCCGCACCAG
GAAATTCCAAGGCACAACAAATCTCCGGcattcctgactcgctaatacaC
CCGGCACGCGACCGTAAAAACCGGATACGATCGTCTTCGGAAGAACACAA
AAAGCCTCGCCGTCGCGATTCGAACGATGATTGGGAGATTTACGCAGACG
ACTTGAAGATCGGAGAGAGGATAGGATCAGGCTCTTATGGAACTGTCTAT
AAGGGATACTGGCATGGCACAGTGGCGGTAAAAACGTTGAATGTGAAAGA
CCCCAATCCTCAACAACTATTAGCATTTCAAAACGAAGTCGGAGTTTTGC
GAAAGACTCGTCATGTCAACGTTCTACTATTCATGGGTTGTCTCTCCTCA
CCTAACCTAGCTATCGTTACTCAATGGTGCGAAGGTTCCAGTCTCTACAG
ACATTTACACGTTTTGGAGAAGAAGTTTCCTATGCATAACTTGATAGAAA
TTGCGAGACAAACTGCTCAAGGGATAGACTATCTTCACGCAAAACAAATT
ATACATCGTGACTTGAAGTCAAACAACATCTTTCTACAGCAGGATTTAAC
AGTGAAAATTGGAGATTTTGGGCTTGCTACCGTCAAAACAAGGTGGAGTG
GTGACCATGGCTGTGAACAACCTTCTGGATCCATCTTATGGATGGCGCCG
GAAGTCATCAAGATGCAAGACCCAAACCCATACACTTTCTTCTCAGATGC
TTATGCATTCGGCATTTGTATTTACGAGTTGATCACCGGCTCATTGCCTT
ATTGTAACATCGGGAATAAAGATATTCTTATATATAGAATTGGGCGTGGT
TTTATCCGCCCCGATCAAAGCAAGATTCGTTCGGATTGTCCGAAAGCTTT
GAAACGATTATACCTGGATTGTATTAAGTACAACCGAGACGAAAGGCCGC
TTTTCAAACAGATCGTGAATTCTTTGGAAACCATATTGATGGCACTACCT
AAGATTACGAGGAGTACTTCTGAGCCTATTTTAGGGCGTGCAAAACCGAG
CACAGATGTTGAAATTGCTTACCCATGCCCCACCCCTCATACGCCCATCC
AAGGGCAAGATGTATTCAGCTTTTTGTCTGGCCAACCGCAACCTGTGTAT
TAGATGGCGGCGACGTCGGAAAACAATTTATCTAACATTGCAAGAATTTC
TGGAGGAGATTTGACGAGAGAACATCGTTCTCTGACTATCGACAACCTTA
ATTGTGGAGCAGAAGTAGATACAGGGCACTTTCAAAGCAATGGCATCAGG
GCTTCGCAGATACTTAGCGAGGCTCAAAATGTGGAAGAGCTGTTTCAGTT
GACGTCAGAACAACTTCAAGAAATGACAAATATGTACAATACTGGAAACT
TCGCCCATCCACCTTCCATCTTGTTTGAGGAGATCGAGGAGCTAAAGACA
AAGCTGGGAACCATCAGCAAGCAACGAGATGAATACTCAGATGCAATGAA
AAATGGCACCGCCCCTCCACCCGTACCGCCCCAACAACAAACTTCCACAA
ACTCTAATAATTCAGATTCTGACAGTCAACCATCCTCACCTAACTTAACA
AGAAGCACATTAAACTCGTTCAGCGATGGAAGTTACAACCAAAGCAATGG
AAATTCCCCTCATTCTTCGCTAAGAGCGCACATTCGTGCTTTTCTACCAA
ATAATCAAAGGACTATGATTAAATATAAGCTTGGACAAACGGTGAGAGAA
GCACTTTACAAAGCAATGTCGCGTCGTTCACTGACCACTGATTCCTATAG
AGTTTACAACAAAGCAAATCGAGAATTAATCGCTTGGGATTCGGACGTCT
CACTTCTAGATGGAGCAGAGGTGATTGTCGAGATGATAGACGAGGAAGAT
CCAAGCACCCAAAATATTTCACATAATTTTGTGCGAAAGACATTCTTCCG
GTTAGCGTTTTGTGATAAATGCACGAAGCTTCTAATCACGGGATTCAGat
GCACAACATGCAATTATCGGTTTCACCAGAAATGTGCTCAGGGGATACCT
CCTCTTTGTGAGCAAGCTGAACATTCACAGATTTACAAGAGGCTACTAGC
AAAACAGAATCCAAACAGTAACACGAATATCCCTTCAACACCTCGACCAA
TCTCTCAACGCGAACGTTCCATATCTGCTCCCAACGTTAATATGATCGGA
CAACCTGACTCGGGACTCATTGAGGCGGTTCTtgaaaaacattacaaaaa
cCGAACCAATCAAGAAACGGCAACTATATCAGgtGGTCTCACACGTCAAA
TGTCAAGTGGACCAAGTAGCGGGCGTGGACGGATAACCAATACTCTCTTC
ACGCCCACTAGCGTTAGTGCGCCCAATAGCGGCGAAAATTACTTCGATTT
CAACACTGCTAACAGTTTGCCCGCACCAGGAAATTCCAAGGCACAACAAA
TCTCCGGcattcctgactcgctaatacaCCCGGCACGCGACCGTAAAAAC
CGGATACGATCGTCTTCGGAAGAACACAAAAAGCCTCGCCGTCGCGATTC
GAACGATGATTGGGAGATTTACGCAGACGACTTGAAGATCGGAGAGAGGA
TAGGATCAGGCTCTTATGGAACTGTCTATAAGGGATACTGGCATGGCACA
GTGGCGGTAAAAACGTTGAATGTGAAAGACCCCAATCCTCAACAACTATT
AGCATTTCAAAACGAAGTCGGAGTTTTGCGAAAGACTCGTCATGTCAACG
TTCTACTATTCATGGGTTGTCTCTCCTCACCTAACCTAGCTATCGTTACT
CAATGGTGCGAAGGTTCCAGTCTCTACAGACATTTACACGTTTTGGAGAA
GAAGTTTCCTATGCATAACTTGATAGAAATTGCGAGACAAACTGCTCAAG
GGATAGACTATCTTCACGCAAAACAAATTATACATCGTGACTTGAAGTCA
AACAACATCTTTCTACAGCAGGATTTAACAGTGAAAATTGGAGATTTTGG
GCTTGCTACCGTCAAAACAAGGTGGAGTGGTGACCATGGCTGTGAACAAC
CTTCTGGATCCATCTTATGGATGGCGCCGGAAGTCATCAAGATGCAAGAC
CCAAACCCATACACTTTCTTCTCAGATGCTTATGCATTCGGCATTTGTAT
TTACGAGTTGATCACCGGCTCATTGCCTTATTGTAACATCGGGAATAAAG
ATATTCTTATATATAGAATTGGGCGTGGTTTTATCCGCCCCGATCAAAGC
AAGATTCGTTCGGATTGTCCGAAAGCTTTGAAACGATTATACCTGGATTG
TATTAAGTACAACCGAGACGAAAGGCCGCTTTTCAAACAGATCGTGAATT
CTTTGGAAACCATATTGATGGCACTACCTAAGATTACGAGGAGTACTTCT
GAGCCTATTTTAGGGCGTGCAAAACCGAGCACAGATGTTGAAATTGCTTA
CCCATGCCCCACCCCTCATACGCCCATCCAAGGGCAAGATGTATTCAGCT
TTTTGTCTGGCCAACCGCAACCTGTGTATTAGATGGCGGCGACGTCGGAA
AACAATTTATCTAACATTGCAAGAATTTCTGGAGGAGATTTGACGAGAGA
ACATCGTTCTCTGACTATCGACAACCTTAATTGTGGAGCAGAAGTAGATA
CAGGGCACTTTCAAAGCAATGGCATCAGGGCTTCGCAGATACTTAGCGAG
GCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAACAACTTCAAGA
AATGACAAATATGTACAATACTGGAAACTTCGCCCATCCACCTTCCATCT
TGTTTGAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAACCATCAGCAAG
CAACGAGATGAATACTCAGATGCAATGAAAAATGGCACCGCCCCTCCACC
CGTACCGCCCCAACAACAAACTTCCACAAACTCTAATAATTCAGATTCTG
ACAGTCAACCATCCTCACCTAACTTAACAAGAAGCACATTAAACTCGTTC
AGCGATGGAAGTTACAACCAAAGCAATGGAAATTCCCCTCATTCTTCGCT
AAGAGCGCACATTCGTGCTTTTCTACCAAATAATCAAAGGACTATGATTA
AATATAAGCTTGGACAAACGGTGAGAGAAGCACTTTACAAAGCAATGTCG
CGTCGTTCACTGACCACTGATTCCTATAGAGTTTACAACAAAGCAAATCG
AGAATTAATCGCTTGGGATTCGGACGTCTCACTTCTAGATGGAGCAGAGG
TGATTGTCGAGATGATAGACGAGGAAGATCCAAGCACCCAAAATATTTCA
CATAATTTTGTGCGAAAGACATTCTTCCGGTTAGCGTTTTGTGATAAATG
CACGAAGCTTCTAATCACGGGATTCAGatGCACAACATGCAATTATCGGT
TTCACCAGAAATGTGCTCAGGGGATACCTCCTCTTTGTGAGCAAGCTGAA
CATTCACAGATTTACAAGAGGCTACTAGCAAAACAGAATCCAAACAGTAA
CACGAATATCCCTTCAACACCTCGACCAATCTCTCAACGCGAACGTTCCA
TATCTGCTCCCAACGTTAATATGATCGGACAACCTGACTCGGGACTCATT
GAGGCGGTTCTtgaaaaacattacaaaaacCGAACCAATCAAGAAACGGC
AACTATATCAGgtGGTCTCACACGTCAAATGTCAAGTGGACCAAGTAGCG
GGCGTGGACGGATAACCAATACTCTCTTCACGCCCACTAGCGTTAGTGCG
CCCAATAGCGGCGAAAATTACTTCGATTTCAACACTGCTAACAGTTTGCC
CGCACCAGGAAATTCCAAGGCACAACAAATCTCCGGcattcctgactcgc
taatacaCCCGGCACGCGACCGTAAAAACCGGATACGATCGTCTTCGGAA
GAACACAAAAAGCCTCGCCGTCGCGATTCGAACGATGATTGGGAGATTTA
CGCAGACGACTTGAAGATCGGAGAGAGGATAGGATCAGGCTCTTATGGAA
CTGTCTATAAGGGATACTGGCATGGCACAGTGGCGGTAAAAACGTTGAAT
GTGAAAGACCCCAATCCTCAACAACTATTAGCATTTCAAAACGAAGTCGG
AGTTTTGCGAAAGACTCGTCATGTCAACGTTCTACTATTCATGGGTTGTC
TCTCCTCACCTAACCTAGCTATCGTTACTCAATGGTGCGAAGGTTCCAGT
CTCTACAGACATTTACACGTTTTGGAGAAGAAGTTTCCTATGCATAACTT
GATAGAAATTGCGAGACAAACTGCTCAAGGGATAGACTATCTTCACGCAA
AACAAATTATACATCGTGACTTGAAGTCAAACAACATCTTTCTACAGCAG
GATTTAACAGTGAAAATTGGAGATTTTGGGCTTGCTACCGTCAAAACAAG
GTGGAGTGGTGACCATGGCTGTGAACAACCTTCTGGATCCATCTTATGGA
TGGCGCCGGAAGTCATCAAGATGCAAGACCCAAACCCATACACTTTCTTC
TCAGATGCTTATGCATTCGGCATTTGTATTTACGAGTTGATCACCGGCTC
ATTGCCTTATTGTAACATCGGGAATAAAGATATTCTTATATATAGAATTG
GGCGTGGTTTTATCCGCCCCGATCAAAGCAAGATTCGTTCGGATTGTCCG
AAAGCTTTGAAACGATTATACCTGGATTGTATTAAGTACAACCGAGACGA
AAGGCCGCTTTTCAAACAGATCGTGAATTCTTTGGAAACCATATTGATGG
CACTACCTAAGATTACGAGGAGTACTTCTGAGCCTATTTTAGGGCGTGCA
AAACCGAGCACAGATGTTGAAATTGCTTACCCATGCCCCACCCCTCATAC
GCCCATCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGGCCAACCGCAAC
CTGTGTATTAGATGGCGGCGACGTCGGAAAACAATTTATCTAACATTGCA
AGAATTTCTGGAGGAGATTTGACGAGAGAACATCGTTCTCTGACTATCGA
CAACCTTAATTGTGGAGCAGAAGTAGATACAGGGCACTTTCAAAGCAATG
GCATCAGGGCTTCGCAGATACTTAGCGAGGCTCAAAATGTGGAAGAGCTG
TTTCAGTTGACGTCAGAACAACTTCAAGAAATGACAAATATGTACAATAC
TGGAAACTTCGCCCATCCACCTTCCATCTTGTTTGAGGAGATCGAGGAGC
TAAAGACAAAGCTGGGAACCATCAGCAAGCAACGAGATGAATACTCAGAT
GCAATGAAAAATGGCACCGCCCCTCCACCCGTACCGCCCCAACAACAAAC
TTCCACAAACTCTAATAATTCAGATTCTGACAGTCAACCATCCTCACCTA
ACTTAACAAGAAGCACATTAAACTCGTTCAGCGATGGAAGTTACAACCAA
AGCAATGGAAATTCCCCTCATTCTTCGCTAAGAGCGCACATTCGTGCTTT
TCTACCAAATAATCAAAGGACTATGATTAAATATAAGCTTGGACAAACGG
TGAGAGAAGCACTTTACAAAGCAATGTCGCGTCGTTCACTGACCACTGAT
TCCTATAGAGTTTACAACAAAGCAAATCGAGAATTAATCGCTTGGGATTC
GGACGTCTCACTTCTAGATGGAGCAGAGGTGATTGTCGAGATGATAGACG
AGGAAGATCCAAGCACCCAAAATATTTCACATAATTTTGTGCGAAAGACA
TTCTTCCGGTTAGCGTTTTGTGATAAATGCACGAAGCTTCTAATCACGGG
ATTCAGatGCACAACATGCAATTATCGGTTTCACCAGAAATGTGCTCAGG
GGATACCTCCTCTTTGTGAGCAAGCTGAACATTCACAGATTTACAAGAGG
CTACTAGCAAAACAGAATCCAAACAGTAACACGAATATCCCTTCAACACC
TCGACCAATCTCTCAACGCGAACGTTCCATATCTGCTCCCAACGTTAATA
TGATCGGACAACCTGACTCGGGACTCATTGAGGCGGTTCTtgaaaaacat
tacaaaaacCGAACCAATCAAGAAACGGCAACTATATCAGgtGGTCTCAC
ACGTCAAATGTCAAGTGGACCAAGTAGCGGGCGTGGACGGATAACCAATA
CTCTCTTCACGCCCACTAGCGTTAGTGCGCCCAATAGCGGCGAAAATTAC
TTCGATTTCAACACTGCTAACAGTTTGCCCGCACCAGGAAATTCCAAGGC
ACAACAAATCTCCGGcattcctgactcgctaatacaCCCGGCACGCGACC
GTAAAAACCGGATACGATCGTCTTCGGAAGAACACAAAAAGCCTCGCCGT
CGCGATTCGAACGATGATTGGGAGATTTACGCAGACGACTTGAAGATCGG
AGAGAGGATAGGATCAGGCTCTTATGGAACTGTCTATAAGGGATACTGGC
ATGGCACAGTGGCGGTAAAAACGTTGAATGTGAAAGACCCCAATCCTCAA
CAACTATTAGCATTTCAAAACGAAGTCGGAGTTTTGCGAAAGACTCGTCA
TGTCAACGTTCTACTATTCATGGGTTGTCTCTCCTCACCTAACCTAGCTA
TCGTTACTCAATGGTGCGAAGGTTCCAGTCTCTACAGACATTTACACGTT
TTGGAGAAGAAGTTTCCTATGCATAACTTGATAGAAATTGCGAGACAAAC
TGCTCAAGGGATAGACTATCTTCACGCAAAACAAATTATACATCGTGACT
TGAAGTCAAACAACATCTTTCTACAGCAGGATTTAACAGTGAAAATTGGA
GATTTTGGGCTTGCTACCGTCAAAACAAGGTGGAGTGGTGACCATGGCTG
TGAACAACCTTCTGGATCCATCTTATGGATGGCGCCGGAAGTCATCAAGA
TGCAAGACCCAAACCCATACACTTTCTTCTCAGATGCTTATGCATTCGGC
ATTTGTATTTACGAGTTGATCACCGGCTCATTGCCTTATTGTAACATCGG
GAATAAAGATATTCTTATATATAGAATTGGGCGTGGTTTTATCCGCCCCG
ATCAAAGCAAGATTCGTTCGGATTGTCCGAAAGCTTTGAAACGATTATAC
CTGGATTGTATTAAGTACAACCGAGACGAAAGGCCGCTTTTCAAACAGAT
CGTGAATTCTTTGGAAACCATATTGATGGCACTACCTAAGATTACGAGGA
GTACTTCTGAGCCTATTTTAGGGCGTGCAAAACCGAGCACAGATGTTGAA
ATTGCTTACCCATGCCCCACCCCTCATACGCCCATCCAAGGGCAAGATGT
ATTCAGCTTTTTGTCTGGCCAACCGCAACCTGTGTATTAGATGGCGGCGA
CGTCGGAAAACAATTTATCTAACATTGCAAGAATTTCTGGAGGAGATTTG
ACGAGAGAACATCGTTCTCTGACTATCGACAACCTTAATTGTGGAGCAGA
AGTAGATACAGGGCACTTTCAAAGCAATGGCATCAGGGCTTCGCAGATAC
TTAGCGAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAACAA
CTTCAAGAAATGACAAATATGTACAATACTGGAAACTTCGCCCATCCACC
TTCCATCTTGTTTGAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAACCA
TCAGCAAGCAACGAGATGAATACTCAGATGCAATGAAAAATGGCACCGCC
CCTCCACCCGTACCGCCCCAACAACAAACTTCCACAAACTCTAATAATTC
AGATTCTGACAGTCAACCATCCTCACCTAACTTAACAAGAAGCACATTAA
ACTCGTTCAGCGATGGAAGTTACAACCAAAGCAATGGAAATTCCCCTCAT
TCTTCGCTAAGAGCGCACATTCGTGCTTTTCTACCAAATAATCAAAGGAC
TATGATTAAATATAAGCTTGGACAAACGGTGAGAGAAGCACTTTACAAAG
CAATGTCGCGTCGTTCACTGACCACTGATTCCTATAGAGTTTACAACAAA
GCAAATCGAGAATTAATCGCTTGGGATTCGGACGTCTCACTTCTAGATGG
AGCAGAGGTGATTGTCGAGATGATAGACGAGGAAGATCCAAGCACCCAAA
ATATTTCACATAATTTTGTGCGAAAGACATTCTTCCGGTTAGCGTTTTGT
GATAAATGCACGAAGCTTCTAATCACGGGATTCAGatGCACAACATGCAA
TTATCGGTTTCACCAGAAATGTGCTCAGGGGATACCTCCTCTTTGTGAGC
AAGCTGAACATTCACAGATTTACAAGAGGCTACTAGCAAAACAGAATCCA
AACAGTAACACGAATATCCCTTCAACACCTCGACCAATCTCTCAACGCGA
ACGTTCCATATCTGCTCCCAACGTTAATATGATCGGACAACCTGACTCGG
GACTCATTGAGGCGGTTCTtgaaaaacattacaaaaacCGAACCAATCAA
GAAACGGCAACTATATCAGgtGGTCTCACACGTCAAATGTCAAGTGGACC
AAGTAGCGGGCGTGGACGGATAACCAATACTCTCTTCACGCCCACTAGCG
TTAGTGCGCCCAATAGCGGCGAAAATTACTTCGATTTCAACACTGCTAAC
AGTTTGCCCGCACCAGGAAATTCCAAGGCACAACAAATCTCCGGcattcc
tgactcgctaatacaCCCGGCACGCGACCGTAAAAACCGGATACGATCGT
CTTCGGAAGAACACAAAAAGCCTCGCCGTCGCGATTCGAACGATGATTGG
GAGATTTACGCAGACGACTTGAAGATCGGAGAGAGGATAGGATCAGGCTC
TTATGGAACTGTCTATAAGGGATACTGGCATGGCACAGTGGCGGTAAAAA
CGTTGAATGTGAAAGACCCCAATCCTCAACAACTATTAGCATTTCAAAAC
GAAGTCGGAGTTTTGCGAAAGACTCGTCATGTCAACGTTCTACTATTCAT
GGGTTGTCTCTCCTCACCTAACCTAGCTATCGTTACTCAATGGTGCGAAG
GTTCCAGTCTCTACAGACATTTACACGTTTTGGAGAAGAAGTTTCCTATG
CATAACTTGATAGAAATTGCGAGACAAACTGCTCAAGGGATAGACTATCT
TCACGCAAAACAAATTATACATCGTGACTTGAAGTCAAACAACATCTTTC
TACAGCAGGATTTAACAGTGAAAATTGGAGATTTTGGGCTTGCTACCGTC
AAAACAAGGTGGAGTGGTGACCATGGCTGTGAACAACCTTCTGGATCCAT
CTTATGGATGGCGCCGGAAGTCATCAAGATGCAAGACCCAAACCCATACA
CTTTCTTCTCAGATGCTTATGCATTCGGCATTTGTATTTACGAGTTGATC
ACCGGCTCATTGCCTTATTGTAACATCGGGAATAAAGATATTCTTATATA
TAGAATTGGGCGTGGTTTTATCCGCCCCGATCAAAGCAAGATTCGTTCGG
ATTGTCCGAAAGCTTTGAAACGATTATACCTGGATTGTATTAAGTACAAC
CGAGACGAAAGGCCGCTTTTCAAACAGATCGTGAATTCTTTGGAAACCAT
ATTGATGGCACTACCTAAGATTACGAGGAGTACTTCTGAGCCTATTTTAG
GGCGTGCAAAACCGAGCACAGATGTTGAAATTGCTTACCCATGCCCCACC
CCTCATACGCCCATCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGGCCA
ACCGCAACCTGTGTATTAGATGGCGGCGACGTCGGAAAACAATTTATCTA
ACATTGCAAGAATTTCTGGAGGAGATTTGACGAGAGAACATCGTTCTCTG
ACTATCGACAACCTTAATTGTGGAGCAGAAGTAGATACAGGGCACTTTCA
AAGCAATGGCATCAGGGCTTCGCAGATACTTAGCGAGGCTCAAAATGTGG
AAGAGCTGTTTCAGTTGACGTCAGAACAACTTCAAGAAATGACAAATATG
TACAATACTGGAAACTTCGCCCATCCACCTTCCATCTTGTTTGAGGAGAT
CGAGGAGCTAAAGACAAAGCTGGGAACCATCAGCAAGCAACGAGATGAAT
ACTCAGATGCAATGAAAAATGGCACCGCCCCTCCACCCGTACCGCCCCAA
CAACAAACTTCCACAAACTCTAATAATTCAGATTCTGACAGTCAACCATC
CTCACCTAACTTAACAAGAAGCACATTAAACTCGTTCAGCGATGGAAGTT
ACAACCAAAGCAATGGAAATTCCCCTCATTCTTCGCTAAGAGCGCACATT
CGTGCTTTTCTACCAAATAATCAAAGGACTATGATTAAATATAAGCTTGG
ACAAACGGTGAGAGAAGCACTTTACAAAGCAATGTCGCGTCGTTCACTGA
CCACTGATTCCTATAGAGTTTACAACAAAGCAAATCGAGAATTAATCGCT
TGGGATTCGGACGTCTCACTTCTAGATGGAGCAGAGGTGATTGTCGAGAT
GATAGACGAGGAAGATCCAAGCACCCAAAATATTTCACATAATTTTGTGC
GAAAGACATTCTTCCGGTTAGCGTTTTGTGATAAATGCACGAAGCTTCTA
ATCACGGGATTCAGatGCACAACATGCAATTATCGGTTTCACCAGAAATG
TGCTCAGGGGATACCTCCTCTTTGTGAGCAAGCTGAACATTCACAGATTT
ACAAGAGGCTACTAGCAAAACAGAATCCAAACAGTAACACGAATATCCCT
TCAACACCTCGACCAATCTCTCAACGCGAACGTTCCATATCTGCTCCCAA
CGTTAATATGATCGGACAACCTGACTCGGGACTCATTGAGGCGGTTCTtg
aaaaacattacaaaaacCGAACCAATCAAGAAACGGCAACTATATCAGgt
GGTCTCACACGTCAAATGTCAAGTGGACCAAGTAGCGGGCGTGGACGGAT
AACCAATACTCTCTTCACGCCCACTAGCGTTAGTGCGCCCAATAGCGGCG
AAAATTACTTCGATTTCAACACTGCTAACAGTTTGCCCGCACCAGGAAAT
TCCAAGGCACAACAAATCTCCGGcattcctgactcgctaatacaCCCGGC
ACGCGACCGTAAAAACCGGATACGATCGTCTTCGGAAGAACACAAAAAGC
CTCGCCGTCGCGATTCGAACGATGATTGGGAGATTTACGCAGACGACTTG
AAGATCGGAGAGAGGATAGGATCAGGCTCTTATGGAACTGTCTATAAGGG
ATACTGGCATGGCACAGTGGCGGTAAAAACGTTGAATGTGAAAGACCCCA
ATCCTCAACAACTATTAGCATTTCAAAACGAAGTCGGAGTTTTGCGAAAG
ACTCGTCATGTCAACGTTCTACTATTCATGGGTTGTCTCTCCTCACCTAA
CCTAGCTATCGTTACTCAATGGTGCGAAGGTTCCAGTCTCTACAGACATT
TACACGTTTTGGAGAAGAAGTTTCCTATGCATAACTTGATAGAAATTGCG
AGACAAACTGCTCAAGGGATAGACTATCTTCACGCAAAACAAATTATACA
TCGTGACTTGAAGTCAAACAACATCTTTCTACAGCAGGATTTAACAGTGA
AAATTGGAGATTTTGGGCTTGCTACCGTCAAAACAAGGTGGAGTGGTGAC
CATGGCTGTGAACAACCTTCTGGATCCATCTTATGGATGGCGCCGGAAGT
CATCAAGATGCAAGACCCAAACCCATACACTTTCTTCTCAGATGCTTATG
CATTCGGCATTTGTATTTACGAGTTGATCACCGGCTCATTGCCTTATTGT
AACATCGGGAATAAAGATATTCTTATATATAGAATTGGGCGTGGTTTTAT
CCGCCCCGATCAAAGCAAGATTCGTTCGGATTGTCCGAAAGCTTTGAAAC
GATTATACCTGGATTGTATTAAGTACAACCGAGACGAAAGGCCGCTTTTC
AAACAGATCGTGAATTCTTTGGAAACCATATTGATGGCACTACCTAAGAT
TACGAGGAGTACTTCTGAGCCTATTTTAGGGCGTGCAAAACCGAGCACAG
ATGTTGAAATTGCTTACCCATGCCCCACCCCTCATACGCCCATCCAAGGG
CAAGATGTATTCAGCTTTTTGTCTGGCCAACCGCAACCTGTGTATTAGAT
GGCGGCGACGTCGGAAAACAATTTATCTAACATTGCAAGAATTTCTGGAG
GAGATTTGACGAGAGAACATCGTTCTCTGACTATCGACAACCTTAATTGT
GGAGCAGAAGTAGATACAGGGCACTTTCAAAGCAATGGCATCAGGGCTTC
GCAGATACTTAGCGAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGT
CAGAACAACTTCAAGAAATGACAAATATGTACAATACTGGAAACTTCGCC
CATCCACCTTCCATCTTGTTTGAGGAGATCGAGGAGCTAAAGACAAAGCT
GGGAACCATCAGCAAGCAACGAGATGAATACTCAGATGCAATGAAAAATG
GCACCGCCCCTCCACCCGTACCGCCCCAACAACAAACTTCCACAAACTCT
AATAATTCAGATTCTGACAGTCAACCATCCTCACCTAACTTAACAAGAAG
CACATTAAACTCGTTCAGCGATGGAAGTTACAACCAAAGCAATGGAAATT
CCCCTCATTCTTCGCTAAGAGCGCACATTCGTGCTTTTCTACCAAATAAT
CAAAGGACTATGATTAAATATAAGCTTGGACAAACGGTGAGAGAAGCACT
TTACAAAGCAATGTCGCGTCGTTCACTGACCACTGATTCCTATAGAGTTT
ACAACAAAGCAAATCGAGAATTAATCGCTTGGGATTCGGACGTCTCACTT
CTAGATGGAGCAGAGGTGATTGTCGAGATGATAGACGAGGAAGATCCAAG
CACCCAAAATATTTCACATAATTTTGTGCGAAAGACATTCTTCCGGTTAG
CGTTTTGTGATAAATGCACGAAGCTTCTAATCACGGGATTCAGatGCACA
ACATGCAATTATCGGTTTCACCAGAAATGTGCTCAGGGGATACCTCCTCT
TTGTGAGCAAGCTGAACATTCACAGATTTACAAGAGGCTACTAGCAAAAC
AGAATCCAAACAGTAACACGAATATCCCTTCAACACCTCGACCAATCTCT
CAACGCGAACGTTCCATATCTGCTCCCAACGTTAATATGATCGGACAACC
TGACTCGGGACTCATTGAGGCGGTTCTtgaaaaacattacaaaaacCGAA
CCAATCAAGAAACGGCAACTATATCAGgtGGTCTCACACGTCAAATGTCA
AGTGGACCAAGTAGCGGGCGTGGACGGATAACCAATACTCTCTTCACGCC
CACTAGCGTTAGTGCGCCCAATAGCGGCGAAAATTACTTCGATTTCAACA
CTGCTAACAGTTTGCCCGCACCAGGAAATTCCAAGGCACAACAAATCTCC
GGcattcctgactcgctaatacaCCCGGCACGCGACCGTAAAAACCGGAT
ACGATCGTCTTCGGAAGAACACAAAAAGCCTCGCCGTCGCGATTCGAACG
ATGATTGGGAGATTTACGCAGACGACTTGAAGATCGGAGAGAGGATAGGA
TCAGGCTCTTATGGAACTGTCTATAAGGGATACTGGCATGGCACAGTGGC
GGTAAAAACGTTGAATGTGAAAGACCCCAATCCTCAACAACTATTAGCAT
TTCAAAACGAAGTCGGAGTTTTGCGAAAGACTCGTCATGTCAACGTTCTA
CTATTCATGGGTTGTCTCTCCTCACCTAACCTAGCTATCGTTACTCAATG
GTGCGAAGGTTCCAGTCTCTACAGACATTTACACGTTTTGGAGAAGAAGT
TTCCTATGCATAACTTGATAGAAATTGCGAGACAAACTGCTCAAGGGATA
GACTATCTTCACGCAAAACAAATTATACATCGTGACTTGAAGTCAAACAA
CATCTTTCTACAGCAGGATTTAACAGTGAAAATTGGAGATTTTGGGCTTG
CTACCGTCAAAACAAGGTGGAGTGGTGACCATGGCTGTGAACAACCTTCT
GGATCCATCTTATGGATGGCGCCGGAAGTCATCAAGATGCAAGACCCAAA
CCCATACACTTTCTTCTCAGATGCTTATGCATTCGGCATTTGTATTTACG
AGTTGATCACCGGCTCATTGCCTTATTGTAACATCGGGAATAAAGATATT
CTTATATATAGAATTGGGCGTGGTTTTATCCGCCCCGATCAAAGCAAGAT
TCGTTCGGATTGTCCGAAAGCTTTGAAACGATTATACCTGGATTGTATTA
AGTACAACCGAGACGAAAGGCCGCTTTTCAAACAGATCGTGAATTCTTTG
GAAACCATATTGATGGCACTACCTAAGATTACGAGGAGTACTTCTGAGCC
TATTTTAGGGCGTGCAAAACCGAGCACAGATGTTGAAATTGCTTACCCAT
GCCCCACCCCTCATACGCCCATCCAAGGGCAAGATGTATTCAGCTTTTTG
TCTGGCCAACCGCAACCTGTGTATTAGATGGCGGCGACGTCGGAAAACAA
TTTATCTAACATTGCAAGAATTTCTGGAGGAGATTTGACGAGAGAACATC
GTTCTCTGACTATCGACAACCTTAATTGTGGAGCAGAAGTAGATACAGGG
CACTTTCAAAGCAATGGCATCAGGGCTTCGCAGATACTTAGCGAGGCTCA
AAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAACAACTTCAAGAAATGA
CAAATATGTACAATACTGGAAACTTCGCCCATCCACCTTCCATCTTGTTT
GAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAACCATCAGCAAGCAACG
AGATGAATACTCAGATGCAATGAAAAATGGCACCGCCCCTCCACCCGTAC
CGCCCCAACAACAAACTTCCACAAACTCTAATAATTCAGATTCTGACAGT
CAACCATCCTCACCTAACTTAACAAGAAGCACATTAAACTCGTTCAGCGA
TGGAAGTTACAACCAAAGCAATGGAAATTCCCCTCATTCTTCGCTAAGAG
CGCACATTCGTGCTTTTCTACCAAATAATCAAAGGACTATGATTAAATAT
AAGCTTGGACAAACGGTGAGAGAAGCACTTTACAAAGCAATGTCGCGTCG
TTCACTGACCACTGATTCCTATAGAGTTTACAACAAAGCAAATCGAGAAT
TAATCGCTTGGGATTCGGACGTCTCACTTCTAGATGGAGCAGAGGTGATT
GTCGAGATGATAGACGAGGAAGATCCAAGCACCCAAAATATTTCACATAA
TTTTGTGCGAAAGACATTCTTCCGGTTAGCGTTTTGTGATAAATGCACGA
AGCTTCTAATCACGGGATTCAGatGCACAACATGCAATTATCGGTTTCAC
CAGAAATGTGCTCAGGGGATACCTCCTCTTTGTGAGCAAGCTGAACATTC
ACAGATTTACAAGAGGCTACTAGCAAAACAGAATCCAAACAGTAACACGA
ATATCCCTTCAACACCTCGACCAATCTCTCAACGCGAACGTTCCATATCT
GCTCCCAACGTTAATATGATCGGACAACCTGACTCGGGACTCATTGAGGC
GGTTCTtgaaaaacattacaaaaacCGAACCAATCAAGAAACGGCAACTA
TATCAGgtGGTCTCACACGTCAAATGTCAAGTGGACCAAGTAGCGGGCGT
GGACGGATAACCAATACTCTCTTCACGCCCACTAGCGTTAGTGCGCCCAA
TAGCGGCGAAAATTACTTCGATTTCAACACTGCTAACAGTTTGCCCGCAC
CAGGAAATTCCAAGGCACAACAAATCTCCGGcattcctgactcgctaata
caCCCGGCACGCGACCGTAAAAACCGGATACGATCGTCTTCGGAAGAACA
CAAAAAGCCTCGCCGTCGCGATTCGAACGATGATTGGGAGATTTACGCAG
ACGACTTGAAGATCGGAGAGAGGATAGGATCAGGCTCTTATGGAACTGTC
TATAAGGGATACTGGCATGGCACAGTGGCGGTAAAAACGTTGAATGTGAA
AGACCCCAATCCTCAACAACTATTAGCATTTCAAAACGAAGTCGGAGTTT
TGCGAAAGACTCGTCATGTCAACGTTCTACTATTCATGGGTTGTCTCTCC
TCACCTAACCTAGCTATCGTTACTCAATGGTGCGAAGGTTCCAGTCTCTA
CAGACATTTACACGTTTTGGAGAAGAAGTTTCCTATGCATAACTTGATAG
AAATTGCGAGACAAACTGCTCAAGGGATAGACTATCTTCACGCAAAACAA
ATTATACATCGTGACTTGAAGTCAAACAACATCTTTCTACAGCAGGATTT
AACAGTGAAAATTGGAGATTTTGGGCTTGCTACCGTCAAAACAAGGTGGA
GTGGTGACCATGGCTGTGAACAACCTTCTGGATCCATCTTATGGATGGCG
CCGGAAGTCATCAAGATGCAAGACCCAAACCCATACACTTTCTTCTCAGA
TGCTTATGCATTCGGCATTTGTATTTACGAGTTGATCACCGGCTCATTGC
CTTATTGTAACATCGGGAATAAAGATATTCTTATATATAGAATTGGGCGT
GGTTTTATCCGCCCCGATCAAAGCAAGATTCGTTCGGATTGTCCGAAAGC
TTTGAAACGATTATACCTGGATTGTATTAAGTACAACCGAGACGAAAGGC
CGCTTTTCAAACAGATCGTGAATTCTTTGGAAACCATATTGATGGCACTA
CCTAAGATTACGAGGAGTACTTCTGAGCCTATTTTAGGGCGTGCAAAACC
GAGCACAGATGTTGAAATTGCTTACCCATGCCCCACCCCTCATACGCCCA
TCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGGCCAACCGCAACCTGTG
TATTAGATGGCGGCGACGTCGGAAAACAATTTATCTAACATTGCAAGAAT
TTCTGGAGGAGATTTGACGAGAGAACATCGTTCTCTGACTATCGACAACC
TTAATTGTGGAGCAGAAGTAGATACAGGGCACTTTCAAAGCAATGGCATC
AGGGCTTCGCAGATACTTAGCGAGGCTCAAAATGTGGAAGAGCTGTTTCA
GTTGACGTCAGAACAACTTCAAGAAATGACAAATATGTACAATACTGGAA
ACTTCGCCCATCCACCTTCCATCTTGTTTGAGGAGATCGAGGAGCTAAAG
ACAAAGCTGGGAACCATCAGCAAGCAACGAGATGAATACTCAGATGCAAT
GAAAAATGGCACCGCCCCTCCACCCGTACCGCCCCAACAACAAACTTCCA
CAAACTCTAATAATTCAGATTCTGACAGTCAACCATCCTCACCTAACTTA
ACAAGAAGCACATTAAACTCGTTCAGCGATGGAAGTTACAACCAAAGCAA
TGGAAATTCCCCTCATTCTTCGCTAAGAGCGCACATTCGTGCTTTTCTAC
CAAATAATCAAAGGACTATGATTAAATATAAGCTTGGACAAACGGTGAGA
GAAGCACTTTACAAAGCAATGTCGCGTCGTTCACTGACCACTGATTCCTA
TAGAGTTTACAACAAAGCAAATCGAGAATTAATCGCTTGGGATTCGGACG
TCTCACTTCTAGATGGAGCAGAGGTGATTGTCGAGATGATAGACGAGGAA
GATCCAAGCACCCAAAATATTTCACATAATTTTGTGCGAAAGACATTCTT
CCGGTTAGCGTTTTGTGATAAATGCACGAAGCTTCTAATCACGGGATTCA
GatGCACAACATGCAATTATCGGTTTCACCAGAAATGTGCTCAGGGGATA
CCTCCTCTTTGTGAGCAAGCTGAACATTCACAGATTTACAAGAGGCTACT
AGCAAAACAGAATCCAAACAGTAACACGAATATCCCTTCAACACCTCGAC
CAATCTCTCAACGCGAACGTTCCATATCTGCTCCCAACGTTAATATGATC
GGACAACCTGACTCGGGACTCATTGAGGCGGTTCTtgaaaaacattacaa
aaacCGAACCAATCAAGAAACGGCAACTATATCAGgtGGTCTCACACGTC
AAATGTCAAGTGGACCAAGTAGCGGGCGTGGACGGATAACCAATACTCTC
TTCACGCCCACTAGCGTTAGTGCGCCCAATAGCGGCGAAAATTACTTCGA
TTTCAACACTGCTAACAGTTTGCCCGCACCAGGAAATTCCAAGGCACAAC
AAATCTCCGGcattcctgactcgctaatacaCCCGGCACGCGACCGTAAA
AACCGGATACGATCGTCTTCGGAAGAACACAAAAAGCCTCGCCGTCGCGA
TTCGAACGATGATTGGGAGATTTACGCAGACGACTTGAAGATCGGAGAGA
GGATAGGATCAGGCTCTTATGGAACTGTCTATAAGGGATACTGGCATGGC
ACAGTGGCGGTAAAAACGTTGAATGTGAAAGACCCCAATCCTCAACAACT
ATTAGCATTTCAAAACGAAGTCGGAGTTTTGCGAAAGACTCGTCATGTCA
ACGTTCTACTATTCATGGGTTGTCTCTCCTCACCTAACCTAGCTATCGTT
ACTCAATGGTGCGAAGGTTCCAGTCTCTACAGACATTTACACGTTTTGGA
GAAGAAGTTTCCTATGCATAACTTGATAGAAATTGCGAGACAAACTGCTC
AAGGGATAGACTATCTTCACGCAAAACAAATTATACATCGTGACTTGAAG
TCAAACAACATCTTTCTACAGCAGGATTTAACAGTGAAAATTGGAGATTT
TGGGCTTGCTACCGTCAAAACAAGGTGGAGTGGTGACCATGGCTGTGAAC
AACCTTCTGGATCCATCTTATGGATGGCGCCGGAAGTCATCAAGATGCAA
GACCCAAACCCATACACTTTCTTCTCAGATGCTTATGCATTCGGCATTTG
TATTTACGAGTTGATCACCGGCTCATTGCCTTATTGTAACATCGGGAATA
AAGATATTCTTATATATAGAATTGGGCGTGGTTTTATCCGCCCCGATCAA
AGCAAGATTCGTTCGGATTGTCCGAAAGCTTTGAAACGATTATACCTGGA
TTGTATTAAGTACAACCGAGACGAAAGGCCGCTTTTCAAACAGATCGTGA
ATTCTTTGGAAACCATATTGATGGCACTACCTAAGATTACGAGGAGTACT
TCTGAGCCTATTTTAGGGCGTGCAAAACCGAGCACAGATGTTGAAATTGC
TTACCCATGCCCCACCCCTCATACGCCCATCCAAGGGCAAGATGTATTCA
GCTTTTTGTCTGGCCAACCGCAACCTGTGTATTAGATGGCGGCGACGTCG
GAAAACAATTTATCTAACATTGCAAGAATTTCTGGAGGAGATTTGACGAG
AGAACATCGTTCTCTGACTATCGACAACCTTAATTGTGGAGCAGAAGTAG
ATACAGGGCACTTTCAAAGCAATGGCATCAGGGCTTCGCAGATACTTAGC
GAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAACAACTTCA
AGAAATGACAAATATGTACAATACTGGAAACTTCGCCCATCCACCTTCCA
TCTTGTTTGAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAACCATCAGC
AAGCAACGAGATGAATACTCAGATGCAATGAAAAATGGCACCGCCCCTCC
ACCCGTACCGCCCCAACAACAAACTTCCACAAACTCTAATAATTCAGATT
CTGACAGTCAACCATCCTCACCTAACTTAACAAGAAGCACATTAAACTCG
TTCAGCGATGGAAGTTACAACCAAAGCAATGGAAATTCCCCTCATTCTTC
GCTAAGAGCGCACATTCGTGCTTTTCTACCAAATAATCAAAGGACTATGA
TTAAATATAAGCTTGGACAAACGGTGAGAGAAGCACTTTACAAAGCAATG
TCGCGTCGTTCACTGACCACTGATTCCTATAGAGTTTACAACAAAGCAAA
TCGAGAATTAATCGCTTGGGATTCGGACGTCTCACTTCTAGATGGAGCAG
AGGTGATTGTCGAGATGATAGACGAGGAAGATCCAAGCACCCAAAATATT
TCACATAATTTTGTGCGAAAGACATTCTTCCGGTTAGCGTTTTGTGATAA
ATGCACGAAGCTTCTAATCACGGGATTCAGatGCACAACATGCAATTATC
GGTTTCACCAGAAATGTGCTCAGGGGATACCTCCTCTTTGTGAGCAAGCT
GAACATTCACAGATTTACAAGAGGCTACTAGCAAAACAGAATCCAAACAG
TAACACGAATATCCCTTCAACACCTCGACCAATCTCTCAACGCGAACGTT
CCATATCTGCTCCCAACGTTAATATGATCGGACAACCTGACTCGGGACTC
ATTGAGGCGGTTCTtgaaaaacattacaaaaacCGAACCAATCAAGAAAC
GGCAACTATATCAGgtGGTCTCACACGTCAAATGTCAAGTGGACCAAGTA
GCGGGCGTGGACGGATAACCAATACTCTCTTCACGCCCACTAGCGTTAGT
GCGCCCAATAGCGGCGAAAATTACTTCGATTTCAACACTGCTAACAGTTT
GCCCGCACCAGGAAATTCCAAGGCACAACAAATCTCCGGcattcctgact
cgctaatacaCCCGGCACGCGACCGTAAAAACCGGATACGATCGTCTTCG
GAAGAACACAAAAAGCCTCGCCGTCGCGATTCGAACGATGATTGGGAGAT
TTACGCAGACGACTTGAAGATCGGAGAGAGGATAGGATCAGGCTCTTATG
GAACTGTCTATAAGGGATACTGGCATGGCACAGTGGCGGTAAAAACGTTG
AATGTGAAAGACCCCAATCCTCAACAACTATTAGCATTTCAAAACGAAGT
CGGAGTTTTGCGAAAGACTCGTCATGTCAACGTTCTACTATTCATGGGTT
GTCTCTCCTCACCTAACCTAGCTATCGTTACTCAATGGTGCGAAGGTTCC
AGTCTCTACAGACATTTACACGTTTTGGAGAAGAAGTTTCCTATGCATAA
CTTGATAGAAATTGCGAGACAAACTGCTCAAGGGATAGACTATCTTCACG
CAAAACAAATTATACATCGTGACTTGAAGTCAAACAACATCTTTCTACAG
CAGGATTTAACAGTGAAAATTGGAGATTTTGGGCTTGCTACCGTCAAAAC
AAGGTGGAGTGGTGACCATGGCTGTGAACAACCTTCTGGATCCATCTTAT
GGATGGCGCCGGAAGTCATCAAGATGCAAGACCCAAACCCATACACTTTC
TTCTCAGATGCTTATGCATTCGGCATTTGTATTTACGAGTTGATCACCGG
CTCATTGCCTTATTGTAACATCGGGAATAAAGATATTCTTATATATAGAA
TTGGGCGTGGTTTTATCCGCCCCGATCAAAGCAAGATTCGTTCGGATTGT
CCGAAAGCTTTGAAACGATTATACCTGGATTGTATTAAGTACAACCGAGA
CGAAAGGCCGCTTTTCAAACAGATCGTGAATTCTTTGGAAACCATATTGA
TGGCACTACCTAAGATTACGAGGAGTACTTCTGAGCCTATTTTAGGGCGT
GCAAAACCGAGCACAGATGTTGAAATTGCTTACCCATGCCCCACCCCTCA
TACGCCCATCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGGCCAACCGC
AACCTGTGTATTAGATGGCGGCGACGTCGGAAAACAATTTATCTAACATT
GCAAGAATTTCTGGAGGAGATTTGACGAGAGAACATCGTTCTCTGACTAT
CGACAACCTTAATTGTGGAGCAGAAGTAGATACAGGGCACTTTCAAAGCA
ATGGCATCAGGGCTTCGCAGATACTTAGCGAGGCTCAAAATGTGGAAGAG
CTGTTTCAGTTGACGTCAGAACAACTTCAAGAAATGACAAATATGTACAA
TACTGGAAACTTCGCCCATCCACCTTCCATCTTGTTTGAGGAGATCGAGG
AGCTAAAGACAAAGCTGGGAACCATCAGCAAGCAACGAGATGAATACTCA
GATGCAATGAAAAATGGCACCGCCCCTCCACCCGTACCGCCCCAACAACA
AACTTCCACAAACTCTAATAATTCAGATTCTGACAGTCAACCATCCTCAC
CTAACTTAACAAGAAGCACATTAAACTCGTTCAGCGATGGAAGTTACAAC
CAAAGCAATGGAAATTCCCCTCATTCTTCGCTAAGAGCGCACATTCGTGC
TTTTCTACCAAATAATCAAAGGACTATGATTAAATATAAGCTTGGACAAA
CGGTGAGAGAAGCACTTTACAAAGCAATGTCGCGTCGTTCACTGACCACT
GATTCCTATAGAGTTTACAACAAAGCAAATCGAGAATTAATCGCTTGGGA
TTCGGACGTCTCACTTCTAGATGGAGCAGAGGTGATTGTCGAGATGATAG
ACGAGGAAGATCCAAGCACCCAAAATATTTCACATAATTTTGTGCGAAAG
ACATTCTTCCGGTTAGCGTTTTGTGATAAATGCACGAAGCTTCTAATCAC
GGGATTCAGatGCACAACATGCAATTATCGGTTTCACCAGAAATGTGCTC
AGGGGATACCTCCTCTTTGTGAGCAAGCTGAACATTCACAGATTTACAAG
AGGCTACTAGCAAAACAGAATCCAAACAGTAACACGAATATCCCTTCAAC
ACCTCGACCAATCTCTCAACGCGAACGTTCCATATCTGCTCCCAACGTTA
ATATGATCGGACAACCTGACTCGGGACTCATTGAGGCGGTTCTtgaaaaa
cattacaaaaacCGAACCAATCAAGAAACGGCAACTATATCAGgtGGTCT
CACACGTCAAATGTCAAGTGGACCAAGTAGCGGGCGTGGACGGATAACCA
ATACTCTCTTCACGCCCACTAGCGTTAGTGCGCCCAATAGCGGCGAAAAT
TACTTCGATTTCAACACTGCTAACAGTTTGCCCGCACCAGGAAATTCCAA
GGCACAACAAATCTCCGGcattcctgactcgctaatacaCCCGGCACGCG
ACCGTAAAAACCGGATACGATCGTCTTCGGAAGAACACAAAAAGCCTCGC
CGTCGCGATTCGAACGATGATTGGGAGATTTACGCAGACGACTTGAAGAT
CGGAGAGAGGATAGGATCAGGCTCTTATGGAACTGTCTATAAGGGATACT
GGCATGGCACAGTGGCGGTAAAAACGTTGAATGTGAAAGACCCCAATCCT
CAACAACTATTAGCATTTCAAAACGAAGTCGGAGTTTTGCGAAAGACTCG
TCATGTCAACGTTCTACTATTCATGGGTTGTCTCTCCTCACCTAACCTAG
CTATCGTTACTCAATGGTGCGAAGGTTCCAGTCTCTACAGACATTTACAC
GTTTTGGAGAAGAAGTTTCCTATGCATAACTTGATAGAAATTGCGAGACA
AACTGCTCAAGGGATAGACTATCTTCACGCAAAACAAATTATACATCGTG
ACTTGAAGTCAAACAACATCTTTCTACAGCAGGATTTAACAGTGAAAATT
GGAGATTTTGGGCTTGCTACCGTCAAAACAAGGTGGAGTGGTGACCATGG
CTGTGAACAACCTTCTGGATCCATCTTATGGATGGCGCCGGAAGTCATCA
AGATGCAAGACCCAAACCCATACACTTTCTTCTCAGATGCTTATGCATTC
GGCATTTGTATTTACGAGTTGATCACCGGCTCATTGCCTTATTGTAACAT
CGGGAATAAAGATATTCTTATATATAGAATTGGGCGTGGTTTTATCCGCC
CCGATCAAAGCAAGATTCGTTCGGATTGTCCGAAAGCTTTGAAACGATTA
TACCTGGATTGTATTAAGTACAACCGAGACGAAAGGCCGCTTTTCAAACA
GATCGTGAATTCTTTGGAAACCATATTGATGGCACTACCTAAGATTACGA
GGAGTACTTCTGAGCCTATTTTAGGGCGTGCAAAACCGAGCACAGATGTT
GAAATTGCTTACCCATGCCCCACCCCTCATACGCCCATCCAAGGGCAAGA
TGTATTCAGCTTTTTGTCTGGCCAACCGCAACCTGTGTATTAGATGGCGG
CGACGTCGGAAAACAATTTATCTAACATTGCAAGAATTTCTGGAGGAGAT
TTGACGAGAGAACATCGTTCTCTGACTATCGACAACCTTAATTGTGGAGC
AGAAGTAGATACAGGGCACTTTCAAAGCAATGGCATCAGGGCTTCGCAGA
TACTTAGCGAGGCTCAAAATGTGGAAGAGCTGTTTCAGTTGACGTCAGAA
CAACTTCAAGAAATGACAAATATGTACAATACTGGAAACTTCGCCCATCC
ACCTTCCATCTTGTTTGAGGAGATCGAGGAGCTAAAGACAAAGCTGGGAA
CCATCAGCAAGCAACGAGATGAATACTCAGATGCAATGAAAAATGGCACC
GCCCCTCCACCCGTACCGCCCCAACAACAAACTTCCACAAACTCTAATAA
TTCAGATTCTGACAGTCAACCATCCTCACCTAACTTAACAAGAAGCACAT
TAAACTCGTTCAGCGATGGAAGTTACAACCAAAGCAATGGAAATTCCCCT
CATTCTTCGCTAAGAGCGCACATTCGTGCTTTTCTACCAAATAATCAAAG
GACTATGATTAAATATAAGCTTGGACAAACGGTGAGAGAAGCACTTTACA
AAGCAATGTCGCGTCGTTCACTGACCACTGATTCCTATAGAGTTTACAAC
AAAGCAAATCGAGAATTAATCGCTTGGGATTCGGACGTCTCACTTCTAGA
TGGAGCAGAGGTGATTGTCGAGATGATAGACGAGGAAGATCCAAGCACCC
AAAATATTTCACATAATTTTGTGCGAAAGACATTCTTCCGGTTAGCGTTT
TGTGATAAATGCACGAAGCTTCTAATCACGGGATTCAGatGCACAACATG
CAATTATCGGTTTCACCAGAAATGTGCTCAGGGGATACCTCCTCTTTGTG
AGCAAGCTGAACATTCACAGATTTACAAGAGGCTACTAGCAAAACAGAAT
CCAAACAGTAACACGAATATCCCTTCAACACCTCGACCAATCTCTCAACG
CGAACGTTCCATATCTGCTCCCAACGTTAATATGATCGGACAACCTGACT
CGGGACTCATTGAGGCGGTTCTtgaaaaacattacaaaaacCGAACCAAT
CAAGAAACGGCAACTATATCAGgtGGTCTCACACGTCAAATGTCAAGTGG
ACCAAGTAGCGGGCGTGGACGGATAACCAATACTCTCTTCACGCCCACTA
GCGTTAGTGCGCCCAATAGCGGCGAAAATTACTTCGATTTCAACACTGCT
AACAGTTTGCCCGCACCAGGAAATTCCAAGGCACAACAAATCTCCGGcat
tcctgactcgctaatacaCCCGGCACGCGACCGTAAAAACCGGATACGAT
CGTCTTCGGAAGAACACAAAAAGCCTCGCCGTCGCGATTCGAACGATGAT
TGGGAGATTTACGCAGACGACTTGAAGATCGGAGAGAGGATAGGATCAGG
CTCTTATGGAACTGTCTATAAGGGATACTGGCATGGCACAGTGGCGGTAA
AAACGTTGAATGTGAAAGACCCCAATCCTCAACAACTATTAGCATTTCAA
AACGAAGTCGGAGTTTTGCGAAAGACTCGTCATGTCAACGTTCTACTATT
CATGGGTTGTCTCTCCTCACCTAACCTAGCTATCGTTACTCAATGGTGCG
AAGGTTCCAGTCTCTACAGACATTTACACGTTTTGGAGAAGAAGTTTCCT
ATGCATAACTTGATAGAAATTGCGAGACAAACTGCTCAAGGGATAGACTA
TCTTCACGCAAAACAAATTATACATCGTGACTTGAAGTCAAACAACATCT
TTCTACAGCAGGATTTAACAGTGAAAATTGGAGATTTTGGGCTTGCTACC
GTCAAAACAAGGTGGAGTGGTGACCATGGCTGTGAACAACCTTCTGGATC
CATCTTATGGATGGCGCCGGAAGTCATCAAGATGCAAGACCCAAACCCAT
ACACTTTCTTCTCAGATGCTTATGCATTCGGCATTTGTATTTACGAGTTG
ATCACCGGCTCATTGCCTTATTGTAACATCGGGAATAAAGATATTCTTAT
ATATAGAATTGGGCGTGGTTTTATCCGCCCCGATCAAAGCAAGATTCGTT
CGGATTGTCCGAAAGCTTTGAAACGATTATACCTGGATTGTATTAAGTAC
AACCGAGACGAAAGGCCGCTTTTCAAACAGATCGTGAATTCTTTGGAAAC
CATATTGATGGCACTACCTAAGATTACGAGGAGTACTTCTGAGCCTATTT
TAGGGCGTGCAAAACCGAGCACAGATGTTGAAATTGCTTACCCATGCCCC
ACCCCTCATACGCCCATCCAAGGGCAAGATGTATTCAGCTTTTTGTCTGG
CCAACCGCAACCTGTGTATTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000587XLOC_000587Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001030-proteinTCONS_00001030-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001030-exon-sc0000007-1491911889:790173..790683TCONS_00001030-exon-sc0000007-1491911889:790173..790683Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:790173..790683TCONS_00001030-exon-sc0000007-1510915933:790173..790683Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:790173..790683TCONS_00001030-exon-sc0000007-1575043694:790173..790683Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:800027..800134TCONS_00001030-exon-sc0000007-1491911889:800027..800134Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:800027..800134TCONS_00001030-exon-sc0000007-1510915933:800027..800134Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:800027..800134TCONS_00001030-exon-sc0000007-1575043694:800027..800134Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:802438..802725TCONS_00001030-exon-sc0000007-1491911889:802438..802725Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:802438..802725TCONS_00001030-exon-sc0000007-1510915933:802438..802725Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:802438..802725TCONS_00001030-exon-sc0000007-1575043694:802438..802725Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:802866..802969TCONS_00001030-exon-sc0000007-1491911889:802866..802969Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:802866..802969TCONS_00001030-exon-sc0000007-1510915933:802866..802969Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:802866..802969TCONS_00001030-exon-sc0000007-1575043694:802866..802969Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:803115..803163TCONS_00001030-exon-sc0000007-1491911889:803115..803163Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:803115..803163TCONS_00001030-exon-sc0000007-1510915933:803115..803163Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:803115..803163TCONS_00001030-exon-sc0000007-1575043694:803115..803163Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:803349..803408TCONS_00001030-exon-sc0000007-1491911889:803349..803408Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:803349..803408TCONS_00001030-exon-sc0000007-1510915933:803349..803408Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:803349..803408TCONS_00001030-exon-sc0000007-1575043694:803349..803408Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:803578..803645TCONS_00001030-exon-sc0000007-1491911889:803578..803645Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:803578..803645TCONS_00001030-exon-sc0000007-1510915933:803578..803645Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:803578..803645TCONS_00001030-exon-sc0000007-1575043694:803578..803645Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:803762..803854TCONS_00001030-exon-sc0000007-1491911889:803762..803854Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:803762..803854TCONS_00001030-exon-sc0000007-1510915933:803762..803854Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:803762..803854TCONS_00001030-exon-sc0000007-1575043694:803762..803854Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:803998..804130TCONS_00001030-exon-sc0000007-1491911889:803998..804130Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:803998..804130TCONS_00001030-exon-sc0000007-1510915933:803998..804130Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:803998..804130TCONS_00001030-exon-sc0000007-1575043694:803998..804130Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:804280..804337TCONS_00001030-exon-sc0000007-1491911889:804280..804337Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:804280..804337TCONS_00001030-exon-sc0000007-1510915933:804280..804337Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:804280..804337TCONS_00001030-exon-sc0000007-1575043694:804280..804337Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:804515..804765TCONS_00001030-exon-sc0000007-1491911889:804515..804765Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:804515..804765TCONS_00001030-exon-sc0000007-1510915933:804515..804765Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:804515..804765TCONS_00001030-exon-sc0000007-1575043694:804515..804765Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:805321..805432TCONS_00001030-exon-sc0000007-1491911889:805321..805432Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:805321..805432TCONS_00001030-exon-sc0000007-1510915933:805321..805432Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:805321..805432TCONS_00001030-exon-sc0000007-1575043694:805321..805432Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:805744..806005TCONS_00001030-exon-sc0000007-1491911889:805744..806005Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:805744..806005TCONS_00001030-exon-sc0000007-1510915933:805744..806005Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:805744..806005TCONS_00001030-exon-sc0000007-1575043694:805744..806005Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:806754..806800TCONS_00001030-exon-sc0000007-1491911889:806754..806800Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:806754..806800TCONS_00001030-exon-sc0000007-1510915933:806754..806800Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:806754..806800TCONS_00001030-exon-sc0000007-1575043694:806754..806800Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:808858..808976TCONS_00001030-exon-sc0000007-1491911889:808858..808976Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:808858..808976TCONS_00001030-exon-sc0000007-1510915933:808858..808976Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:808858..808976TCONS_00001030-exon-sc0000007-1575043694:808858..808976Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:810434..810565TCONS_00001030-exon-sc0000007-1491911889:810434..810565Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:810434..810565TCONS_00001030-exon-sc0000007-1510915933:810434..810565Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:810434..810565TCONS_00001030-exon-sc0000007-1575043694:810434..810565Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:810734..810868TCONS_00001030-exon-sc0000007-1491911889:810734..810868Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:810734..810868TCONS_00001030-exon-sc0000007-1510915933:810734..810868Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:810734..810868TCONS_00001030-exon-sc0000007-1575043694:810734..810868Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:812602..813097TCONS_00001030-exon-sc0000007-1491911889:812602..813097Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:812602..813097TCONS_00001030-exon-sc0000007-1510915933:812602..813097Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:812602..813097TCONS_00001030-exon-sc0000007-1575043694:812602..813097Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1491911889:814267..815156TCONS_00001030-exon-sc0000007-1491911889:814267..815156Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1510915933:814267..815156TCONS_00001030-exon-sc0000007-1510915933:814267..815156Clytia hemisphaericaexon
TCONS_00001030-exon-sc0000007-1575043694:814267..815156TCONS_00001030-exon-sc0000007-1575043694:814267..815156Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:790173..815156 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 1.65985e-07 0 0 0.392511 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.385883 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR003116RBD_dom
IPR002219PE/DAG-bd
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR029071Ubiquitin-rel_dom
IPR011009Kinase-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005057signal transducer activity, downstream of receptor
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO:0007165signal transduction
GO:0035556intracellular signal transduction
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0035556 intracellular signal transduction
biological_process GO:0006468 protein phosphorylation
biological_process GO:0007165 signal transduction
molecular_function GO:0005524 ATP binding
molecular_function GO:0004672 protein kinase activity
molecular_function GO:0005057 signal transducer activity, downstream of receptor
Blast
BLAST of TCONS_00001030 vs. Swiss-Prot (Human)
Match: ARAF (Serine/threonine-protein kinase A-Raf OS=Homo sapiens GN=ARAF PE=1 SV=2)

HSP 1 Score: 520.005 bits (1338), Expect = 8.070e-169
Identity = 288/630 (45.71%), Postives = 385/630 (61.11%), Query Frame = 2
Query:  833 SNGNSPHSSLRAHIRAFLPNNQRTMIKYKLGQTVREALYKAMSRRSLTTDSYRVYN--KANRELIAWDSDVSLLDGAEVIVEMIDEEDPSTQNISHNFVRKTFFRLAFCDKCTKLLITGFRCTTCNYRFHQKCAQGIPPLC-----------------------EQAEHSQIYKRLLAKQXXXXXXXX--------XXXXXXISQRERSISAPNVNMIGQPDSGLIEAVLEKHYKNRTNQETATISGGLTRQMSSGPSSGRGRITNTLFTPTSVSAPNSGENYFDFNTANSLPAPGNSKAQQISGIPDSLIHPARDRKNRIRSSSEEHKKPRR---RDSNDDWEIYADDLKIGERIGSGSYGTVYKGYWHGTVAVKTLNVKDPNPQQLLAFQNEVGVLRKTRHVNVLLFMGCLSSPNLAIVTQWCEGSSLYRHLHVLEKKFPMHNLIEIARQTAQGIDYLHAKQIIHRDLKSNNIFLQQDLTVKIGDFGLATVKTRWSGDHGCEQPSGSILWMAPEVIKMQDPNPYTFFSDAYAFGICIYELITGSLPYCNIGNKDILIYRIGRGFIRPDQSKIRSDCPKALKRLYLDCIKYNRDERPLFKQIVNSLETILMALPKITRSTSEPILGRAK 2614
            +NG  P  ++   ++ +LPN QRT++  + G +V ++L KA+  R L  D   VY   K  + + AWD+ ++ LDG E+IVE++ E+ P T    HNFVRKTFF LAFCD C K L  GFRC TC Y+FHQ C+  +P +C                        +A  ++    LL  Q P+  T          P+      QR RS S PNV+M+         A ++ +    T Q  +T + G     S G S G  R + +   P SVS+     +               S A+Q            R+RK    S +++ KK +    RDS   WE+   ++++ +RIG+GS+GTV++G WHG VAVK L V  P  +Q  AF+NE+ VLRKTRHVN+LLFMG ++ P  AI+TQWCEGSSLY HLHV + +F M  LI++ARQTAQG+DYLHAK IIHRDLKSNNIFL + LTVKIGDFGLATVKTRWSG    EQPSGS+LWMA EVI+MQDPNPY+F SD YA+G+ +YEL+TGSLPY +IG +D +I+ +GRG++ PD SKI S+CPKA++RL  DC+K+ R+ERPLF QI+ ++E +  +LPKI RS SEP L R +
Sbjct:    9 ANGAEPSRAV-GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVL-EDVPLTM---HNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVS------TTAPMDSNLIQLTGQSFSTDAAG-----SRGGSDGTPRGSPS---PASVSSGRKSPH-------------SKSPAEQ------------RERK----SLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQ 590          
The following BLAST results are available for this feature:
BLAST of TCONS_00001030 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ARAF8.070e-16945.71Serine/threonine-protein kinase A-Raf OS=Homo sapi... [more]
back to top