Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000985 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000985
Unique NameTCONS_00000985
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1534

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000985 ID=TCONS_00000985|Name=TCONS_00000985|organism=Clytia hemisphaerica|type=transcript|length=1534bp
AAAATCGGAAAACTGTTAACCCGAAAAGTAACCCCGATGTCGAACAACTT
TTTCCCGTCTCCCTCTTTTCCATGTGTGTAAAAATGGCAGCTTGAGAACA
TCAGACTTTATCATCCTTTCCTTaaaaaaagacaacaaaaacTTGATACA
TTCGCAATAAAATGAAACCTTTACTTCTCCATGGTCATGAGCGTTCAATC
ACGCAAATCAAATACAACAAAGAAGGGGATTTGTTATTTTCGTCTGCCAA
AGACAATCGTCCTACAGTATGGTACAGTGTGAATGGAGAACGTCTAGGAA
CATACAATGGTCATGGTGGTGCTGTATGGTGTCTAGATCCACGCTGGGAC
TCCAAATATCTTCTCACCGGTTCGGCAGACAACTCTGCTAAACTGTGGGA
TATTGAAACTGGGACAGAGTTGAAAAGTTTAGGCACTGGCTCAGCTGTTC
GTACATGTGGCTTCTCATACAGTGGAAAACAATTCTTTTATTCGACTGAT
AAAGCTATGGGACGTCAAtgtgaaatatatttttacgATGTCAATAATGC
ATTGACAGGGGAAGGAAATCCCGATCCATATTTGGTGATTGAATCGAAAG
ATTCCAAAGTTACAGCAGCTTTATGGGGACCTTTAGATGAATATATTTTA
ACTGGTCATGACGATGGAACTATCACAAAATGGTGTTCAAAGACCGGTGA
CAAGATCAAAGCTGTAAAACCTCACTCAGAGAAAGTGAACGATATTCAAA
AGAACGAAAACGAGATGATGTTTGTCACAGCTTCAAAAGACAACTACTCT
AAACTTTTCGATACTGAAACTATGCAAGTATTGAAAGAATATAAGACTGA
ACGTCCTGTCAACTCGGCTGCTGTTTCCCCTATCCGTGACCAGGTTGTAC
TTGGAGGAGGTCAAGAAGCAATGGAAGTCACCACAACTTCAGCAAGAGTT
GGAAAATTCGATGCACGCTTCTTTCATATGATTTTCGAAGAGGAAATTGG
AAGGGTCAAAGGTCATTTCGGACCAATCAACAGTTTAGCGTTTCATCCTG
ATGGAAAGAGTTACAGTAGTGGAGGGGAGGATGGCTACGTCAGAAATCAC
GTCTTCGATAAATCGTACTACGAATTCGATTTCGAATATTAAACATCAAA
CATTGTCAACACGCTGTCTATTTTTACGCtatgaattattatttttcatg
ccGAATTTGTTTCAAATTATTAAATAGTTCTTTCTATTCACTCGCTGTTT
CCTTTTTAATCACCGGTCAGATTGCCGAACTcgaaatttctaaaaagtta
aatttttatttcacgCAGCAACTTCTGTGAATAGAAAGAACAATTATTTA
TATaggaaattaattttaaaatgaaaaataagtgaTAAAGGGCTGATGAA
ATACTTCTCACGTTTGACTTCATTTTTGGATAATCCTGACTGTCTACAAT
TGAAACTCCTTATCTTTGATTTGAACCTTATCACTTCAATGTTTCAACGA
CTTCAGCTTAACTTTGATTAATCCTAGAGAAttt
Run BLAST on NCBI

protein sequence of TCONS_00000985-protein

>TCONS_00000985-protein ID=TCONS_00000985-protein|Name=TCONS_00000985-protein|organism=Clytia hemisphaerica|type=polypeptide|length=326bp
MKPLLLHGHERSITQIKYNKEGDLLFSSAKDNRPTVWYSVNGERLGTYNG
HGGAVWCLDPRWDSKYLLTGSADNSAKLWDIETGTELKSLGTGSAVRTCG
FSYSGKQFFYSTDKAMGRQCEIYFYDVNNALTGEGNPDPYLVIESKDSKV
TAALWGPLDEYILTGHDDGTITKWCSKTGDKIKAVKPHSEKVNDIQKNEN
EMMFVTASKDNYSKLFDTETMQVLKEYKTERPVNSAAVSPIRDQVVLGGG
QEAMEVTTTSARVGKFDARFFHMIFEEEIGRVKGHFGPINSLAFHPDGKS
YSSGGEDGYVRNHVFDKSYYEFDFEY
Run BLAST on NCBI

transcript from alignment at sc0000007:275848..281049+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000985 ID=TCONS_00000985|Name=TCONS_00000985|organism=Clytia hemisphaerica|type=transcript|length=5202bp|location=Sequence derived from alignment at sc0000007:275848..281049+ (Clytia hemisphaerica)
AAAATCGGAAAACTGTTAACCCGAAAAGTAACCCCGATGTCGAACAACTT TTTCCCGTCTCCCTCTTTTCCATGTGTGTAAAAATGGCAGCTTGAGAACA TCAGACTTTATCATCCTTTCCTTaaaaaaagacaacaaaaacTTGATACA TTCGCAATAAAATGGTAAGAACAATATTTTCTAAGTTTGTTATCAATAGT TCTCATTCGTCACCTATTAAAATTTCGAACACAATCCTAACTAAAGTTTG TGCTTcctcaaaaccacttttttttttaattgaccgTCTgacgaccctgc cggtgcacctGACAGTCGGGTGTTTTGTCGGGTGCTGAAACttctaaatt tgcgaaaacacccgacaaatagtgcacccgacagtcgggtgcttaAAAAG AACCCGTTTTCTTCCGCCTTTAGAAATCGCCACCCGCCTGTTACATGTCG GGTGCTGTTAAGAGCGCCCAAGATATAGTACCCGAAAAAGTGCATCCGAC TGTCGGGTGTTAAAATTTATAACTTCGAGCACCCGAcaacagcacccgac tgtcgggtgcacctGGCAGGGTCGTACTGTCTGTGACCAAGCTTCCTTag gcgatgggaatttgatgttctgtttaccgtcgcgtttcaaaaaatatttg atgcggcaaaatttcattattcattattcctacCTGGTGCTTCCAATCCC CAACAAAGTTTAATTCCACTGTGAAATCGAGCTGCTTTCACTTTCGGAAT CAAAATGACATGCGCGAAAATTCATACGCGTTCAAGACGCGTCTAAAACG CGAATTTCTAAAACACCCTTGATGCCGCCCACTGCTTAAAAATGCCTGCC CCATTCGCGGACGTGATTGGAACCATGTTTTTTACTCGAGGCGCACATTT TGTTAGCgaagatgttatttttgattcactttgagTGNNNGTTGAGtgtt ttggatagcttggcacaggaaaagaagaaaataatgagtttttaagaaat aatgaacttttttgagcggcgGCTCAAGAGCATGCGGGCAGTCGACGGTA AACggaacatcaaattcccatcgccttaaaattgatttttgtcaatttga gggtgctgatatTTGGAATTCAAATGATGAAAAGCCTGCAGTTTGTGGGT ATCTTGCGATTCTGGGGTCCCCAAGCAAAATCCCAAGGTCTGATAATATT TGCAGAATGGCATGGTGTCAGTTTCGGTTTTCGGAACTCTGCTGCTGTGC CAGTCTAGACTGAAACTCCTGTATATATATCatcaagttgacacaacaca acACAAGTCAAGTTGCAAGTCAACCTCATGCTTGTGtatgtattccaggc tttatttacgttactgatagagacgccagagaataccctggtgttgacTG ATGcaagttccccctctgagagggggggggacttctcaaaacaaaacgTC ATAAAAAATCTGACATTACAAAGTTACGCCACAAAGCAATGgcttaaaaa aagaagaacaaattaaatctgatggttttttgtttcaaattacGGAATCT TTTGCATTTGAAAAACACACAATGCCAGGGTGTTATCTTGCACTATCAGT AAGCAGGAAAAGCTAGTAATACACAGGGAACAAGGTCCTGGAAAAGTCtc attttttattgctttaatTGAAGGGGAATTTGGAAAAGAGCAGAACCCta ttacaaaattttaaaacatctGAAAAGACCCTAagattggctaaacacct aatttaaagaaaggaactaaagaaatatatataattttaaaattattgta ATTTACTAAAGAAGCCTATAAGCCCATAGCCTTCAAATTTCAACCAGACA AAGTGAAAAAGTaagtaaaattttttatttgtaaaattgTAACAAACTAA TTGAAATAATAAATCATTGCAACTCAAAATATCCtacatttcttttataa atctttgtttgGATTTTGCCAACCCTTGTCTGAAAACTGAGTCTCAGGAA TTGCTAATAAACtatttctcgtaattttttcgaattttgatcatttgttt atttttttcagtccCTATTTGTTTCTTATTTTACGTCCTTCCATTCTATA TTTATCATTAGCTAGGTCCAATATGCATTGTGCTTATTTGCCCTAAAAAG GTAACCTTCTGGGTACTGTGCTTGTTATCAGCAGCGCAGTGAACCTATCA AAGTCTTTTGTCAGTGCTATCCCTATATTGTGCTTTCGCCCTGCCACTAG CATAACTAGGAAATGATTCTTGGGAAATCCCTGCCTTTTTTCACAGTCAG TTTTAGAGAAGGGGTATTCATTGAGTGTTTTAATTAACATTCATCATTGT CATGATAGCACTTTGCACAGCTTTGCAAGGCTATTTGGGAGCATTCTGCC AGACTAGTATTAAAGTGATGTGAATAatcttttcaattataaataaTTTG TTAGAATTGAAACATGATCTGGAAGATGACAAGCTTACCAAgattagtgc acacttaaacTGTATATGGGCTTTATAttatctttaaagatcttttccAA AGACCATGGCCTGCTGAACGCCCAGACCTTTCCCAGTTTGCTCTTTCCCA GTTTGATTTTTCTATTCTTCTAATTTTATTAACCTCGGATTGTTATAGAA ACCTTTACTTCTCCATGGTCATGAGCGTTCAATCACGCAAATCAAATACA ACAAAGAAGGGGATTTGTTATTTTCGTCTGCCAAAGACAATCGTCCTACA GTATGGTACAGTGTGAATGGAGAACGTCTAGGAACATACAATGGTCATGG TGGTGCTGTATGGTGTCTAGATCCACGCTGGGACTCCAAATATCTTCTCA CCGGTTCGGCAGACAACTCTGCTAAACTGTGGGATATTGAAACTGGGACA GAGTTGAAAAGTTTAGGCACTGGCTCAGCTGTTCGTACATGTGGCTTCTC ATACAGTGGAAAACAATTCTTTTATTCGACTGATAAAGCTATGGGACGTC AAtgtgaaatatatttttacgATGTCAATAATGCATTGACAGGGGAAGGT AAGTATTCCATTTAAAACATGCATTAGTTGCTTAGCTTTTTTCTGATTAA GGAAAGAAATTGACGCCTAACATAACATATCTGAAACATCCCTTCCTTTA AAACCTTGGGAATCCAAAACATTTATCATAATCTCATATGTATTGGTTAA AGAATTTTGTATTAATTAACAAAATGTCAATGTAAATACCAAAATTTCTG CTTTTTATGCTATCTATTATAAAAAGTCGAAGCTTCTTGCATATTTTAAC AGTTGTTTTTTGTGATATTTTAAAAATAGGAGGTGTATAAATAGGCGGAT GCAATACTGTATAAACACTTCAGTATTGTTTTATCTTAAATGGTGGCCAA AGATCactttgtttttactttttctatcATTTGATTTTCAGGAAATCCCG ATCCATATTTGGTGATTGAATCGAAAGATTCCAAAGTTACAGCAGCTTTA TGGGGACCTTTAGATGAATATATTTTAACTGGTCATGACGATGGAACTAT CACAAAATGGTGTTCAAAGGTTAGCAGGTCGTTCTTGGTTGCATACAGTC CTTCTAACGAATTCCTTTCCCACTGAAAGCCTTCTTACATcccaacttga aaaatatcgtTTTGTCAAAtgtttctgaaattttttccttctttgGTCCT ATTTCTTCTGTATAggttttctttttccaaattttgacacTGAACAATTT TTTCGTATTATAAGATTCCAATCCATATTTTCTCATCAGACCGGTGACAA GATCAAAGCTGTAAAACCTCACTCAGAGAAAGTGAACGATATTCAAAAGA ACGAAAACGAGATGATGTTTGTCACAGCTTCAAAAGACAACTACTCTAAA CTTTTCGATACTGAAACTATGCAAGTATTGAAAGAATATAAGACTGAACG TCCTGTCAACTCGGCTGCTGTTTCCCCTATCCGTGACCAGGTGggcattc ttttttttttcttttgtcacttgaaattttgtttgcttttgtaCACAAGA TCAAGCTAGATATATGAGGGGAATTCGGTTACCACAATTCAAGAGTTTTT ACATTGTAAACACCCTGCGCTCATAACGAGTAATATGGTCATTAGCTGTC GATACACTTCCAACTTAAAAAAGCTTGACTTCCTACAATATTTCAGAGCG TTTCGTcgtttttaaaaatgtcaagTTCGGGTGAGACTGGCGATTTCAGC CCTTCCACTTTATGTCATTGGCATTTTTGATTCTAGAGGGGTTTACTGCC TTCCAGGGTATATCCTAAGCCTTATTGAAccatttttttgcatttaatTT CTATCCTAGGTCCTctcaagtcttaagtctaaagCTCAAGAGTTAAAACT ATACTTTCCATAAGTTAAAACACTTgcggttttaaaattttcaaggaatT CCCGTTTAATTCTAAATATTACGGCAAGACTTGTAGCTTTAAAGGAGTGA AACCTTTACCTTTTGGAAAGGTTAAGTGCGTTTTACCAGCAAACTCCTCA TCTTTCGGCAGGTTGTACTTGGAGGAGGTCAAGAAGCAATGGAAGTCACC ACAACTTCAGCAAGAGTTGGAAAATTCGATGCACGCTTCTTTCATATGAT TTTCGAAGAGGAAATTGGAAGGGTCAAAGGTCATTTCGGACCAATCAACA GTTTAGCGTTTCATCCTGATGGAAAGAGTTACAGTAGTGGAGGGGAGGAT GGCTACGTCAGAAATCACGTCTTCGATAAATCGTACTACGAATTCGATTT CGAATATTAAACATCAAACATTGTCAACACGCTGTCTATTTTTACGCtat gaattattatttttcatgccGAATTTGTTTCAAATTATTAAATAGTTCTT TCTATTCACTCGCTGTTTCCTTTTTAATCACCGGTCAGATTGCCGAACTc gaaatttctaaaaagttaaatttttatttcacgCAGCAACTTCTGTGAAT AGAAAGAACAATTATTTATATaggaaattaattttaaaatgaaaaataag tgaTAAAGGGCTGATGAAATACTTCTCACGTTTGACTTCATTTTTGGATA ATCCTGACTGTCTACAATTGAAACTCCTTATCTTTGATTTGAACCTTATC ACTTCAATGTTTCAACGACTTCAGCTTAACTTTGATTAATCCTAGAGAAt tt

Coding sequence (CDS) from alignment at sc0000007:275848..281049+

>TCONS_00000985 ID=TCONS_00000985|Name=TCONS_00000985|organism=Clytia hemisphaerica|type=CDS|length=4905bp|location=Sequence derived from alignment at sc0000007:275848..281049+ (Clytia hemisphaerica)
ATGAAACCTTTACTTCTCCATGGTCATGAGCGTTCAATCACGCAAATCAA
ATACAACAAAGAAGGGGATTTGTTATTTTCGTCTGCCAAAGACAATCGTC
CTACAGTATGGTACAGTGTGAATGGAGAACGTCTAGGAACATACAATGGT
CATGGTGGTGCTGTATGGTGTCTAGATCCACGCTGGGACTCCAAATATCT
TCTCACCGGTTCGGCAGACAACTCTGCTAAACTGTGGGATATTGAAACTG
GGACAGAGTTGAAAAGTTTAGGCACTGGCTCAGCTGTTCGTACATGTGGC
TTCTCATACAGTGGAAAACAATTCTTTTATTCGACTGATAAAGCTATGGG
ACGTCAAtgtgaaatatatttttacgATGTCAATAATGCATTGACAGGGG
AAGGAAATCCCGATCCATATTTGGTGATTGAATCGAAAGATTCCAAAGTT
ACAGCAGCTTTATGGGGACCTTTAGATGAATATATTTTAACTGGTCATGA
CGATGGAACTATCACAAAATGGTGTTCAAAGACCGGTGACAAGATCAAAG
CTGTAAAACCTCACTCAGAGAAAGTGAACGATATTCAAAAGAACGAAAAC
GAGATGATGTTTGTCACAGCTTCAAAAGACAACTACTCTAAACTTTTCGA
TACTGAAACTATGCAAGTATTGAAAGAATATAAGACTGAACGTCCTGTCA
ACTCGGCTGCTGTTTCCCCTATCCGTGACCAGGTTGTACTTGGAGGAGGT
CAAGAAGCAATGGAAGTCACCACAACTTCAGCAAGAGTTGGAAAATTCGA
TGCACGCTTCTTTCATATGATTTTCGAAGAGGAAATTGGAAGGGTCAAAG
GTCATTTCGGACCAATCAACAGTTTAGCGTTTCATCCTGATGGAAAGAGT
TACAGTAGTGGAGGGGAGGATGGCTACGTCAGAAATCACGTCTTCGATAA
ATCGTACTACGAATTCGATTTCGAATATTAAATGAAACCTTTACTTCTCC
ATGGTCATGAGCGTTCAATCACGCAAATCAAATACAACAAAGAAGGGGAT
TTGTTATTTTCGTCTGCCAAAGACAATCGTCCTACAGTATGGTACAGTGT
GAATGGAGAACGTCTAGGAACATACAATGGTCATGGTGGTGCTGTATGGT
GTCTAGATCCACGCTGGGACTCCAAATATCTTCTCACCGGTTCGGCAGAC
AACTCTGCTAAACTGTGGGATATTGAAACTGGGACAGAGTTGAAAAGTTT
AGGCACTGGCTCAGCTGTTCGTACATGTGGCTTCTCATACAGTGGAAAAC
AATTCTTTTATTCGACTGATAAAGCTATGGGACGTCAAtgtgaaatatat
ttttacgATGTCAATAATGCATTGACAGGGGAAGGAAATCCCGATCCATA
TTTGGTGATTGAATCGAAAGATTCCAAAGTTACAGCAGCTTTATGGGGAC
CTTTAGATGAATATATTTTAACTGGTCATGACGATGGAACTATCACAAAA
TGGTGTTCAAAGACCGGTGACAAGATCAAAGCTGTAAAACCTCACTCAGA
GAAAGTGAACGATATTCAAAAGAACGAAAACGAGATGATGTTTGTCACAG
CTTCAAAAGACAACTACTCTAAACTTTTCGATACTGAAACTATGCAAGTA
TTGAAAGAATATAAGACTGAACGTCCTGTCAACTCGGCTGCTGTTTCCCC
TATCCGTGACCAGGTTGTACTTGGAGGAGGTCAAGAAGCAATGGAAGTCA
CCACAACTTCAGCAAGAGTTGGAAAATTCGATGCACGCTTCTTTCATATG
ATTTTCGAAGAGGAAATTGGAAGGGTCAAAGGTCATTTCGGACCAATCAA
CAGTTTAGCGTTTCATCCTGATGGAAAGAGTTACAGTAGTGGAGGGGAGG
ATGGCTACGTCAGAAATCACGTCTTCGATAAATCGTACTACGAATTCGAT
TTCGAATATTAAATGAAACCTTTACTTCTCCATGGTCATGAGCGTTCAAT
CACGCAAATCAAATACAACAAAGAAGGGGATTTGTTATTTTCGTCTGCCA
AAGACAATCGTCCTACAGTATGGTACAGTGTGAATGGAGAACGTCTAGGA
ACATACAATGGTCATGGTGGTGCTGTATGGTGTCTAGATCCACGCTGGGA
CTCCAAATATCTTCTCACCGGTTCGGCAGACAACTCTGCTAAACTGTGGG
ATATTGAAACTGGGACAGAGTTGAAAAGTTTAGGCACTGGCTCAGCTGTT
CGTACATGTGGCTTCTCATACAGTGGAAAACAATTCTTTTATTCGACTGA
TAAAGCTATGGGACGTCAAtgtgaaatatatttttacgATGTCAATAATG
CATTGACAGGGGAAGGAAATCCCGATCCATATTTGGTGATTGAATCGAAA
GATTCCAAAGTTACAGCAGCTTTATGGGGACCTTTAGATGAATATATTTT
AACTGGTCATGACGATGGAACTATCACAAAATGGTGTTCAAAGACCGGTG
ACAAGATCAAAGCTGTAAAACCTCACTCAGAGAAAGTGAACGATATTCAA
AAGAACGAAAACGAGATGATGTTTGTCACAGCTTCAAAAGACAACTACTC
TAAACTTTTCGATACTGAAACTATGCAAGTATTGAAAGAATATAAGACTG
AACGTCCTGTCAACTCGGCTGCTGTTTCCCCTATCCGTGACCAGGTTGTA
CTTGGAGGAGGTCAAGAAGCAATGGAAGTCACCACAACTTCAGCAAGAGT
TGGAAAATTCGATGCACGCTTCTTTCATATGATTTTCGAAGAGGAAATTG
GAAGGGTCAAAGGTCATTTCGGACCAATCAACAGTTTAGCGTTTCATCCT
GATGGAAAGAGTTACAGTAGTGGAGGGGAGGATGGCTACGTCAGAAATCA
CGTCTTCGATAAATCGTACTACGAATTCGATTTCGAATATTAAATGAAAC
CTTTACTTCTCCATGGTCATGAGCGTTCAATCACGCAAATCAAATACAAC
AAAGAAGGGGATTTGTTATTTTCGTCTGCCAAAGACAATCGTCCTACAGT
ATGGTACAGTGTGAATGGAGAACGTCTAGGAACATACAATGGTCATGGTG
GTGCTGTATGGTGTCTAGATCCACGCTGGGACTCCAAATATCTTCTCACC
GGTTCGGCAGACAACTCTGCTAAACTGTGGGATATTGAAACTGGGACAGA
GTTGAAAAGTTTAGGCACTGGCTCAGCTGTTCGTACATGTGGCTTCTCAT
ACAGTGGAAAACAATTCTTTTATTCGACTGATAAAGCTATGGGACGTCAA
tgtgaaatatatttttacgATGTCAATAATGCATTGACAGGGGAAGGAAA
TCCCGATCCATATTTGGTGATTGAATCGAAAGATTCCAAAGTTACAGCAG
CTTTATGGGGACCTTTAGATGAATATATTTTAACTGGTCATGACGATGGA
ACTATCACAAAATGGTGTTCAAAGACCGGTGACAAGATCAAAGCTGTAAA
ACCTCACTCAGAGAAAGTGAACGATATTCAAAAGAACGAAAACGAGATGA
TGTTTGTCACAGCTTCAAAAGACAACTACTCTAAACTTTTCGATACTGAA
ACTATGCAAGTATTGAAAGAATATAAGACTGAACGTCCTGTCAACTCGGC
TGCTGTTTCCCCTATCCGTGACCAGGTTGTACTTGGAGGAGGTCAAGAAG
CAATGGAAGTCACCACAACTTCAGCAAGAGTTGGAAAATTCGATGCACGC
TTCTTTCATATGATTTTCGAAGAGGAAATTGGAAGGGTCAAAGGTCATTT
CGGACCAATCAACAGTTTAGCGTTTCATCCTGATGGAAAGAGTTACAGTA
GTGGAGGGGAGGATGGCTACGTCAGAAATCACGTCTTCGATAAATCGTAC
TACGAATTCGATTTCGAATATTAAATGAAACCTTTACTTCTCCATGGTCA
TGAGCGTTCAATCACGCAAATCAAATACAACAAAGAAGGGGATTTGTTAT
TTTCGTCTGCCAAAGACAATCGTCCTACAGTATGGTACAGTGTGAATGGA
GAACGTCTAGGAACATACAATGGTCATGGTGGTGCTGTATGGTGTCTAGA
TCCACGCTGGGACTCCAAATATCTTCTCACCGGTTCGGCAGACAACTCTG
CTAAACTGTGGGATATTGAAACTGGGACAGAGTTGAAAAGTTTAGGCACT
GGCTCAGCTGTTCGTACATGTGGCTTCTCATACAGTGGAAAACAATTCTT
TTATTCGACTGATAAAGCTATGGGACGTCAAtgtgaaatatatttttacg
ATGTCAATAATGCATTGACAGGGGAAGGAAATCCCGATCCATATTTGGTG
ATTGAATCGAAAGATTCCAAAGTTACAGCAGCTTTATGGGGACCTTTAGA
TGAATATATTTTAACTGGTCATGACGATGGAACTATCACAAAATGGTGTT
CAAAGACCGGTGACAAGATCAAAGCTGTAAAACCTCACTCAGAGAAAGTG
AACGATATTCAAAAGAACGAAAACGAGATGATGTTTGTCACAGCTTCAAA
AGACAACTACTCTAAACTTTTCGATACTGAAACTATGCAAGTATTGAAAG
AATATAAGACTGAACGTCCTGTCAACTCGGCTGCTGTTTCCCCTATCCGT
GACCAGGTTGTACTTGGAGGAGGTCAAGAAGCAATGGAAGTCACCACAAC
TTCAGCAAGAGTTGGAAAATTCGATGCACGCTTCTTTCATATGATTTTCG
AAGAGGAAATTGGAAGGGTCAAAGGTCATTTCGGACCAATCAACAGTTTA
GCGTTTCATCCTGATGGAAAGAGTTACAGTAGTGGAGGGGAGGATGGCTA
CGTCAGAAATCACGTCTTCGATAAATCGTACTACGAATTCGATTTCGAAT
ATTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000573XLOC_000573Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000985-exon-sc0000007-1491911889:275848..276011TCONS_00000985-exon-sc0000007-1491911889:275848..276011Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1510915933:275848..276011TCONS_00000985-exon-sc0000007-1510915933:275848..276011Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1575043694:275848..276011TCONS_00000985-exon-sc0000007-1575043694:275848..276011Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1491911889:278496..278895TCONS_00000985-exon-sc0000007-1491911889:278496..278895Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1510915933:278496..278895TCONS_00000985-exon-sc0000007-1510915933:278496..278895Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1575043694:278496..278895TCONS_00000985-exon-sc0000007-1575043694:278496..278895Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1491911889:279289..279416TCONS_00000985-exon-sc0000007-1491911889:279289..279416Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1510915933:279289..279416TCONS_00000985-exon-sc0000007-1510915933:279289..279416Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1575043694:279289..279416TCONS_00000985-exon-sc0000007-1575043694:279289..279416Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1491911889:279637..279837TCONS_00000985-exon-sc0000007-1491911889:279637..279837Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1510915933:279637..279837TCONS_00000985-exon-sc0000007-1510915933:279637..279837Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1575043694:279637..279837TCONS_00000985-exon-sc0000007-1575043694:279637..279837Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1491911889:280409..281049TCONS_00000985-exon-sc0000007-1491911889:280409..281049Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1510915933:280409..281049TCONS_00000985-exon-sc0000007-1510915933:280409..281049Clytia hemisphaericaexon
TCONS_00000985-exon-sc0000007-1575043694:280409..281049TCONS_00000985-exon-sc0000007-1575043694:280409..281049Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000985-proteinTCONS_00000985-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:275848..281049 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
321.549 342.308 333.697 298.886 337.542 262.935 422.352 429.691 436.961 360.17 454.952 445.24 453.757 461.115 425.943 372.061 352.541 373.168 244.64 254.629 395.805 388.178 285.299 309.953 367.139 414.28 273.084 306.411 193.797 202.142
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom
IPR019775WD40_repeat_CS
IPR027525eIF3i
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0003743translation initiation factor activity
Vocabulary: Cellular Component
TermDefinition
GO:0005852eukaryotic translation initiation factor 3 complex
GO:0005737cytoplasm
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005737 cytoplasm
cellular_component GO:0005852 eukaryotic translation initiation factor 3 complex
molecular_function GO:0005515 protein binding
molecular_function GO:0003743 translation initiation factor activity
Blast
BLAST of TCONS_00000985 vs. Swiss-Prot (Human)
Match: EIF3I (Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens GN=EIF3I PE=1 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 3.413e-153
Identity = 208/325 (64.00%), Postives = 256/325 (78.77%), Query Frame = 3
Query:  162 MKPLLLHGHERSITQIKYNKEGDLLFSSAKDNRPTVWYSVNGERLGTYNGHGGAVWCLDPRWDSKYLLTGSADNSAKLWDIETGTELKSLGTGSAVRTCGFSYSGKQFFYSTDKAMGRQCEIYFYDVNNALTGEGNPDPYLVIESKDSKVTAALWGPLDEYILTGHDDGTITKWCSKTGDKIKAVKPHSEKVNDIQKNENEMMFVTASKDNYSKLFDTETMQVLKEYKTERPVNSAAVSPIRDQVVLGGGQEAMEVTTTSARVGKFDARFFHMIFEEEIGRVKGHFGPINSLAFHPDGKSYSSGGEDGYVRNHVFDKSYYEFDFE 1136
            MKP+LL GHERSITQIKYN+EGDLLF+ AKD    VWYSVNGERLGTY GH GAVWC+D  WD+K++LTGSADNS +LWD ETG +L  L T SAVRTCGF + G    +STDK MG QC + F+D+ +    + N +PY+ I   DSK+T+A+WGPL E I+ GH+ G + ++ +K+G+ +  VK HS ++NDIQ + +  MFVTASKDN +KLFD+ T++  K ++TERPVNSAA+SP  D VVLGGGQEAM+VTTTS R+GKF+ARFFH+ FEEE GRVKGHFGPINS+AFHPDGKSYSSGGEDGYVR H FD  Y+EF+FE
Sbjct:    1 MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNN-EPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFE 324          
The following BLAST results are available for this feature:
BLAST of TCONS_00000985 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
EIF3I3.413e-15364.00Eukaryotic translation initiation factor 3 subunit... [more]
back to top