Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000994-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000994-protein
Unique NameTCONS_00000994-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length529

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000994-protein ID=TCONS_00000994-protein|Name=TCONS_00000994-protein|organism=Clytia hemisphaerica|type=polypeptide|length=529bp
MASPNEDEKRVALQEKIKEQGEVVRKLKSSKDQTDEIKQQIKDEVAKLLE
LKAQLGGNNTKKKFVLKTPKGTRDYGPKQMAIREKVFKIITETFQKHGAV
EINTPVMELKETLTGKYGEDSKLIYDLKDQGGEILALRYDLTVPFARYVA
MNKVEKIKRYHIARVYRRDNPAMTRGRYREFYQCDYDVAGQYDPLIPDAE
CVKIVAEILLKLELGDFVIKVNHRKVLDGIFAISGVPECQFRTICSSVDK
LDKTPWEEVRNEMVKEKGLSEDIADKIYEYVQYKGGPELIEKLLNDEKFT
NNKSAKEGVEDMKLLFKYCELFGCLQNVSFDLSLARGLDYYTGVIYEAVL
TGLPKELMNGKTDKKKDKKKEGEDEQVGVGSVAGGGRYDDLVGMFDSKGK
KVPCVGVSLGIERIFSIMEKKQELSEEKARITKTKVLVVSGQKKMLEERL
KLVNELWSQNIEAEVTFKANPKLLNQFQYCEDNAIPLCAVIGDSELEKGV
VMLRNMKTREQNEVKRDELAEEIRKLCVE
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000579XLOC_000579Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000994TCONS_00000994Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000738WHEP-TRS_dom
IPR004516HisRS/HisZ
IPR004154Anticodon-bd
IPR015807His-tRNA-ligase
IPR006195aa-tRNA-synth_II
IPR033656HisRS_anticodon
IPR009068S15_NS1_RNA-bd
Vocabulary: Biological Process
TermDefinition
GO:0006418tRNA aminoacylation for protein translation
GO:0006427histidyl-tRNA aminoacylation
Vocabulary: Molecular Function
TermDefinition
GO:0004812aminoacyl-tRNA ligase activity
GO:0005524ATP binding
GO:0004821histidine-tRNA ligase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006427 histidyl-tRNA aminoacylation
biological_process GO:0006418 tRNA aminoacylation for protein translation
cellular_component GO:0005737 cytoplasm
molecular_function GO:0004812 aminoacyl-tRNA ligase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0004821 histidine-tRNA ligase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 34..54
NoneNo IPR availableCOILSCoilCoilcoord: 509..529
NoneNo IPR availablePFAMPF13393tRNA-synt_Hiscoord: 71..360
e-value: 2.7E-34
score: 118.8
NoneNo IPR availableGENE3D1.10.287.10coord: 6..56
e-value: 2.6E-14
score: 52.4
NoneNo IPR availableGENE3D3.30.930.10coord: 57..429
e-value: 5.1E-118
score: 393.5
NoneNo IPR availableCDDcd00773HisRS-like_corecoord: 79..419
e-value: 6.88215E-93
score: 285.651
NoneNo IPR availableSUPERFAMILY55681Class II aaRS and biotin synthetasescoord: 67..418
IPR000738WHEP-TRS domainSMARTSM00991WHEP_TRS_a_2_a_3_acoord: 13..70
e-value: 3.3E-10
score: 49.9
IPR000738WHEP-TRS domainPFAMPF00458WHEP-TRScoord: 13..56
e-value: 2.1E-10
score: 40.5
IPR000738WHEP-TRS domainPROSITEPS51185WHEP_TRS_2coord: 9..69
score: 11.703
IPR004516Histidine-tRNA ligase/ATP phosphoribosyltransferase regulatory subunitPIRSFPIRSF001549His-tRNA_synthcoord: 62..527
e-value: 3.4E-124
score: 412.8
coord: 3..67
e-value: 83.0
score: -0.4
IPR004154Anticodon-bindingGENE3D3.40.50.800coord: 431..529
e-value: 8.9E-24
score: 83.0
IPR004154Anticodon-bindingPFAMPF03129HGTP_anticodoncoord: 436..525
e-value: 2.6E-16
score: 59.4
IPR004154Anticodon-bindingSUPERFAMILY52954Class II aaRS ABD-relatedcoord: 432..526
IPR015807Histidine-tRNA ligaseTIGRFAMTIGR00442TIGR00442coord: 67..515
e-value: 4.8E-96
score: 320.1
IPR015807Histidine-tRNA ligaseHAMAPMF_00127His_tRNA_synthcoord: 64..525
score: 23.286
IPR006195Aminoacyl-tRNA synthetase, class IIPROSITEPS50862AA_TRNA_LIGASE_IIcoord: 71..418
score: 10.667
IPR033656Histidyl-anticodon-bindingCDDcd00859HisRS_anticodoncoord: 434..524
e-value: 4.01846E-23
score: 92.988
IPR009068S15/NS1, RNA-bindingSUPERFAMILY47060S15/NS1 RNA-binding domaincoord: 13..69

Blast
BLAST of TCONS_00000994-protein vs. Swiss-Prot (Human)
Match: SYHC (Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2)

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 333/525 (63.43%), Postives = 415/525 (79.05%), Query Frame = 0
Query:    9 KRVALQEKIKEQGEVVRKLKSSKDQTDEIKQQIKDEVAKLLELKAQLGGNNTKKKFVLKTPKGTRDYGPKQMAIREKVFKIITETFQKHGAVEINTPVMELKETLTGKYGEDSKLIYDLKDQGGEILALRYDLTVPFARYVAMNKVEKIKRYHIARVYRRDNPAMTRGRYREFYQCDYDVAGQYDPLIPDAECVKIVAEILLKLELGDFVIKVNHRKVLDGIFAISGVPECQFRTICSSVDKLDKTPWEEVRNEMVKEKGLSEDIADKIYEYVQYKGGPELIEKLLNDEKFTNNKSAKEGVEDMKLLFKYCELFGCLQNVSFDLSLARGLDYYTGVIYEAVLTGLPKELMNGKTDKKKDKKKEGEDEQVGVGSVAGGGRYDDLVGMFDSKGKKVPCVGVSLGIERIFSIMEKKQELSEEKARITKTKVLVVSGQKKMLEERLKLVNELWSQNIEAEVTFKANPKLLNQFQYCEDNAIPLCAVIGDSELEKGVVMLRNMKTREQNEVKRDELAEEIRK-----LCV 528
            +R AL+E +K QGE VR LK  K       + I++EVAKLL+LKAQLG + +K+KFVLKTPKGTRDY P+QMA+REKVF +I   F++HGA  I+TPV ELKETL GKYGEDSKLIYDLKDQGGE+L+LRYDLTVPFARY+AMNK+  IKRYHIA+VYRRDNPAMTRGRYREFYQCD+D+AG +DP+IPDAEC+KI+ EIL  L++GDF++KVN R++LDG+FAI GV + +FRTICSSVDKLDK  WEEV+NEMV EKGL+ ++AD+I +YVQ  GG  L+E+LL D K + NK A EG+ D+KLLF+Y  LFG    +SFDLSLARGLDYYTGVIYEAVL   P                +  +E +GVGSVA GGRYD LVGMFD KG+KVPCVG+S+G+ERIFSI+E++ E  EEK R T+T+VLV S QKK+LEERLKLV+ELW   I+AE+ +K NPKLLNQ QYCE+  IPL A+IG+ EL+ GV+ LR++ +RE+ +V+R++L EEI++     LC+
Sbjct:    3 ERAALEELVKLQGERVRGLKQQKASA----ELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTP---------------AQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCI 508          
The following BLAST results are available for this feature:
BLAST of TCONS_00000994-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SYHC0.000e+063.43Histidine--tRNA ligase, cytoplasmic OS=Homo sapien... [more]
back to top