Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000994 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000994
Unique NameTCONS_00000994
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1887

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000994 ID=TCONS_00000994|Name=TCONS_00000994|organism=Clytia hemisphaerica|type=transcript|length=1887bp
agtttttttcgcgttggtgcaatgcaacatgctccatcccacccaagaaa
aaagtgtgtgtctcatggtttccttttgttgtttcatgggacaaaaagtg
agggaaatacggGTGCCAGATAAAGGATCCGCCCGCCGCCCGCCTAAATT
GCGGGCGGTTTGATACTTCCttgatttcatgatttcatcactttttttaC
ACGAAtccagaaaaacaaaatggcgtctccaaatgaagatgaaaaacgaG
TTGCTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACTT
AAATCCTCAAAAGACCAAACTGATGAAATAAAGCAACAGATCAAAGATGA
GGTGGCAAAACTGTTGGAACTGAAAGCACAACTGGGAGGGAATAATacta
aaaagaaatttgtcctCAAAACACCAAAAGGAACACGAGATTATGGGCCA
AAGCAAATGGCAATTcgtgaaaaagttttcaaaattatcacAGAGACATT
TCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAGG
AAACACTCACAGGAAAATATGGAGAAGACTCGAAACTGATATACGATTTG
AAAGATCAAGGAGGAGAGATACTTGCACTGCGTTATGATTTGACGGTACC
ATTTGCACGGTATGTTGCAATGAACAAAGTAGAGAAGATCAAAAGATATC
ATATAGCACGTGTATACAGAAGAGATAACCCTGCTATGACTCGTGGAAGG
TACCGTGAATTCTACCAATGTGATTACGATGTAGCAGGACAATACGACCC
ACTTATACCTGATGCTGAATGTGTCAAAATTGTagctgaaattttattga
aacttgAACTTGGCGATTTTGTTATTAAGGTCAATCACCGCAAAGTATTG
GACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTACCAT
CTGTTCATCAGTCGACAAACTGGATAAAACACCATGGGAAGAAGTTCGTA
ACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACATAGCTGACAAGATA
TACGAATATGTCCAATATAAAGGTGGTCCTGAACTGATAGAAAAGTTACT
GAACGATGAGAAATTCACCAATAACAAAAGTGCTAAAGAGGGAGTCGAAG
ATATGAAGCTCCTGTTCAAATATTGTGAACTTTTTGGATGTTTACAAAAT
GTTTCGTTTGATTTGAGCTTGGCACGTGGTTTGGACTATTACACAGGAGT
GATTTATGAAGCAGTGCTCACGGGACTGCCCAAAGAACTCATGAATGGTA
AAACTGATAAGAAGAAAGACAAGAAAAAAGAAGGTGAAGATGAACAAGTT
GGCGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCAT
GTTCGATTCAAAGGGGAAAAAAGTTCCTTGTGTCGGTGTTAGCCTGGGGA
TTGAACGTATTTTTTCGATCATGGAAAAGAAGCAAGAGtTATCGGAAGAG
AAAGCTCGaattacgaaaacgaaagtgttaGTTGTCAGCGGCCAAAAGAA
AATGCTGGAAGAAAGATTGAAATTAGTCAACGAGCTTTGGTCTCAAAACA
TCGAGGCAGAAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTTC
CAATACTGTGAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACAG
TGAATTGGAAAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAAC
AGAATGAAGTCAAACGTGACGAACTTGCTGAAGAAATTCGAAAACTTTGC
GTCGAATAGATcaaccaaaattgaaattagatttttttatgcagtttttt
taaatgaaaaaatatttatttagatATGATTTAATTA
Run BLAST on NCBI

protein sequence of TCONS_00000994-protein

>TCONS_00000994-protein ID=TCONS_00000994-protein|Name=TCONS_00000994-protein|organism=Clytia hemisphaerica|type=polypeptide|length=529bp
MASPNEDEKRVALQEKIKEQGEVVRKLKSSKDQTDEIKQQIKDEVAKLLE
LKAQLGGNNTKKKFVLKTPKGTRDYGPKQMAIREKVFKIITETFQKHGAV
EINTPVMELKETLTGKYGEDSKLIYDLKDQGGEILALRYDLTVPFARYVA
MNKVEKIKRYHIARVYRRDNPAMTRGRYREFYQCDYDVAGQYDPLIPDAE
CVKIVAEILLKLELGDFVIKVNHRKVLDGIFAISGVPECQFRTICSSVDK
LDKTPWEEVRNEMVKEKGLSEDIADKIYEYVQYKGGPELIEKLLNDEKFT
NNKSAKEGVEDMKLLFKYCELFGCLQNVSFDLSLARGLDYYTGVIYEAVL
TGLPKELMNGKTDKKKDKKKEGEDEQVGVGSVAGGGRYDDLVGMFDSKGK
KVPCVGVSLGIERIFSIMEKKQELSEEKARITKTKVLVVSGQKKMLEERL
KLVNELWSQNIEAEVTFKANPKLLNQFQYCEDNAIPLCAVIGDSELEKGV
VMLRNMKTREQNEVKRDELAEEIRKLCVE
Run BLAST on NCBI

transcript from alignment at sc0000007:404900..423361+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000994 ID=TCONS_00000994|Name=TCONS_00000994|organism=Clytia hemisphaerica|type=transcript|length=18462bp|location=Sequence derived from alignment at sc0000007:404900..423361+ (Clytia hemisphaerica)
agtttttttcgcgttggtgcaatgcaacatgctccatcccacccaagaaa aaagtgtgtgtctcatggtttccttttgttgtttcatgggacaaaaagtg agggaaatacggGTGCCAGATAAAGGATCCGCCCGCCGCCCGCCTAAATT GCGGGCGGTTTGATACTTCCttgatttcatgatttcatcactttttttaC ACGAAtccagaaaaacaaaatggcgtctccaaatgaagatgaaaaacgaG TTGCTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACTT AAATCCTCAAAAGACCAAACTGATGAAATAAAGCAACAGGTActgatttc aaaaagttttctttacTGTGTGTCTCTCTAGAACTAGAGTCAATGAGTGA AGACAGTTCAAGACAATTTTAAAAGGGGGGTGACAAATTTTTCCcagaca aaaattttccccaataTATTATCACCCAACCAAATTGGTGGCTTTGGAGC TCCGCATCAGGAATGGTCAGCTTGGGAAAATATAGTGTGTTTTGTTTACG TTTATCTTAAACTTAACTTATATGTNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCcccct ggcttcaaaaaaaattctttccccctatacgtccttttgacctcaaaacc cattccccccctgaatccagggggggggaggacactatgtgtACCGTCTg tcatcaactgctctaacttgggacgattggtcgaaacatgggactgttgc atatctggtctgtattttaatttactgtaaaatcgaaagagaaatcgtgt aatttttaatacgccgtttgttaactcaaatcaaatgtcTTTGGAGATTC GGtaaaatggtggccgaattgctgtcccatgttttgtcagatagtcccaa gttagagcagttgacggtattgcTCTTGCGGCAATACACCTGTTCCCATA ATTCAAACTTCTTGAAAATGTGCTCTCCattgttgtgtataaaattgtat GGGAGGTAAACAACGCGTTTTTACCTGCTGGCGAAGgcggggttagggaa agtgggttttaaCCTACCTACcatgagagtgggtaacttgcatcagtgga ggctaacatgcatagccctcaaatggtGAAAGCTTCTTCGTAAaaacgaa agacatgtatctatttttcggatccggaatgcgggaatagtgtcaggacc tgcaggcgacctggtagggttgggtatgggtgtggtttgggtgtggttac gtatcagattggctaggaatttggttattatcagttagggttagagttgg agctcgaaaaaagcactcttttgtgattttctcttaatacagtctggtct gtagtttgtacaatataaatagccgtcagaaacgcTCTTTCGgtatgaat ccgtggcgcagtggataaggcattgggtttcaaaacatctgaactttgca tttagtgggttcgaatcccaccgttggcgatctgtcggtaagtcattcag ggtgtcagtaagttagaaaacatagtaaataactcacacagaaccagaaa gtcagaaaaactacgaacaagagactggaaagtacgaaatacgTCCAGAT CTGTCTTACAAAGAAGCCACGAccccctcaaatgaatgacctggctggtc attaaaataaactatattcagctcTGCTCACAggtctactctaccatttt tgttttgatttaactttctattttaatgaccatccaggtcattcatttga gggctatgcatgttagcctccactgatgcaattTACCCACTCTCACTGTA CCTCTTTGTACCTATTTTTGGCTTTTGCTTGAACAGCTCATCCAACTCGT TGAGTCCGATGCTTCGACATTTCCTTGAGGCTGTTGGAGTCAGCTTGCCT AAGGTTAAGATAGTGGGCAAGCAGAGGTTCATCCGGAACAGTTGTGAAGA AGGTGTCTAAGTattttttgaatacttctttggGGCAGTTTGTCAAATCT CTTATTGGTCTGGGAAGGGTGTTGAATAATCGAGGGCCTTCTTGGGAAAG ACTTCCCCTCCAGATATCTTTGTGTTAAACGCTGACAGCTTTGAGAACGC AAATTCTCCCCAATCTTGCCAATCTCTGACTTTATCTCGTATGACATTTA ATTAANtccagatatttttgtgtttgatattgacagcttttagaTTGCAA ATTCTCCCCAATCTCTGATTTATATGGCAGGAAATGCCTCCTTTACTTTT GTCATTTAATCAAAATTCGGGACGTTGCCTTCAATGACGTACCAGGTATA AATTATTTGATACCGCTCTCTCCGTCTTTCAAGGCTATACAAttttaatg atttgagtttttccCAATAATTAAGATGTCTGAGGGATGGAATTCCATGT AAAAATGATTTCTGAACTTCTTCCAGTTGCTGGAAAAAAGACCACGCTTC CAGGGAGACCAGAGTTGAGAACAGTAGTCCAAATGAGGGATGGCTAGTGC TTTCCATAAAGTTAACATGGTTTCAATTTTCCTTGATTTGAATGTGCGAT ATATCCATGCacttatattttttacttttttgatttgttcttgGATATGT TTCTCATAAGTCAACTGAGTGTCTAGGGTGGCTCCAACTCTTTAACTTTG TCTTTATTTTCGATCAACGTTGCTGTGTCAGAAAAATAGCGAGAACTTTG CTTCAGAGCGTCGTTTTTCCCGTAGGCAAGGTGCTCAAATTTAAGACCAT TCAGCTGCATGTTGTTGTCTTCTGTCCACTTATAGACAGTGTCTAGATCA TTTTGTAGATGATAAACATCCTCCAGTTAGGATATTTCTTTCGTCAAACG GGTGTCGTCAGCAAACAATGCCAAAATAGAATGAAGGATGTTGTTATCAA TATCTTGAATCATGATCAGGAACAATAGCGGTCCCAGCACAGATCCTTGC GGCACACCTGAAATAATAACTGTTTCTGAGGACAAGGTTGAGTTTACTGA AACTCTCTGTTTTCGATGAGCCAAAAAGGATCTGATCCATTCAAGGAGTT TACCGTTTATGCCATTTTCTGAAGCTTGTGTTACAAAATGGTATGGTCTA CTCTATCAAAAGCTTTACTGAAGTCTAAATAGATAACGTCAATGTTGTTT CCATTCTCTAGGTAATGGATCAGTCTTTCAGTGTGTTGAAGTAATtgatt tcattcattcattcctgCTTAGCATCTACTAATCTCTTGCATTATTTCTG AGGTTTACTCAATACTAGGAaggagttttattttattttattttgtatat caataaaaatttttacctagcacattaattcatttttcatatcactTTTC TTATTAAGTACTATAGCCTTAGTCCCTTTGTTTAACTCTTGCTCTAGTAT TTATATTCTTTCCCTTAATTCTAATAAAACTTGTACATTATaacaataat atttattttaaattttaaattttatatgtgGCGAATATAGGCCTAATGCT ACTTAATTAATTTGGTAAAAACATTGTGGCAAATAtggcaattttgaaaa ataagatccAACAACGGTATCATTATTTAGTTGACAATATATATATTTCG ATCAATTTGATCATCATCAggtctaaaatcaaaaataaaaagNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNtttatttttgattttagaccTGATGA TGATCAAATTGATCGAAATATATATATTGTCAACTAAATAATGATACCGT TGTTggatcttatttttcaaaattgctacttaattaaatagatagataga tagattgaCTAAGACATGAGCGGCCTTTCCTAAAGCCATGTTGATTATTG TTATACAGATTGTTTTCTTCTAGATGATTCTGTATCTTGGCTCgtacaat cttttcaaagaccTTAGAAACGTGGGATGTGAGGGCAACGGGTCTAGTTT TCAGCAAGTCCTTGATTCCCTTTCTTGGAAACTGGGGATATATGTccagt ttttaaaagttttggagtGAGGTAAGGCAATGTTATCTTTAGTTTTTAGC AGAAGAATAGCTGGAAAACCATCAGGTCCAGGTGCTGAAGTTGGTGACAG TGTACCAATTTCTTTGACAAAGTCCTCGATAGTCAGATTGATATCTTCAA GTGTTGGTATTTGTGACTCAAGCGGATGAAGGTCGTAGTTTTGAAGAGGT TGGGTGAAGACAgacttttgtacaattattgtcacttttttcttattttc atctgatgttaatcattaggtaggtccattcagcatgttgcttgtttact tTTCTACTGATTCCGACTGATTCAGCATTGcattgttgaaaaaattgcct tttttgGCAACAataattgttatttttatcTTAAATACCCAACTGTTTTA TGCCCTCTGACAGCTGAAAATTAGGCTAGGCTAGACTtacctcttttctc ttttctattCTAACAATAAAATGCTTACATAGTTGACACATAATCACATA ATGCACATTGACCAAAGTATTCCCCATGCAatgtttatatcaaaatctgc aataaaaacaaaagttgtTTCCTTCTCAGCAGCTTCCTTAATTCGCTCTA TCGGAacgtcttttttttaatttcagccAATAAGATTGCCGAGTATGATG AAGGTTAAGAACCGGCCCTTTTTGgcgctacatgttttttttataagcat tgcgcttataagcatatctaggctcatatatggcaaaattttaaacatat gCTAAACATTTCTTTGagccttcattttcagaatttgtttgtttttggct ggattttcgaaatttctctaaaattttgcttaggatataagcattcCTCA AAGCATTTTTAAGCTTTGTAAATCTCTTGATCTAAGCATTTCCGAGCCAG CTTTGGgctttttgtatgcttataaaaaaacatgtaatggcTTTTCAGCG CCTTGGACGACAAGCAGTTGTATAACCTTATTAATTTTagggaaattttt taaattaacaATTTCTAAAAACTTATAAAACTACTCTTGGGTAACTAATA GCCAGTCTGAGACAGAATGTTTGAAACAGTCCGTGGGTGAACCCTTGTta acagactttctgaactttggaaacccaggcagaaaCGCAttatcaactta ccataaaaactctttaacATAATgttgggtttccaaagttcagaaagtct gttaACAAGGGTTCACCCACGGACTGTTTCAAACATTCTGtctcagacta atctacctgcaccaagctctataataaGGTGATTTTTGTTTGTTATAAAA TGTTGaacttggattcccaggctaacttTTCATTTAAATCACAAAGCTGA CTGACCGTGATTGTTATAATAATTATACACCAATTATTGGTGTTCCATTA TTCGAAAAATTGATCAACTATCTCGTGTGACAAacaaaatattctttgaa gTCACCTTACTTAGTTTTCTCTTCAAGACAATTTTATAAACTtaattata attattttcattttgaataagtGTGAAATTGAGATTCTCAAGGGGAGCTT ATGTTTTGCTGTTTCTTTCTCGAAAAATCTTTACGCATATAGGGGACATT AAAAaaggagtctgctaaatgacgtggCCTGCATACCCACGTGCCTAATT TTTTCACTTGCCTGCGTGCCCTCGTGCCCTCTGAAATTTCGCGTGTCCAC GTGGCCTCTAAAATTTCATGTGCCCACGTGCCCTCTAAAATTTTGTGTGC CcttaaatttttttagtttttggtaTTTCTATTATGTGGTATTATTCTAT TTCCTCTTGAATAAACTCTTGATCTAATCAAGGTCATTAGGCTAGTACAC AGTTTATAAATGATAGAAGATTGCTCAAAAATAGACCTTTCCCGAAACCC ACTTAAAAATTAGCTTctgtaaaatgtaaattttgattaATCTAATATGA CGGTTCAGTTTGTTTTCGTCTAATGACAAAACccctgaaaatttttgtta catttAATCTACTAGATTAAAAGatatttcactttcgttttctataaAAT TCTTCTTATTTTGTAAGCTTCTGATGATTTCCCATACCCCGCCTTGTTTT CATgtaaacttgatttttttaaacctttattgTGAAGCAATGAGAAATTC TTTTAACTTTAACTGGTATTGAAAGTGTCGGACTTGTGAGATGTACCCTA AATGAGGGCATCAAAAATGGTTTAAGTGGCATTGgttactaaaataccaa aatagaTGGTATAAAGTGCAAGAAAATTTTCCCTTTGAAGTAACACTTTC gaagtcaaattttttttcaaaaaatatttctcaaataGTATCATAGTATC AATTTGACATTTTGAGGAAAGTTGGTCTCTTCATAAAAATATGGCTTTCT TTATGCAGTGTTGCAACTTTCCCGTCTGTAGACGGATATCCGTCCAGTTG AGATACAAATATATCATTTCCGTCTTGCCAGTAAGAGGGTTTTTGGTTTA AATGACCATCTAATCCTAAGGTTTCCGTCTATATTCACAAAACCTAGTTG CAACACTGCTTATgacaaaatatctcaaaaaattTTAGTTTAGTACATTG TAtagtaaaaacattttctcataATTGAGGCAGGTGTACTTGAAAATTCT TTCGATCATCACTATTTGTCTGAGATGGNATAATTGAGGCAGGTGTactt gaaaattcttttgatcATCACTAtttgtctgagattttagtattGACCTC CTCTTGCTTGACTTTTGGCAACCAACTAAAGACTGTCTTGGCAACTTGTT TTTCGAAGAGTTTACaactcctttgttttttttcttgtagagaaaaaaaa aaataataattatgaaTTGTAATATTGTATTGAAAACTGCAAGAAATATT GTGCTTCGAAAAACATGCTGTCAACATGTCAGATTTCTTTCAAATGAGGT ATGAACCTTGTTTCATCTAATGCTTATAAATCATTGGGACTTCACCCGCA ATGCTCTGCTCAAAAACTCTCTTATTTATAGGAATTTTAATATGCGATTT CATTCTTTAGATCAAAGATGAGGTGGCAAAACTGTTGGAACTGAAAGCAC AACTGGGAGGGAATAATactaaaaagaaatttgtcctCAAAACACCAAAA GTAAGTTTGAAACAATCTCAATCTGTACAACTATGATTACGTGTTTACCT ATTATCTCCAAAACAAAATTATAGATTTTCTAGGATGTCAGCATATGTAG ACCACATCAATTCTTTCTCTATCAATTCTTCAGGGAACACGAGATTATGG GCCAAAGCAAATGGCAATTcgtgaaaaagttttcaaaattatcacAGAGA CATTTCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGATGGAATTG AAGGTAATTTCACTTGAACTGTACGCTTGGAATTAATTTCTTAAAAGTTT TGGTTCTTATATTAACTTGTTAATTTAAATGCTCTAGTAAAGTATATTTC TTTTGAAGTGAACTTCTTACTACGTTTTTCTTCCATAGGAAACACTCACA GGAAAATATGGAGAAGACTCGAAACTGATATACGATTTGAAAGATCAAGG AGGAGAGATACTTGCACTGCGTTATGATTTGACGGTATAGTTCTTGCCTT GATTTACCAAAACATTGAGACTAGCAAGTTTTCCATTTTCGAATATAACC CTATGAATGAAATAGAAATGACTCATATTCAAGCTCTTCTTCACAAGAAA AAGACCGCAAAATACAATTTGTAGCCGTTAGGCACCATTCCATGTCTGAT AAGTCTTGTTTCCCTTGTGGTGGTTTTTAACATGCGTCTCCATTATCCAA CTAATGAAACCTTTCGTGTGCGATTAACAGGTACCATTTGCACGGTATGT TGCAATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGCACGTGTAT ACAGAAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTGAATTCTAC CAATGTGTAAGTAAAACAAGCTATGTACCTTGGTCTgttatttcatattt tactaTTTTGGTTTTTACCTtatctttcaattttgaaatgacAAATGATT TATTCTAAATTATAACAGCTACAACATGgctcgcaccccccccccccccN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNaaatgaagacattctattgcattctctaaaagt gcacacacatgtaaatagagctttgtgaatgccataaaacttttccccta tactgggacctaaaattttattagaCTGGGGGAaccttgttctcaggggg gacctagaaccccagtcggagccatgtACAATGTGATGACaccatcaaaa tattttctggaCAACTCGTATATTTCGTTTTGCTCTGTTTTAGGATTACG ATGTAGCAGGACAATACGACCCACTTATACCTGATGCTGAATGTGTCAAA ATTGTagctgaaattttattgaaacttgAACTTGGCGATTTTGTTATTAA GGTATTTCTATTCAACTAAGATTAATGTGAACAACCTAGCATTTAAGTAT GTCACTTAATTTTTTAGTACCACACGGGTACAATAAGGATTTTTTAATAT ACCACCACATCAATGAACGTTACTGAAactgagattttagtactgaTTTA GAGTAGTTAGTTCTTTTCTACAACTTATTACTTCAGGTCAATCACCGCAA AGTATTGGACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAATTTC GTACCATCTGTTCATCAGTCGACAAACTGGATAAAGTATGTATAATGCTA TGTTTACCAATGATACTGGTTATATTATAACAAATGTGACTCGAATAAAT GCTGCTTAGTACATCATTCCTAACATTTGTCACTCGCAAATAGTTCTCTG TCTCTTCGCTTTAAAGCCAGTGCTTAAAAAGGACACATAAATTCAGTCCC GATCACAATTTAGATTcaaccttttttatttgatttttgcaGACACCATG GGAAGAAGTTCGTAACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACA TAGCTGACAAGATATACGAATATGTCCAATATAAAGGTAATTGAGGTACC TATCTGGAATCTGAAAATctaaatcactgaaaaaagtTCCAGTCTAGTCC TCTAAGATATAAAGTTCTCTCTTGCTTTCCTTTCCAGGTGGTCCTGAACT GATAGAAAAGTTACTGAACGATGAGAAATTCACCAATAACAAAAGTGCTA AAGAGGGAGTCGAAGATATGAAGCTCCTGTTCAAATATTGTGAACTTTTT GGATGTTTACAAAATGTGAGTCTTTTTATCTTCTTCACCTTTATTGAGTT TTCTAAAGAATAACATTCAGTCCTTATCAATTCTGGCAATGACATTGAAC TGTGGTTATTTTCTCCAAAGGTTTCGTTTGATTTGAGCTTGGCACGTGGT TTGGACTATTACACAGGAGTGATTTATGAAGCAGTGCTCACGGGACTGCC CAAAGAACTCATGAATGGTAAAACTGATAAGAAGAAAGACAAGAAAAAAG AAGGTAGTTGTCACACTAATTCAATTGATCTCGTTTTCAGGATTTATTGT CTTGAGGCTGTTAATACTTGTAAATTCAACAACTTAAACAAGAGTCAAAT AATTATCAGCTCTATTTTGAATATTGATCGTTACTTTCTATCCTTCTAGT CTTTATTGcctcatcaaccatttcttttCTACAGGTGAAGATGAACAAGT TGGCGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCA TGTTCGATTCAAAGGGGAAAAAAGTAAGAGTCATTTTTGCTAAGTTTCAA AGATAGCTAGCTAACTACTTAAATTGTAACAATCTTCATTTGGACTCTTC CAAACTTGAAAATGCATCTGACTAAAACCTCTGTAATATTCCTGGTGATT GCACTTGGAGAGAATTTGGTTTGTCTATTCTAATGCTAAACTGTGATCTT AACTCAACACTTACTCGTCATGTCTCCACTCAGTGATGTCTTAACCTGTG TTCGAGtgtaaatttcttaaaatcttgCAAACGAACTGGTGATCTTAAAG ATTCAACGCCAAATATTTTGATTCATTTAGAGCACTTTTAAGATTCTGCC TTCTTGGTTGGTTATCGACCGCCGAAGGCGGTTAATTTTCCGAGCTGTAT ACGGGTAAAAaagttggattcaaaatttgtcacaactgtgctatcctttt gaatattttaaaatttgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNTAGGGAGATAAatgttaagtaaataaaaaaac ttaaagtatttatcagcttctgattcaaaccacaagtgattaaacAACTC AAAATATACTATACTAGCTCATCGAAATTAGAGACTCTGTATGGCATCTT ACAtatgtttttgtttataagcatacaagaatcagaaaacaggctcagag atgcttaggttcaaagcttaataaggctgataAATGCCTGAGCGGATGCC TAAAAGCTAAAACacaaatttagggaaatactgaaaatccgcaaaattcc agccaaaatcaggaaaaaaacatttttcgtaggctcaagtaatgtttgcc atatgcttaacttttccccatatctgagcctagatatgtgcaatgcttat aaaaaatatccatattttcaagttaaatcacgAAAACGAGAGTGTCGAAG TGGATCATTGTCTAAACCGatgaattcttcatcaaatttaaggCGGTCGT TATCCAGTGATGTGAGCACTGTTCTAGTATCTAAATCACTTCTGATTTCC ACAGGAGCTTTCATGTTTTGATAGTTGACATCGTTATTAATTctgttctt aaattttattttgaatcttcatcttttaagaaaaaaacatctAAAAGTAC ATTATGTGTAATACTGTTCTTAAGAATTAGTTGACTACTCCAAAAAATTA GTAATTGTCTTGAATACAACCGCCAATTTCTTTAATGATGTTTTCCACTG ATTTGCAAAGGTTTTTTGTTTCGCTTGAATTCATCACAATGAATTCAAAG CTGTGTTTACAATTTTATTGTAAAATAATATAAATCGATAAAAACATACG TTGTTTATCGATATAAATGAAcgagagctttcaaaaagcgtCTTCACTCT TCAGAAACTTGTTCCTATCTGATTTGTTAATTAAAAGGCTagtgaatttt atattttttctgacgtcaaatatatttgtaaaatatactACGTCGATTCA ACTcgtcaaaataattattttgtcaCGTGACACGTAATGTTAGCTTCGGT TATGGAAGGAGTGTTCAGGGAGAACAATCCCACCAAGCNCACTCAGTGAT GTCTTAACCTGTGCTCGAGTGTAAATTTCTTCAAATCTTGCAAACGAACT GGTGATCTTAAAGATTCAACGCCAAATATTTTGATTCATTTAGAGCACTT TTAAGATTCTGCCTTCTTGGTTGGTTATATCTAGAAATCACTTCTGATTT CCACAGGAGCTTTCATGTTTTGATAGTTGACATCGTTATTAATTCTGAAA AAAACATCTAAAAGTACATTATGTGTAATACTGTTCTGAAGAATTCGTTG ACAACCGCCAATTTCTTTAATGATGTTTTCCACTGACTtgcaaagatttt ttatttcgctTGAATCCATCGCAGTGAATTCAAAGCTGTGTTTACaattt tattgtaaaatattataaatCGATAAAAACATACGTTATTTATCGATATA AATGAAtgagagctttcaaaaagcgtCTTCACTCTTCAGGAACTTGTTCC TAACTGATTTGTTAATTAAAAGGCTAGTGAATTTTATATcttttctgacg tcaaatatatttgtaaaatatactACGTCGATTCAATTcgtcaaaataat tattttgtcaCGTGACACGTAATGTTAGCTTCGGTTATGGAAGGAGTGTT CAGGGAGAACAATCCCACCAAGCtgtcaaattttctcaaatttccgtCAT ACCTTAAAAACGAAATTCCACCGCAATTGTATCGAATGTTAGGATTTCAA ACGTAATGGCTTGAAGTCACTTATCTCTTACACAAGTTGCGCAGCCAGTG TGGTTTTCGCGTAAGTAACGTTCACCGCCAAATTCTTCGAGCAAATGCCA GGCAAAAAGGCTGAGTCTTTTGCCTATATGATATTATAGATTTTCTTTAT ATCGTGTTTATTTAGGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACG TATTTTTTCGATCATGGAAAAGAAGCAAGAGGTGAGTTAGAATGAAATAT TCATCAATTTGTCTGAAATGTTAAGCCTTGTGATGATTCAGAATGCTATT AAGCTAACTTGTCCCACAAAATGGGATTGGACGTGTAATGCGTATTTCAC TTCGCAACGGGGTGCTCGAAATAAATGGATTAGAAGAGATCCACCTCATA ATGACTTCAACTTTCAACGGATTATTTCTCTCCTTATCTCTAAACACTAT TGTCTACCAAGGATTAACCATTAAGTTTAAAATCTTAATTGACTTTACTA ATGGTTTATGTGAACTTTTCTaaacaaaacagtttttcaaaTGACGAATC ATCAGCTGATTAAATTCTTTATCTAATCCTAACTAAACGATTTGAAGTAT GACTCTaattttctcaactttttaCACACCTCGGAATGCCTTTGTAGATT CGGCAATGTAATTTGCTtggtattttaaaaatgtcacCCGAGAATGAATC TAGGTATTTTATCGTCTCTTTGATCTCATCCATCGTTTCTAACTGATACA TCttcattttttgtgttttagtTATCGGAAGAGAAAGCTCGaattacgaa aacgaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTGGAAGAAAGAT TGAAATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGTAAAAATACCC TCTACCACCTACTCTCCCTCCCCCAAATAAGCAATGCGCAGTTTCAAGTG CCGTTCCAGGTCAATTTTTTCCCtaaaacaaattcaacaaaaccTTCAAC CAAAGGGAATTTTGGATAAATCACTACATGGTCATGAGGTCTCCATTACT TTCAAGTTTGCTTAGAGAATTTAAATTATTGACCAATGAAATTGGTGCGT GTCTCGATTTAACATGTTATCGACTCTTAGTATCGTTTTCTTTGCAGGCA GAAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACTG TGAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTGG AAAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAACAGGTATAA ATGCATTGCCTCTGACTAACTAATTTTTGGAAGAAATGGTAAATTCATTC TTTTCTGTTCTGCACTTCACGCCATCCTTCTGTCCTTATTATGTGTTACC CTTTGAATCAAATTTGAACACTTTAATGGGCTTAATTTTCGCGGAGACTA AATCTCGCGGATTCCGCGGATTTGGGCGAACAtaaatcccaatggaaatt tgaaaagttgATAAGGTTCTCCCTgcgaaacctttttaaattaaattcca ataaatgtcaaaaaacaattttaacatGTTTACCGCCATCAAAAAAGGGC TAATAATGCGTTCCTTTATATTTATAGAATGAAGTCAAACGTGACGAACT TGCTGAAGAAATTCGAAAACTTTGCGTCGAATAGATcaaccaaaattgaa attagatttttttatgcagtttttttaaatgaaaaaatatttatttagat ATGATTTAATTA

Coding sequence (CDS) from alignment at sc0000007:404900..423361+

>TCONS_00000994 ID=TCONS_00000994|Name=TCONS_00000994|organism=Clytia hemisphaerica|type=CDS|length=23850bp|location=Sequence derived from alignment at sc0000007:404900..423361+ (Clytia hemisphaerica)
atggcgtctccaaatgaagatgaaaaacgaGTTGCTCTTCAAGAAAAGAT
TAAAGAACAAGGAGAGGTTGTCAGAAAACTTAAATCCTCAAAAGACCAAA
CTGATGAAATAAAGCAACAGATCAAAGATGAGGTGGCAAAACTGTTGGAA
CTGAAAGCACAACTGGGAGGGAATAATactaaaaagaaatttgtcctCAA
AACACCAAAAGGAACACGAGATTATGGGCCAAAGCAAATGGCAATTcgtg
aaaaagttttcaaaattatcacAGAGACATTTCAAAAACATGGAGCTGTA
GAAATCAATACACCTGTGATGGAATTGAAGGAAACACTCACAGGAAAATA
TGGAGAAGACTCGAAACTGATATACGATTTGAAAGATCAAGGAGGAGAGA
TACTTGCACTGCGTTATGATTTGACGGTACCATTTGCACGGTATGTTGCA
ATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGCACGTGTATACAG
AAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTGAATTCTACCAAT
GTGATTACGATGTAGCAGGACAATACGACCCACTTATACCTGATGCTGAA
TGTGTCAAAATTGTagctgaaattttattgaaacttgAACTTGGCGATTT
TGTTATTAAGGTCAATCACCGCAAAGTATTGGACGGTATTTTCGCAATTT
CTGGCGTTCCTGAATGTCAATTTCGTACCATCTGTTCATCAGTCGACAAA
CTGGATAAAACACCATGGGAAGAAGTTCGTAACGAAATGGTGAAAGAAAA
AGGGTTATCAGAAGACATAGCTGACAAGATATACGAATATGTCCAATATA
AAGGTGGTCCTGAACTGATAGAAAAGTTACTGAACGATGAGAAATTCACC
AATAACAAAAGTGCTAAAGAGGGAGTCGAAGATATGAAGCTCCTGTTCAA
ATATTGTGAACTTTTTGGATGTTTACAAAATGTTTCGTTTGATTTGAGCT
TGGCACGTGGTTTGGACTATTACACAGGAGTGATTTATGAAGCAGTGCTC
ACGGGACTGCCCAAAGAACTCATGAATGGTAAAACTGATAAGAAGAAAGA
CAAGAAAAAAGAAGGTGAAGATGAACAAGTTGGCGTCGGATCTGTGGCGG
GTGGTGGGCGTTATGATGATCTAGTTGGCATGTTCGATTCAAAGGGGAAA
AAAGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACGTATTTTTTCGAT
CATGGAAAAGAAGCAAGAGtTATCGGAAGAGAAAGCTCGaattacgaaaa
cgaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTGGAAGAAAGATTG
AAATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGCAGAAGTGACATT
CAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACTGTGAAGACAATG
CGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTGGAAAAGGGTGTT
GTCATGCTTCGCAACATGAAAACTAGAGAACAGAATGAAGTCAAACGTGA
CGAACTTGCTGAAGAAATTCGAAAACTTTGCGTCGAATAGatggcgtctc
caaatgaagatgaaaaacgaGTTGCTCTTCAAGAAAAGATTAAAGAACAA
GGAGAGGTTGTCAGAAAACTTAAATCCTCAAAAGACCAAACTGATGAAAT
AAAGCAACAGATCAAAGATGAGGTGGCAAAACTGTTGGAACTGAAAGCAC
AACTGGGAGGGAATAATactaaaaagaaatttgtcctCAAAACACCAAAA
GGAACACGAGATTATGGGCCAAAGCAAATGGCAATTcgtgaaaaagtttt
caaaattatcacAGAGACATTTCAAAAACATGGAGCTGTAGAAATCAATA
CACCTGTGATGGAATTGAAGGAAACACTCACAGGAAAATATGGAGAAGAC
TCGAAACTGATATACGATTTGAAAGATCAAGGAGGAGAGATACTTGCACT
GCGTTATGATTTGACGGTACCATTTGCACGGTATGTTGCAATGAACAAAG
TAGAGAAGATCAAAAGATATCATATAGCACGTGTATACAGAAGAGATAAC
CCTGCTATGACTCGTGGAAGGTACCGTGAATTCTACCAATGTGATTACGA
TGTAGCAGGACAATACGACCCACTTATACCTGATGCTGAATGTGTCAAAA
TTGTagctgaaattttattgaaacttgAACTTGGCGATTTTGTTATTAAG
GTCAATCACCGCAAAGTATTGGACGGTATTTTCGCAATTTCTGGCGTTCC
TGAATGTCAATTTCGTACCATCTGTTCATCAGTCGACAAACTGGATAAAA
CACCATGGGAAGAAGTTCGTAACGAAATGGTGAAAGAAAAAGGGTTATCA
GAAGACATAGCTGACAAGATATACGAATATGTCCAATATAAAGGTGGTCC
TGAACTGATAGAAAAGTTACTGAACGATGAGAAATTCACCAATAACAAAA
GTGCTAAAGAGGGAGTCGAAGATATGAAGCTCCTGTTCAAATATTGTGAA
CTTTTTGGATGTTTACAAAATGTTTCGTTTGATTTGAGCTTGGCACGTGG
TTTGGACTATTACACAGGAGTGATTTATGAAGCAGTGCTCACGGGACTGC
CCAAAGAACTCATGAATGGTAAAACTGATAAGAAGAAAGACAAGAAAAAA
GAAGGTGAAGATGAACAAGTTGGCGTCGGATCTGTGGCGGGTGGTGGGCG
TTATGATGATCTAGTTGGCATGTTCGATTCAAAGGGGAAAAAAGTTCCTT
GTGTCGGTGTTAGCCTGGGGATTGAACGTATTTTTTCGATCATGGAAAAG
AAGCAAGAGtTATCGGAAGAGAAAGCTCGaattacgaaaacgaaagtgtt
aGTTGTCAGCGGCCAAAAGAAAATGCTGGAAGAAAGATTGAAATTAGTCA
ACGAGCTTTGGTCTCAAAACATCGAGGCAGAAGTGACATTCAAAGCTAAT
CCCAAACTTTTGAATCAGTTCCAATACTGTGAAGACAATGCGATCCCTTT
GTGTGCTGTGATCGGTGACAGTGAATTGGAAAAGGGTGTTGTCATGCTTC
GCAACATGAAAACTAGAGAACAGAATGAAGTCAAACGTGACGAACTTGCT
GAAGAAATTCGAAAACTTTGCGTCGAATAGatggcgtctccaaatgaaga
tgaaaaacgaGTTGCTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTG
TCAGAAAACTTAAATCCTCAAAAGACCAAACTGATGAAATAAAGCAACAG
ATCAAAGATGAGGTGGCAAAACTGTTGGAACTGAAAGCACAACTGGGAGG
GAATAATactaaaaagaaatttgtcctCAAAACACCAAAAGGAACACGAG
ATTATGGGCCAAAGCAAATGGCAATTcgtgaaaaagttttcaaaattatc
acAGAGACATTTCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGAT
GGAATTGAAGGAAACACTCACAGGAAAATATGGAGAAGACTCGAAACTGA
TATACGATTTGAAAGATCAAGGAGGAGAGATACTTGCACTGCGTTATGAT
TTGACGGTACCATTTGCACGGTATGTTGCAATGAACAAAGTAGAGAAGAT
CAAAAGATATCATATAGCACGTGTATACAGAAGAGATAACCCTGCTATGA
CTCGTGGAAGGTACCGTGAATTCTACCAATGTGATTACGATGTAGCAGGA
CAATACGACCCACTTATACCTGATGCTGAATGTGTCAAAATTGTagctga
aattttattgaaacttgAACTTGGCGATTTTGTTATTAAGGTCAATCACC
GCAAAGTATTGGACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAA
TTTCGTACCATCTGTTCATCAGTCGACAAACTGGATAAAACACCATGGGA
AGAAGTTCGTAACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACATAG
CTGACAAGATATACGAATATGTCCAATATAAAGGTGGTCCTGAACTGATA
GAAAAGTTACTGAACGATGAGAAATTCACCAATAACAAAAGTGCTAAAGA
GGGAGTCGAAGATATGAAGCTCCTGTTCAAATATTGTGAACTTTTTGGAT
GTTTACAAAATGTTTCGTTTGATTTGAGCTTGGCACGTGGTTTGGACTAT
TACACAGGAGTGATTTATGAAGCAGTGCTCACGGGACTGCCCAAAGAACT
CATGAATGGTAAAACTGATAAGAAGAAAGACAAGAAAAAAGAAGGTGAAG
ATGAACAAGTTGGCGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGAT
CTAGTTGGCATGTTCGATTCAAAGGGGAAAAAAGTTCCTTGTGTCGGTGT
TAGCCTGGGGATTGAACGTATTTTTTCGATCATGGAAAAGAAGCAAGAGt
TATCGGAAGAGAAAGCTCGaattacgaaaacgaaagtgttaGTTGTCAGC
GGCCAAAAGAAAATGCTGGAAGAAAGATTGAAATTAGTCAACGAGCTTTG
GTCTCAAAACATCGAGGCAGAAGTGACATTCAAAGCTAATCCCAAACTTT
TGAATCAGTTCCAATACTGTGAAGACAATGCGATCCCTTTGTGTGCTGTG
ATCGGTGACAGTGAATTGGAAAAGGGTGTTGTCATGCTTCGCAACATGAA
AACTAGAGAACAGAATGAAGTCAAACGTGACGAACTTGCTGAAGAAATTC
GAAAACTTTGCGTCGAATAGatggcgtctccaaatgaagatgaaaaacga
GTTGCTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACT
TAAATCCTCAAAAGACCAAACTGATGAAATAAAGCAACAGATCAAAGATG
AGGTGGCAAAACTGTTGGAACTGAAAGCACAACTGGGAGGGAATAATact
aaaaagaaatttgtcctCAAAACACCAAAAGGAACACGAGATTATGGGCC
AAAGCAAATGGCAATTcgtgaaaaagttttcaaaattatcacAGAGACAT
TTCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAG
GAAACACTCACAGGAAAATATGGAGAAGACTCGAAACTGATATACGATTT
GAAAGATCAAGGAGGAGAGATACTTGCACTGCGTTATGATTTGACGGTAC
CATTTGCACGGTATGTTGCAATGAACAAAGTAGAGAAGATCAAAAGATAT
CATATAGCACGTGTATACAGAAGAGATAACCCTGCTATGACTCGTGGAAG
GTACCGTGAATTCTACCAATGTGATTACGATGTAGCAGGACAATACGACC
CACTTATACCTGATGCTGAATGTGTCAAAATTGTagctgaaattttattg
aaacttgAACTTGGCGATTTTGTTATTAAGGTCAATCACCGCAAAGTATT
GGACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTACCA
TCTGTTCATCAGTCGACAAACTGGATAAAACACCATGGGAAGAAGTTCGT
AACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACATAGCTGACAAGAT
ATACGAATATGTCCAATATAAAGGTGGTCCTGAACTGATAGAAAAGTTAC
TGAACGATGAGAAATTCACCAATAACAAAAGTGCTAAAGAGGGAGTCGAA
GATATGAAGCTCCTGTTCAAATATTGTGAACTTTTTGGATGTTTACAAAA
TGTTTCGTTTGATTTGAGCTTGGCACGTGGTTTGGACTATTACACAGGAG
TGATTTATGAAGCAGTGCTCACGGGACTGCCCAAAGAACTCATGAATGGT
AAAACTGATAAGAAGAAAGACAAGAAAAAAGAAGGTGAAGATGAACAAGT
TGGCGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCA
TGTTCGATTCAAAGGGGAAAAAAGTTCCTTGTGTCGGTGTTAGCCTGGGG
ATTGAACGTATTTTTTCGATCATGGAAAAGAAGCAAGAGtTATCGGAAGA
GAAAGCTCGaattacgaaaacgaaagtgttaGTTGTCAGCGGCCAAAAGA
AAATGCTGGAAGAAAGATTGAAATTAGTCAACGAGCTTTGGTCTCAAAAC
ATCGAGGCAGAAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTT
CCAATACTGTGAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACA
GTGAATTGGAAAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAA
CAGAATGAAGTCAAACGTGACGAACTTGCTGAAGAAATTCGAAAACTTTG
CGTCGAATAGatggcgtctccaaatgaagatgaaaaacgaGTTGCTCTTC
AAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACTTAAATCCTCA
AAAGACCAAACTGATGAAATAAAGCAACAGATCAAAGATGAGGTGGCAAA
ACTGTTGGAACTGAAAGCACAACTGGGAGGGAATAATactaaaaagaaat
ttgtcctCAAAACACCAAAAGGAACACGAGATTATGGGCCAAAGCAAATG
GCAATTcgtgaaaaagttttcaaaattatcacAGAGACATTTCAAAAACA
TGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAGGAAACACTCA
CAGGAAAATATGGAGAAGACTCGAAACTGATATACGATTTGAAAGATCAA
GGAGGAGAGATACTTGCACTGCGTTATGATTTGACGGTACCATTTGCACG
GTATGTTGCAATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGCAC
GTGTATACAGAAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTGAA
TTCTACCAATGTGATTACGATGTAGCAGGACAATACGACCCACTTATACC
TGATGCTGAATGTGTCAAAATTGTagctgaaattttattgaaacttgAAC
TTGGCGATTTTGTTATTAAGGTCAATCACCGCAAAGTATTGGACGGTATT
TTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTACCATCTGTTCATC
AGTCGACAAACTGGATAAAACACCATGGGAAGAAGTTCGTAACGAAATGG
TGAAAGAAAAAGGGTTATCAGAAGACATAGCTGACAAGATATACGAATAT
GTCCAATATAAAGGTGGTCCTGAACTGATAGAAAAGTTACTGAACGATGA
GAAATTCACCAATAACAAAAGTGCTAAAGAGGGAGTCGAAGATATGAAGC
TCCTGTTCAAATATTGTGAACTTTTTGGATGTTTACAAAATGTTTCGTTT
GATTTGAGCTTGGCACGTGGTTTGGACTATTACACAGGAGTGATTTATGA
AGCAGTGCTCACGGGACTGCCCAAAGAACTCATGAATGGTAAAACTGATA
AGAAGAAAGACAAGAAAAAAGAAGGTGAAGATGAACAAGTTGGCGTCGGA
TCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCATGTTCGATTC
AAAGGGGAAAAAAGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACGTA
TTTTTTCGATCATGGAAAAGAAGCAAGAGtTATCGGAAGAGAAAGCTCGa
attacgaaaacgaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTGGA
AGAAAGATTGAAATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGCAG
AAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACTGT
GAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTGGA
AAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAACAGAATGAAG
TCAAACGTGACGAACTTGCTGAAGAAATTCGAAAACTTTGCGTCGAATAG
atggcgtctccaaatgaagatgaaaaacgaGTTGCTCTTCAAGAAAAGAT
TAAAGAACAAGGAGAGGTTGTCAGAAAACTTAAATCCTCAAAAGACCAAA
CTGATGAAATAAAGCAACAGATCAAAGATGAGGTGGCAAAACTGTTGGAA
CTGAAAGCACAACTGGGAGGGAATAATactaaaaagaaatttgtcctCAA
AACACCAAAAGGAACACGAGATTATGGGCCAAAGCAAATGGCAATTcgtg
aaaaagttttcaaaattatcacAGAGACATTTCAAAAACATGGAGCTGTA
GAAATCAATACACCTGTGATGGAATTGAAGGAAACACTCACAGGAAAATA
TGGAGAAGACTCGAAACTGATATACGATTTGAAAGATCAAGGAGGAGAGA
TACTTGCACTGCGTTATGATTTGACGGTACCATTTGCACGGTATGTTGCA
ATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGCACGTGTATACAG
AAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTGAATTCTACCAAT
GTGATTACGATGTAGCAGGACAATACGACCCACTTATACCTGATGCTGAA
TGTGTCAAAATTGTagctgaaattttattgaaacttgAACTTGGCGATTT
TGTTATTAAGGTCAATCACCGCAAAGTATTGGACGGTATTTTCGCAATTT
CTGGCGTTCCTGAATGTCAATTTCGTACCATCTGTTCATCAGTCGACAAA
CTGGATAAAACACCATGGGAAGAAGTTCGTAACGAAATGGTGAAAGAAAA
AGGGTTATCAGAAGACATAGCTGACAAGATATACGAATATGTCCAATATA
AAGGTGGTCCTGAACTGATAGAAAAGTTACTGAACGATGAGAAATTCACC
AATAACAAAAGTGCTAAAGAGGGAGTCGAAGATATGAAGCTCCTGTTCAA
ATATTGTGAACTTTTTGGATGTTTACAAAATGTTTCGTTTGATTTGAGCT
TGGCACGTGGTTTGGACTATTACACAGGAGTGATTTATGAAGCAGTGCTC
ACGGGACTGCCCAAAGAACTCATGAATGGTAAAACTGATAAGAAGAAAGA
CAAGAAAAAAGAAGGTGAAGATGAACAAGTTGGCGTCGGATCTGTGGCGG
GTGGTGGGCGTTATGATGATCTAGTTGGCATGTTCGATTCAAAGGGGAAA
AAAGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACGTATTTTTTCGAT
CATGGAAAAGAAGCAAGAGtTATCGGAAGAGAAAGCTCGaattacgaaaa
cgaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTGGAAGAAAGATTG
AAATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGCAGAAGTGACATT
CAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACTGTGAAGACAATG
CGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTGGAAAAGGGTGTT
GTCATGCTTCGCAACATGAAAACTAGAGAACAGAATGAAGTCAAACGTGA
CGAACTTGCTGAAGAAATTCGAAAACTTTGCGTCGAATAGatggcgtctc
caaatgaagatgaaaaacgaGTTGCTCTTCAAGAAAAGATTAAAGAACAA
GGAGAGGTTGTCAGAAAACTTAAATCCTCAAAAGACCAAACTGATGAAAT
AAAGCAACAGATCAAAGATGAGGTGGCAAAACTGTTGGAACTGAAAGCAC
AACTGGGAGGGAATAATactaaaaagaaatttgtcctCAAAACACCAAAA
GGAACACGAGATTATGGGCCAAAGCAAATGGCAATTcgtgaaaaagtttt
caaaattatcacAGAGACATTTCAAAAACATGGAGCTGTAGAAATCAATA
CACCTGTGATGGAATTGAAGGAAACACTCACAGGAAAATATGGAGAAGAC
TCGAAACTGATATACGATTTGAAAGATCAAGGAGGAGAGATACTTGCACT
GCGTTATGATTTGACGGTACCATTTGCACGGTATGTTGCAATGAACAAAG
TAGAGAAGATCAAAAGATATCATATAGCACGTGTATACAGAAGAGATAAC
CCTGCTATGACTCGTGGAAGGTACCGTGAATTCTACCAATGTGATTACGA
TGTAGCAGGACAATACGACCCACTTATACCTGATGCTGAATGTGTCAAAA
TTGTagctgaaattttattgaaacttgAACTTGGCGATTTTGTTATTAAG
GTCAATCACCGCAAAGTATTGGACGGTATTTTCGCAATTTCTGGCGTTCC
TGAATGTCAATTTCGTACCATCTGTTCATCAGTCGACAAACTGGATAAAA
CACCATGGGAAGAAGTTCGTAACGAAATGGTGAAAGAAAAAGGGTTATCA
GAAGACATAGCTGACAAGATATACGAATATGTCCAATATAAAGGTGGTCC
TGAACTGATAGAAAAGTTACTGAACGATGAGAAATTCACCAATAACAAAA
GTGCTAAAGAGGGAGTCGAAGATATGAAGCTCCTGTTCAAATATTGTGAA
CTTTTTGGATGTTTACAAAATGTTTCGTTTGATTTGAGCTTGGCACGTGG
TTTGGACTATTACACAGGAGTGATTTATGAAGCAGTGCTCACGGGACTGC
CCAAAGAACTCATGAATGGTAAAACTGATAAGAAGAAAGACAAGAAAAAA
GAAGGTGAAGATGAACAAGTTGGCGTCGGATCTGTGGCGGGTGGTGGGCG
TTATGATGATCTAGTTGGCATGTTCGATTCAAAGGGGAAAAAAGTTCCTT
GTGTCGGTGTTAGCCTGGGGATTGAACGTATTTTTTCGATCATGGAAAAG
AAGCAAGAGtTATCGGAAGAGAAAGCTCGaattacgaaaacgaaagtgtt
aGTTGTCAGCGGCCAAAAGAAAATGCTGGAAGAAAGATTGAAATTAGTCA
ACGAGCTTTGGTCTCAAAACATCGAGGCAGAAGTGACATTCAAAGCTAAT
CCCAAACTTTTGAATCAGTTCCAATACTGTGAAGACAATGCGATCCCTTT
GTGTGCTGTGATCGGTGACAGTGAATTGGAAAAGGGTGTTGTCATGCTTC
GCAACATGAAAACTAGAGAACAGAATGAAGTCAAACGTGACGAACTTGCT
GAAGAAATTCGAAAACTTTGCGTCGAATAGatggcgtctccaaatgaaga
tgaaaaacgaGTTGCTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTG
TCAGAAAACTTAAATCCTCAAAAGACCAAACTGATGAAATAAAGCAACAG
ATCAAAGATGAGGTGGCAAAACTGTTGGAACTGAAAGCACAACTGGGAGG
GAATAATactaaaaagaaatttgtcctCAAAACACCAAAAGGAACACGAG
ATTATGGGCCAAAGCAAATGGCAATTcgtgaaaaagttttcaaaattatc
acAGAGACATTTCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGAT
GGAATTGAAGGAAACACTCACAGGAAAATATGGAGAAGACTCGAAACTGA
TATACGATTTGAAAGATCAAGGAGGAGAGATACTTGCACTGCGTTATGAT
TTGACGGTACCATTTGCACGGTATGTTGCAATGAACAAAGTAGAGAAGAT
CAAAAGATATCATATAGCACGTGTATACAGAAGAGATAACCCTGCTATGA
CTCGTGGAAGGTACCGTGAATTCTACCAATGTGATTACGATGTAGCAGGA
CAATACGACCCACTTATACCTGATGCTGAATGTGTCAAAATTGTagctga
aattttattgaaacttgAACTTGGCGATTTTGTTATTAAGGTCAATCACC
GCAAAGTATTGGACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAA
TTTCGTACCATCTGTTCATCAGTCGACAAACTGGATAAAACACCATGGGA
AGAAGTTCGTAACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACATAG
CTGACAAGATATACGAATATGTCCAATATAAAGGTGGTCCTGAACTGATA
GAAAAGTTACTGAACGATGAGAAATTCACCAATAACAAAAGTGCTAAAGA
GGGAGTCGAAGATATGAAGCTCCTGTTCAAATATTGTGAACTTTTTGGAT
GTTTACAAAATGTTTCGTTTGATTTGAGCTTGGCACGTGGTTTGGACTAT
TACACAGGAGTGATTTATGAAGCAGTGCTCACGGGACTGCCCAAAGAACT
CATGAATGGTAAAACTGATAAGAAGAAAGACAAGAAAAAAGAAGGTGAAG
ATGAACAAGTTGGCGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGAT
CTAGTTGGCATGTTCGATTCAAAGGGGAAAAAAGTTCCTTGTGTCGGTGT
TAGCCTGGGGATTGAACGTATTTTTTCGATCATGGAAAAGAAGCAAGAGt
TATCGGAAGAGAAAGCTCGaattacgaaaacgaaagtgttaGTTGTCAGC
GGCCAAAAGAAAATGCTGGAAGAAAGATTGAAATTAGTCAACGAGCTTTG
GTCTCAAAACATCGAGGCAGAAGTGACATTCAAAGCTAATCCCAAACTTT
TGAATCAGTTCCAATACTGTGAAGACAATGCGATCCCTTTGTGTGCTGTG
ATCGGTGACAGTGAATTGGAAAAGGGTGTTGTCATGCTTCGCAACATGAA
AACTAGAGAACAGAATGAAGTCAAACGTGACGAACTTGCTGAAGAAATTC
GAAAACTTTGCGTCGAATAGatggcgtctccaaatgaagatgaaaaacga
GTTGCTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACT
TAAATCCTCAAAAGACCAAACTGATGAAATAAAGCAACAGATCAAAGATG
AGGTGGCAAAACTGTTGGAACTGAAAGCACAACTGGGAGGGAATAATact
aaaaagaaatttgtcctCAAAACACCAAAAGGAACACGAGATTATGGGCC
AAAGCAAATGGCAATTcgtgaaaaagttttcaaaattatcacAGAGACAT
TTCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAG
GAAACACTCACAGGAAAATATGGAGAAGACTCGAAACTGATATACGATTT
GAAAGATCAAGGAGGAGAGATACTTGCACTGCGTTATGATTTGACGGTAC
CATTTGCACGGTATGTTGCAATGAACAAAGTAGAGAAGATCAAAAGATAT
CATATAGCACGTGTATACAGAAGAGATAACCCTGCTATGACTCGTGGAAG
GTACCGTGAATTCTACCAATGTGATTACGATGTAGCAGGACAATACGACC
CACTTATACCTGATGCTGAATGTGTCAAAATTGTagctgaaattttattg
aaacttgAACTTGGCGATTTTGTTATTAAGGTCAATCACCGCAAAGTATT
GGACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTACCA
TCTGTTCATCAGTCGACAAACTGGATAAAACACCATGGGAAGAAGTTCGT
AACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACATAGCTGACAAGAT
ATACGAATATGTCCAATATAAAGGTGGTCCTGAACTGATAGAAAAGTTAC
TGAACGATGAGAAATTCACCAATAACAAAAGTGCTAAAGAGGGAGTCGAA
GATATGAAGCTCCTGTTCAAATATTGTGAACTTTTTGGATGTTTACAAAA
TGTTTCGTTTGATTTGAGCTTGGCACGTGGTTTGGACTATTACACAGGAG
TGATTTATGAAGCAGTGCTCACGGGACTGCCCAAAGAACTCATGAATGGT
AAAACTGATAAGAAGAAAGACAAGAAAAAAGAAGGTGAAGATGAACAAGT
TGGCGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCA
TGTTCGATTCAAAGGGGAAAAAAGTTCCTTGTGTCGGTGTTAGCCTGGGG
ATTGAACGTATTTTTTCGATCATGGAAAAGAAGCAAGAGtTATCGGAAGA
GAAAGCTCGaattacgaaaacgaaagtgttaGTTGTCAGCGGCCAAAAGA
AAATGCTGGAAGAAAGATTGAAATTAGTCAACGAGCTTTGGTCTCAAAAC
ATCGAGGCAGAAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTT
CCAATACTGTGAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACA
GTGAATTGGAAAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAA
CAGAATGAAGTCAAACGTGACGAACTTGCTGAAGAAATTCGAAAACTTTG
CGTCGAATAGatggcgtctccaaatgaagatgaaaaacgaGTTGCTCTTC
AAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACTTAAATCCTCA
AAAGACCAAACTGATGAAATAAAGCAACAGATCAAAGATGAGGTGGCAAA
ACTGTTGGAACTGAAAGCACAACTGGGAGGGAATAATactaaaaagaaat
ttgtcctCAAAACACCAAAAGGAACACGAGATTATGGGCCAAAGCAAATG
GCAATTcgtgaaaaagttttcaaaattatcacAGAGACATTTCAAAAACA
TGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAGGAAACACTCA
CAGGAAAATATGGAGAAGACTCGAAACTGATATACGATTTGAAAGATCAA
GGAGGAGAGATACTTGCACTGCGTTATGATTTGACGGTACCATTTGCACG
GTATGTTGCAATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGCAC
GTGTATACAGAAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTGAA
TTCTACCAATGTGATTACGATGTAGCAGGACAATACGACCCACTTATACC
TGATGCTGAATGTGTCAAAATTGTagctgaaattttattgaaacttgAAC
TTGGCGATTTTGTTATTAAGGTCAATCACCGCAAAGTATTGGACGGTATT
TTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTACCATCTGTTCATC
AGTCGACAAACTGGATAAAACACCATGGGAAGAAGTTCGTAACGAAATGG
TGAAAGAAAAAGGGTTATCAGAAGACATAGCTGACAAGATATACGAATAT
GTCCAATATAAAGGTGGTCCTGAACTGATAGAAAAGTTACTGAACGATGA
GAAATTCACCAATAACAAAAGTGCTAAAGAGGGAGTCGAAGATATGAAGC
TCCTGTTCAAATATTGTGAACTTTTTGGATGTTTACAAAATGTTTCGTTT
GATTTGAGCTTGGCACGTGGTTTGGACTATTACACAGGAGTGATTTATGA
AGCAGTGCTCACGGGACTGCCCAAAGAACTCATGAATGGTAAAACTGATA
AGAAGAAAGACAAGAAAAAAGAAGGTGAAGATGAACAAGTTGGCGTCGGA
TCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCATGTTCGATTC
AAAGGGGAAAAAAGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACGTA
TTTTTTCGATCATGGAAAAGAAGCAAGAGtTATCGGAAGAGAAAGCTCGa
attacgaaaacgaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTGGA
AGAAAGATTGAAATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGCAG
AAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACTGT
GAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTGGA
AAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAACAGAATGAAG
TCAAACGTGACGAACTTGCTGAAGAAATTCGAAAACTTTGCGTCGAATAG
atggcgtctccaaatgaagatgaaaaacgaGTTGCTCTTCAAGAAAAGAT
TAAAGAACAAGGAGAGGTTGTCAGAAAACTTAAATCCTCAAAAGACCAAA
CTGATGAAATAAAGCAACAGATCAAAGATGAGGTGGCAAAACTGTTGGAA
CTGAAAGCACAACTGGGAGGGAATAATactaaaaagaaatttgtcctCAA
AACACCAAAAGGAACACGAGATTATGGGCCAAAGCAAATGGCAATTcgtg
aaaaagttttcaaaattatcacAGAGACATTTCAAAAACATGGAGCTGTA
GAAATCAATACACCTGTGATGGAATTGAAGGAAACACTCACAGGAAAATA
TGGAGAAGACTCGAAACTGATATACGATTTGAAAGATCAAGGAGGAGAGA
TACTTGCACTGCGTTATGATTTGACGGTACCATTTGCACGGTATGTTGCA
ATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGCACGTGTATACAG
AAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTGAATTCTACCAAT
GTGATTACGATGTAGCAGGACAATACGACCCACTTATACCTGATGCTGAA
TGTGTCAAAATTGTagctgaaattttattgaaacttgAACTTGGCGATTT
TGTTATTAAGGTCAATCACCGCAAAGTATTGGACGGTATTTTCGCAATTT
CTGGCGTTCCTGAATGTCAATTTCGTACCATCTGTTCATCAGTCGACAAA
CTGGATAAAACACCATGGGAAGAAGTTCGTAACGAAATGGTGAAAGAAAA
AGGGTTATCAGAAGACATAGCTGACAAGATATACGAATATGTCCAATATA
AAGGTGGTCCTGAACTGATAGAAAAGTTACTGAACGATGAGAAATTCACC
AATAACAAAAGTGCTAAAGAGGGAGTCGAAGATATGAAGCTCCTGTTCAA
ATATTGTGAACTTTTTGGATGTTTACAAAATGTTTCGTTTGATTTGAGCT
TGGCACGTGGTTTGGACTATTACACAGGAGTGATTTATGAAGCAGTGCTC
ACGGGACTGCCCAAAGAACTCATGAATGGTAAAACTGATAAGAAGAAAGA
CAAGAAAAAAGAAGGTGAAGATGAACAAGTTGGCGTCGGATCTGTGGCGG
GTGGTGGGCGTTATGATGATCTAGTTGGCATGTTCGATTCAAAGGGGAAA
AAAGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACGTATTTTTTCGAT
CATGGAAAAGAAGCAAGAGtTATCGGAAGAGAAAGCTCGaattacgaaaa
cgaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTGGAAGAAAGATTG
AAATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGCAGAAGTGACATT
CAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACTGTGAAGACAATG
CGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTGGAAAAGGGTGTT
GTCATGCTTCGCAACATGAAAACTAGAGAACAGAATGAAGTCAAACGTGA
CGAACTTGCTGAAGAAATTCGAAAACTTTGCGTCGAATAGatggcgtctc
caaatgaagatgaaaaacgaGTTGCTCTTCAAGAAAAGATTAAAGAACAA
GGAGAGGTTGTCAGAAAACTTAAATCCTCAAAAGACCAAACTGATGAAAT
AAAGCAACAGATCAAAGATGAGGTGGCAAAACTGTTGGAACTGAAAGCAC
AACTGGGAGGGAATAATactaaaaagaaatttgtcctCAAAACACCAAAA
GGAACACGAGATTATGGGCCAAAGCAAATGGCAATTcgtgaaaaagtttt
caaaattatcacAGAGACATTTCAAAAACATGGAGCTGTAGAAATCAATA
CACCTGTGATGGAATTGAAGGAAACACTCACAGGAAAATATGGAGAAGAC
TCGAAACTGATATACGATTTGAAAGATCAAGGAGGAGAGATACTTGCACT
GCGTTATGATTTGACGGTACCATTTGCACGGTATGTTGCAATGAACAAAG
TAGAGAAGATCAAAAGATATCATATAGCACGTGTATACAGAAGAGATAAC
CCTGCTATGACTCGTGGAAGGTACCGTGAATTCTACCAATGTGATTACGA
TGTAGCAGGACAATACGACCCACTTATACCTGATGCTGAATGTGTCAAAA
TTGTagctgaaattttattgaaacttgAACTTGGCGATTTTGTTATTAAG
GTCAATCACCGCAAAGTATTGGACGGTATTTTCGCAATTTCTGGCGTTCC
TGAATGTCAATTTCGTACCATCTGTTCATCAGTCGACAAACTGGATAAAA
CACCATGGGAAGAAGTTCGTAACGAAATGGTGAAAGAAAAAGGGTTATCA
GAAGACATAGCTGACAAGATATACGAATATGTCCAATATAAAGGTGGTCC
TGAACTGATAGAAAAGTTACTGAACGATGAGAAATTCACCAATAACAAAA
GTGCTAAAGAGGGAGTCGAAGATATGAAGCTCCTGTTCAAATATTGTGAA
CTTTTTGGATGTTTACAAAATGTTTCGTTTGATTTGAGCTTGGCACGTGG
TTTGGACTATTACACAGGAGTGATTTATGAAGCAGTGCTCACGGGACTGC
CCAAAGAACTCATGAATGGTAAAACTGATAAGAAGAAAGACAAGAAAAAA
GAAGGTGAAGATGAACAAGTTGGCGTCGGATCTGTGGCGGGTGGTGGGCG
TTATGATGATCTAGTTGGCATGTTCGATTCAAAGGGGAAAAAAGTTCCTT
GTGTCGGTGTTAGCCTGGGGATTGAACGTATTTTTTCGATCATGGAAAAG
AAGCAAGAGtTATCGGAAGAGAAAGCTCGaattacgaaaacgaaagtgtt
aGTTGTCAGCGGCCAAAAGAAAATGCTGGAAGAAAGATTGAAATTAGTCA
ACGAGCTTTGGTCTCAAAACATCGAGGCAGAAGTGACATTCAAAGCTAAT
CCCAAACTTTTGAATCAGTTCCAATACTGTGAAGACAATGCGATCCCTTT
GTGTGCTGTGATCGGTGACAGTGAATTGGAAAAGGGTGTTGTCATGCTTC
GCAACATGAAAACTAGAGAACAGAATGAAGTCAAACGTGACGAACTTGCT
GAAGAAATTCGAAAACTTTGCGTCGAATAGatggcgtctccaaatgaaga
tgaaaaacgaGTTGCTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTG
TCAGAAAACTTAAATCCTCAAAAGACCAAACTGATGAAATAAAGCAACAG
ATCAAAGATGAGGTGGCAAAACTGTTGGAACTGAAAGCACAACTGGGAGG
GAATAATactaaaaagaaatttgtcctCAAAACACCAAAAGGAACACGAG
ATTATGGGCCAAAGCAAATGGCAATTcgtgaaaaagttttcaaaattatc
acAGAGACATTTCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGAT
GGAATTGAAGGAAACACTCACAGGAAAATATGGAGAAGACTCGAAACTGA
TATACGATTTGAAAGATCAAGGAGGAGAGATACTTGCACTGCGTTATGAT
TTGACGGTACCATTTGCACGGTATGTTGCAATGAACAAAGTAGAGAAGAT
CAAAAGATATCATATAGCACGTGTATACAGAAGAGATAACCCTGCTATGA
CTCGTGGAAGGTACCGTGAATTCTACCAATGTGATTACGATGTAGCAGGA
CAATACGACCCACTTATACCTGATGCTGAATGTGTCAAAATTGTagctga
aattttattgaaacttgAACTTGGCGATTTTGTTATTAAGGTCAATCACC
GCAAAGTATTGGACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAA
TTTCGTACCATCTGTTCATCAGTCGACAAACTGGATAAAACACCATGGGA
AGAAGTTCGTAACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACATAG
CTGACAAGATATACGAATATGTCCAATATAAAGGTGGTCCTGAACTGATA
GAAAAGTTACTGAACGATGAGAAATTCACCAATAACAAAAGTGCTAAAGA
GGGAGTCGAAGATATGAAGCTCCTGTTCAAATATTGTGAACTTTTTGGAT
GTTTACAAAATGTTTCGTTTGATTTGAGCTTGGCACGTGGTTTGGACTAT
TACACAGGAGTGATTTATGAAGCAGTGCTCACGGGACTGCCCAAAGAACT
CATGAATGGTAAAACTGATAAGAAGAAAGACAAGAAAAAAGAAGGTGAAG
ATGAACAAGTTGGCGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGAT
CTAGTTGGCATGTTCGATTCAAAGGGGAAAAAAGTTCCTTGTGTCGGTGT
TAGCCTGGGGATTGAACGTATTTTTTCGATCATGGAAAAGAAGCAAGAGt
TATCGGAAGAGAAAGCTCGaattacgaaaacgaaagtgttaGTTGTCAGC
GGCCAAAAGAAAATGCTGGAAGAAAGATTGAAATTAGTCAACGAGCTTTG
GTCTCAAAACATCGAGGCAGAAGTGACATTCAAAGCTAATCCCAAACTTT
TGAATCAGTTCCAATACTGTGAAGACAATGCGATCCCTTTGTGTGCTGTG
ATCGGTGACAGTGAATTGGAAAAGGGTGTTGTCATGCTTCGCAACATGAA
AACTAGAGAACAGAATGAAGTCAAACGTGACGAACTTGCTGAAGAAATTC
GAAAACTTTGCGTCGAATAGatggcgtctccaaatgaagatgaaaaacga
GTTGCTCTTCAAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACT
TAAATCCTCAAAAGACCAAACTGATGAAATAAAGCAACAGATCAAAGATG
AGGTGGCAAAACTGTTGGAACTGAAAGCACAACTGGGAGGGAATAATact
aaaaagaaatttgtcctCAAAACACCAAAAGGAACACGAGATTATGGGCC
AAAGCAAATGGCAATTcgtgaaaaagttttcaaaattatcacAGAGACAT
TTCAAAAACATGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAG
GAAACACTCACAGGAAAATATGGAGAAGACTCGAAACTGATATACGATTT
GAAAGATCAAGGAGGAGAGATACTTGCACTGCGTTATGATTTGACGGTAC
CATTTGCACGGTATGTTGCAATGAACAAAGTAGAGAAGATCAAAAGATAT
CATATAGCACGTGTATACAGAAGAGATAACCCTGCTATGACTCGTGGAAG
GTACCGTGAATTCTACCAATGTGATTACGATGTAGCAGGACAATACGACC
CACTTATACCTGATGCTGAATGTGTCAAAATTGTagctgaaattttattg
aaacttgAACTTGGCGATTTTGTTATTAAGGTCAATCACCGCAAAGTATT
GGACGGTATTTTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTACCA
TCTGTTCATCAGTCGACAAACTGGATAAAACACCATGGGAAGAAGTTCGT
AACGAAATGGTGAAAGAAAAAGGGTTATCAGAAGACATAGCTGACAAGAT
ATACGAATATGTCCAATATAAAGGTGGTCCTGAACTGATAGAAAAGTTAC
TGAACGATGAGAAATTCACCAATAACAAAAGTGCTAAAGAGGGAGTCGAA
GATATGAAGCTCCTGTTCAAATATTGTGAACTTTTTGGATGTTTACAAAA
TGTTTCGTTTGATTTGAGCTTGGCACGTGGTTTGGACTATTACACAGGAG
TGATTTATGAAGCAGTGCTCACGGGACTGCCCAAAGAACTCATGAATGGT
AAAACTGATAAGAAGAAAGACAAGAAAAAAGAAGGTGAAGATGAACAAGT
TGGCGTCGGATCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCA
TGTTCGATTCAAAGGGGAAAAAAGTTCCTTGTGTCGGTGTTAGCCTGGGG
ATTGAACGTATTTTTTCGATCATGGAAAAGAAGCAAGAGtTATCGGAAGA
GAAAGCTCGaattacgaaaacgaaagtgttaGTTGTCAGCGGCCAAAAGA
AAATGCTGGAAGAAAGATTGAAATTAGTCAACGAGCTTTGGTCTCAAAAC
ATCGAGGCAGAAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTT
CCAATACTGTGAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACA
GTGAATTGGAAAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAA
CAGAATGAAGTCAAACGTGACGAACTTGCTGAAGAAATTCGAAAACTTTG
CGTCGAATAGatggcgtctccaaatgaagatgaaaaacgaGTTGCTCTTC
AAGAAAAGATTAAAGAACAAGGAGAGGTTGTCAGAAAACTTAAATCCTCA
AAAGACCAAACTGATGAAATAAAGCAACAGATCAAAGATGAGGTGGCAAA
ACTGTTGGAACTGAAAGCACAACTGGGAGGGAATAATactaaaaagaaat
ttgtcctCAAAACACCAAAAGGAACACGAGATTATGGGCCAAAGCAAATG
GCAATTcgtgaaaaagttttcaaaattatcacAGAGACATTTCAAAAACA
TGGAGCTGTAGAAATCAATACACCTGTGATGGAATTGAAGGAAACACTCA
CAGGAAAATATGGAGAAGACTCGAAACTGATATACGATTTGAAAGATCAA
GGAGGAGAGATACTTGCACTGCGTTATGATTTGACGGTACCATTTGCACG
GTATGTTGCAATGAACAAAGTAGAGAAGATCAAAAGATATCATATAGCAC
GTGTATACAGAAGAGATAACCCTGCTATGACTCGTGGAAGGTACCGTGAA
TTCTACCAATGTGATTACGATGTAGCAGGACAATACGACCCACTTATACC
TGATGCTGAATGTGTCAAAATTGTagctgaaattttattgaaacttgAAC
TTGGCGATTTTGTTATTAAGGTCAATCACCGCAAAGTATTGGACGGTATT
TTCGCAATTTCTGGCGTTCCTGAATGTCAATTTCGTACCATCTGTTCATC
AGTCGACAAACTGGATAAAACACCATGGGAAGAAGTTCGTAACGAAATGG
TGAAAGAAAAAGGGTTATCAGAAGACATAGCTGACAAGATATACGAATAT
GTCCAATATAAAGGTGGTCCTGAACTGATAGAAAAGTTACTGAACGATGA
GAAATTCACCAATAACAAAAGTGCTAAAGAGGGAGTCGAAGATATGAAGC
TCCTGTTCAAATATTGTGAACTTTTTGGATGTTTACAAAATGTTTCGTTT
GATTTGAGCTTGGCACGTGGTTTGGACTATTACACAGGAGTGATTTATGA
AGCAGTGCTCACGGGACTGCCCAAAGAACTCATGAATGGTAAAACTGATA
AGAAGAAAGACAAGAAAAAAGAAGGTGAAGATGAACAAGTTGGCGTCGGA
TCTGTGGCGGGTGGTGGGCGTTATGATGATCTAGTTGGCATGTTCGATTC
AAAGGGGAAAAAAGTTCCTTGTGTCGGTGTTAGCCTGGGGATTGAACGTA
TTTTTTCGATCATGGAAAAGAAGCAAGAGtTATCGGAAGAGAAAGCTCGa
attacgaaaacgaaagtgttaGTTGTCAGCGGCCAAAAGAAAATGCTGGA
AGAAAGATTGAAATTAGTCAACGAGCTTTGGTCTCAAAACATCGAGGCAG
AAGTGACATTCAAAGCTAATCCCAAACTTTTGAATCAGTTCCAATACTGT
GAAGACAATGCGATCCCTTTGTGTGCTGTGATCGGTGACAGTGAATTGGA
AAAGGGTGTTGTCATGCTTCGCAACATGAAAACTAGAGAACAGAATGAAG
TCAAACGTGACGAACTTGCTGAAGAAATTCGAAAACTTTGCGTCGAATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000579XLOC_000579Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000994-proteinTCONS_00000994-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000994-exon-sc0000007-1491911889:404900..405238TCONS_00000994-exon-sc0000007-1491911889:404900..405238Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:404900..405238TCONS_00000994-exon-sc0000007-1510915933:404900..405238Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:404900..405238TCONS_00000994-exon-sc0000007-1575043694:404900..405238Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:414410..414499TCONS_00000994-exon-sc0000007-1491911889:414410..414499Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:414410..414499TCONS_00000994-exon-sc0000007-1510915933:414410..414499Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:414410..414499TCONS_00000994-exon-sc0000007-1575043694:414410..414499Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:414633..414752TCONS_00000994-exon-sc0000007-1491911889:414633..414752Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:414633..414752TCONS_00000994-exon-sc0000007-1510915933:414633..414752Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:414633..414752TCONS_00000994-exon-sc0000007-1575043694:414633..414752Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:414888..414983TCONS_00000994-exon-sc0000007-1491911889:414888..414983Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:414888..414983TCONS_00000994-exon-sc0000007-1510915933:414888..414983Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:414888..414983TCONS_00000994-exon-sc0000007-1575043694:414888..414983Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:415230..415355TCONS_00000994-exon-sc0000007-1491911889:415230..415355Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:415230..415355TCONS_00000994-exon-sc0000007-1510915933:415230..415355Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:415230..415355TCONS_00000994-exon-sc0000007-1575043694:415230..415355Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:416093..416200TCONS_00000994-exon-sc0000007-1491911889:416093..416200Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:416093..416200TCONS_00000994-exon-sc0000007-1510915933:416093..416200Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:416093..416200TCONS_00000994-exon-sc0000007-1575043694:416093..416200Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:416386..416484TCONS_00000994-exon-sc0000007-1491911889:416386..416484Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:416386..416484TCONS_00000994-exon-sc0000007-1510915933:416386..416484Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:416386..416484TCONS_00000994-exon-sc0000007-1575043694:416386..416484Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:416692..416785TCONS_00000994-exon-sc0000007-1491911889:416692..416785Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:416692..416785TCONS_00000994-exon-sc0000007-1510915933:416692..416785Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:416692..416785TCONS_00000994-exon-sc0000007-1575043694:416692..416785Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:416887..417014TCONS_00000994-exon-sc0000007-1491911889:416887..417014Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:416887..417014TCONS_00000994-exon-sc0000007-1510915933:416887..417014Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:416887..417014TCONS_00000994-exon-sc0000007-1575043694:416887..417014Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:417120..417252TCONS_00000994-exon-sc0000007-1491911889:417120..417252Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:417120..417252TCONS_00000994-exon-sc0000007-1510915933:417120..417252Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:417120..417252TCONS_00000994-exon-sc0000007-1575043694:417120..417252Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:417434..417522TCONS_00000994-exon-sc0000007-1491911889:417434..417522Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:417434..417522TCONS_00000994-exon-sc0000007-1510915933:417434..417522Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:417434..417522TCONS_00000994-exon-sc0000007-1575043694:417434..417522Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:421765..421830TCONS_00000994-exon-sc0000007-1491911889:421765..421830Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:421765..421830TCONS_00000994-exon-sc0000007-1510915933:421765..421830Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:421765..421830TCONS_00000994-exon-sc0000007-1575043694:421765..421830Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:422371..422487TCONS_00000994-exon-sc0000007-1491911889:422371..422487Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:422371..422487TCONS_00000994-exon-sc0000007-1510915933:422371..422487Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:422371..422487TCONS_00000994-exon-sc0000007-1575043694:422371..422487Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:422747..422893TCONS_00000994-exon-sc0000007-1491911889:422747..422893Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:422747..422893TCONS_00000994-exon-sc0000007-1510915933:422747..422893Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:422747..422893TCONS_00000994-exon-sc0000007-1575043694:422747..422893Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1491911889:423227..423361TCONS_00000994-exon-sc0000007-1491911889:423227..423361Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1510915933:423227..423361TCONS_00000994-exon-sc0000007-1510915933:423227..423361Clytia hemisphaericaexon
TCONS_00000994-exon-sc0000007-1575043694:423227..423361TCONS_00000994-exon-sc0000007-1575043694:423227..423361Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:404900..423361 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
114.472 109.122 116.909 110.324 143.041 110.382 120.229 128.582 80.8335 89.3513 66.0899 45.9323 45.8991 46.3659 44.3607 54.5718 74.8653 65.7353 31.9223 34.625 44.3556 43.5401 66.5006 61.0685 60.9237 65.3915 62.0455 53.7944 62.8402 62.9626
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000738WHEP-TRS_dom
IPR004516HisRS/HisZ
IPR004154Anticodon-bd
IPR015807His-tRNA-ligase
IPR006195aa-tRNA-synth_II
IPR033656HisRS_anticodon
IPR009068S15_NS1_RNA-bd
Vocabulary: Biological Process
TermDefinition
GO:0006418tRNA aminoacylation for protein translation
GO:0006427histidyl-tRNA aminoacylation
Vocabulary: Molecular Function
TermDefinition
GO:0004812aminoacyl-tRNA ligase activity
GO:0005524ATP binding
GO:0004821histidine-tRNA ligase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006427 histidyl-tRNA aminoacylation
biological_process GO:0006418 tRNA aminoacylation for protein translation
cellular_component GO:0005737 cytoplasm
molecular_function GO:0004812 aminoacyl-tRNA ligase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0004821 histidine-tRNA ligase activity
Blast
BLAST of TCONS_00000994 vs. Swiss-Prot (Human)
Match: SYHC (Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 333/525 (63.43%), Postives = 415/525 (79.05%), Query Frame = 1
Query:  244 KRVALQEKIKEQGEVVRKLKSSKDQTDEIKQQIKDEVAKLLELKAQLGGNNTKKKFVLKTPKGTRDYGPKQMAIREKVFKIITETFQKHGAVEINTPVMELKETLTGKYGEDSKLIYDLKDQGGEILALRYDLTVPFARYVAMNKVEKIKRYHIARVYRRDNPAMTRGRYREFYQCDYDVAGQYDPLIPDAECVKIVAEILLKLELGDFVIKVNHRKVLDGIFAISGVPECQFRTICSSVDKLDKTPWEEVRNEMVKEKGLSEDIADKIYEYVQYKGGPELIEKLLNDEKFTNNKSAKEGVEDMKLLFKYCELFGCLQNVSFDLSLARGLDYYTGVIYEAVLTGLPKELMNXXXXXXXXXXXXXXXXQVGVGSVAGGGRYDDLVGMFDSKGKKVPCVGVSLGIERIFSIMEKKQELSEEKARITKTKVLVVSGQKKMLEERLKLVNELWSQNIEAEVTFKANPKLLNQFQYCEDNAIPLCAVIGDSELEKGVVMLRNMKTREQNEVKRDELAEEIRK-----LCV 1803
            +R AL+E +K QGE VR LK  K       + I++EVAKLL+LKAQLG + +K+KFVLKTPKGTRDY P+QMA+REKVF +I   F++HGA  I+TPV ELKETL GKYGEDSKLIYDLKDQGGE+L+LRYDLTVPFARY+AMNK+  IKRYHIA+VYRRDNPAMTRGRYREFYQCD+D+AG +DP+IPDAEC+KI+ EIL  L++GDF++KVN R++LDG+FAI GV + +FRTICSSVDKLDK  WEEV+NEMV EKGL+ ++AD+I +YVQ  GG  L+E+LL D K + NK A EG+ D+KLLF+Y  LFG    +SFDLSLARGLDYYTGVIYEAVL   P +                 +E +GVGSVA GGRYD LVGMFD KG+KVPCVG+S+G+ERIFSI+E++ E  EEK R T+T+VLV S QKK+LEERLKLV+ELW   I+AE+ +K NPKLLNQ QYCE+  IPL A+IG+ EL+ GV+ LR++ +RE+ +V+R++L EEI++     LC+
Sbjct:    3 ERAALEELVKLQGERVRGLKQQKASA----ELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQ---------------AGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCI 508          
The following BLAST results are available for this feature:
BLAST of TCONS_00000994 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SYHC0.000e+063.43Histidine--tRNA ligase, cytoplasmic OS=Homo sapien... [more]
back to top