Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000922 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000922
Unique NameTCONS_00000922
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1887

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000922 ID=TCONS_00000922|Name=TCONS_00000922|organism=Clytia hemisphaerica|type=transcript|length=1887bp
TAGATTTGCTAGTTATAATAACACTAAATGTGAGCGATTCAACTCGAAAT
TCTACGTTCCTGGGACGGAAGCGGTGGATGCATTTACGCAGGATTGGCGT
TTTGAAAACAACCTTTGGGTTCCTCCGGCTAATTTAATCACCCGGGTGCT
GAGAACTATCATATCTACGCATGGTATTAGAGGGGTTTTGATAATTCCGT
ATTGGCGTTCCGCTCCATTTTGGTCACTGCTTCAAAACGGAccgatattt
tcaagttttgttgTCGATCATATGGTTTTCAAAGATACTGCTGGTATCCT
GAAGTTGGGCAACTACAAGTATTCCCTTCTCGGTTCTCCTCATTATCGTG
GGAGTATTGTGgcatttttgataaaaagttgAGTTTTGGGTTCTGGGCCT
TATTGGATAAGCTGTCCCACCTTCCCAAGTACTTTCGCCCAGGTGGGCAG
GGTTAGCCTCAGAGGTAACCCATTATTCATTAGATTTTTGGACCTAGATG
GGGTCCTCCTATGCTCAACCGGGTTGAGAGAAATAGAAAGTGTAACGGGG
TTACACTGTGTAACTGGATTACACCGTGGCTTGGGCCACTTGCTCAGAAG
GTTTTGTAAGAAAAATTGGCCTTATCAGGTTATTTAACCCAAGCTGACTA
ATTCTGCATTTTTAGGATCCAGCTCGCTTCAAATCGTTAACCAGGTACAG
GATGACCACCTGAAGGAAGTAGCACACGGTTTACAAGACGTGCTGTCGAA
ATCAAGAGCGAATAACACGATAAAGAAATATGCTACCTACTTCAAGCGTT
GGTCAAATTGGAGTGCAAAGTTCGATGAAGTTGTTGAATTCCCTGCCAAA
GACGTACACGTGGTGCTGTTTTTCGTCAGCCTCATACAGTAGGGAATATC
ATTCTCAGTGATCGAAAGCTGCTTTTACGCAATCAAACACACTCATAATG
TCAATAACCAACCTGACCCAACAGATTCAGTATTGGCCAGTTGTGCCTTA
GAGGCGTACGTACTTGTTCTAAGCCAGTGACCAAGAAGCTTCCAATCACA
CCTGAACACATCAAACGAGTGTACGAACCCATTATCGAGGAGGGTAAGAT
GTCTTTGCTATCCTTGAGGGATTTTTCATTGATATTGTTATGTTTTTGTG
GATTTCTGAGGTTCGAGGAAGCGGCTAACATCACTCTTGGGGGCGTAGTA
TTCAACCAAATGTACATGAAAATATTCATTGAAGAATCAAAAACTGATCA
ATATAGGATTGGAGCCTGGGTATTCATTGCCAAGCTAGACTCCCAACTTT
TCCCCATCGACTTTATCAGAAATTATATTAATAGGGCTGAGATCGTTAAC
GATGATGAGTTTTTGTTCAGGGGAATgtctttctttaaaactttgaatga
CCACAAGCTGAAATGTCGAAATAAGCCTACTTCTTGTTCTACTGCAAGAT
CAGCAGGAAGTCTTGTGAAACGAATCGGGGTCAATGAAAAGCTATTTGGG
ACCCACAGCATGCGTCGTGGAGGAGCCACATGTGCCGCAAACAACGGGGT
AAAGGATCATCTTTTCCAGAAACACGGTAGATGGAAATCTGTCAGTGCTA
AAGATGGCTATGTGGATGATAATCTGAAACAACTGATGTCTGTTTCTTTG
GGGCTAGGCCTCTAAAAGTTTTATAGTATATGATGATTATTTAGAGGATT
TGATGTCTAATTCTGTGAGGCTAGGCCTCTGATgttatttcttatatttt
tcaatcgcgTTCTTCTGTTACAACCATTTACAGGGCTTTCTAGACAACCC
ACTAACGTGATAACNTATAGATCGCGTTCTTCTGCTACAACCATTTACAG
GGCTTTCTAGACGACCCACTAACGTGATAAGAAGAGA
Run BLAST on NCBI

protein sequence of TCONS_00000922-protein

>TCONS_00000922-protein ID=TCONS_00000922-protein|Name=TCONS_00000922-protein|organism=Clytia hemisphaerica|type=polypeptide|length=188bp
MSLLSLRDFSLILLCFCGFLRFEEAANITLGGVVFNQMYMKIFIEESKTD
QYRIGAWVFIAKLDSQLFPIDFIRNYINRAEIVNDDEFLFRGMSFFKTLN
DHKLKCRNKPTSCSTARSAGSLVKRIGVNEKLFGTHSMRRGGATCAANNG
VKDHLFQKHGRWKSVSAKDGYVDDNLKQLMSVSLGLGL
Run BLAST on NCBI

transcript from alignment at sc0000005:627037..628923

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000922 ID=TCONS_00000922|Name=TCONS_00000922|organism=Clytia hemisphaerica|type=transcript|length=1887bp|location=Sequence derived from alignment at sc0000005:627037..628923 (Clytia hemisphaerica)
TCTCTTCTTATCACGTTAGTGGGTCGTCTAGAAAGCCCTGTAAATGGTTG TAGCAGAAGAACGCGATCTATANGTTATCACGTTAGTGGGTTGTCTAGAA AGCCCTGTAAATGGTTGTAACAGAAGAAcgcgattgaaaaatataagaaa taacATCAGAGGCCTAGCCTCACAGAATTAGACATCAAATCCTCTAAATA ATCATCATATACTATAAAACTTTTAGAGGCCTAGCCCCAAAGAAACAGAC ATCAGTTGTTTCAGATTATCATCCACATAGCCATCTTTAGCACTGACAGA TTTCCATCTACCGTGTTTCTGGAAAAGATGATCCTTTACCCCGTTGTTTG CGGCACATGTGGCTCCTCCACGACGCATGCTGTGGGTCCCAAATAGCTTT TCATTGACCCCGATTCGTTTCACAAGACTTCCTGCTGATCTTGCAGTAGA ACAAGAAGTAGGCTTATTTCGACATTTCAGCTTGTGGtcattcaaagttt taaagaaagacATTCCCCTGAACAAAAACTCATCATCGTTAACGATCTCA GCCCTATTAATATAATTTCTGATAAAGTCGATGGGGAAAAGTTGGGAGTC TAGCTTGGCAATGAATACCCAGGCTCCAATCCTATATTGATCAGTTTTTG ATTCTTCAATGAATATTTTCATGTACATTTGGTTGAATACTACGCCCCCA AGAGTGATGTTAGCCGCTTCCTCGAACCTCAGAAATCCACAAAAACATAA CAATATCAATGAAAAATCCCTCAAGGATAGCAAAGACATCTTACCCTCCT CGATAATGGGTTCGTACACTCGTTTGATGTGTTCAGGTGTGATTGGAAGC TTCTTGGTCACTGGCTTAGAACAAGTACGTACGCCTCTAAGGCACAACTG GCCAATACTGAATCTGTTGGGTCAGGTTGGTTATTGACATTATGAGTGTG TTTGATTGCGTAAAAGCAGCTTTCGATCACTGAGAATGATATTCCCTACT GTATGAGGCTGACGAAAAACAGCACCACGTGTACGTCTTTGGCAGGGAAT TCAACAACTTCATCGAACTTTGCACTCCAATTTGACCAACGCTTGAAGTA GGTAGCATATTTCTTTATCGTGTTATTCGCTCTTGATTTCGACAGCACGT CTTGTAAACCGTGTGCTACTTCCTTCAGGTGGTCATCCTGTACCTGGTTA ACGATTTGAAGCGAGCTGGATCCTAAAAATGCAGAATTAGTCAGCTTGGG TTAAATAACCTGATAAGGCCAATTTTTCTTACAAAACCTTCTGAGCAAGT GGCCCAAGCCACGGTGTAATCCAGTTACACAGTGTAACCCCGTTACACTT TCTATTTCTCTCAACCCGGTTGAGCATAGGAGGACCCCATCTAGGTCCAA AAATCTAATGAATAATGGGTTACCTCTGAGGCTAACCCTGCCCACCTGGG CGAAAGTACTTGGGAAGGTGGGACAGCTTATCCAATAAGGCCCAGAACCC AAAACTcaactttttatcaaaaatgcCACAATACTCCCACGATAATGAGG AGAACCGAGAAGGGAATACTTGTAGTTGCCCAACTTCAGGATACCAGCAG TATCTTTGAAAACCATATGATCGAcaacaaaacttgaaaatatcggTCCG TTTTGAAGCAGTGACCAAAATGGAGCGGAACGCCAATACGGAATTATCAA AACCCCTCTAATACCATGCGTAGATATGATAGTTCTCAGCACCCGGGTGA TTAAATTAGCCGGAGGAACCCAAAGGTTGTTTTCAAAACGCCAATCCTGC GTAAATGCATCCACCGCTTCCGTCCCAGGAACGTAGAATTTCGAGTTGAA TCGCTCACATTTAGTGTTATTATAACTAGCAAATCTA

Coding sequence (CDS) from alignment at sc0000005:627037..628923

>TCONS_00000922 ID=TCONS_00000922|Name=TCONS_00000922|organism=Clytia hemisphaerica|type=CDS|length=567bp|location=Sequence derived from alignment at sc0000005:627037..628923 (Clytia hemisphaerica)
TTAGAGGCCTAGCCCCAAAGAAACAGACATCAGTTGTTTCAGATTATCAT
CCACATAGCCATCTTTAGCACTGACAGATTTCCATCTACCGTGTTTCTGG
AAAAGATGATCCTTTACCCCGTTGTTTGCGGCACATGTGGCTCCTCCACG
ACGCATGCTGTGGGTCCCAAATAGCTTTTCATTGACCCCGATTCGTTTCA
CAAGACTTCCTGCTGATCTTGCAGTAGAACAAGAAGTAGGCTTATTTCGA
CATTTCAGCTTGTGGtcattcaaagttttaaagaaagacATTCCCCTGAA
CAAAAACTCATCATCGTTAACGATCTCAGCCCTATTAATATAATTTCTGA
TAAAGTCGATGGGGAAAAGTTGGGAGTCTAGCTTGGCAATGAATACCCAG
GCTCCAATCCTATATTGATCAGTTTTTGATTCTTCAATGAATATTTTCAT
GTACATTTGGTTGAATACTACGCCCCCAAGAGTGATGTTAGCCGCTTCCT
CGAACCTCAGAAATCCACAAAAACATAACAATATCAATGAAAAATCCCTC
AAGGATAGCAAAGACAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000547XLOC_000547Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000922-proteinTCONS_00000922-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000922-exon-sc0000005-1491911889:627037..628923TCONS_00000922-exon-sc0000005-1491911889:627037..628923Clytia hemisphaericaexon
TCONS_00000922-exon-sc0000005-1510915933:627037..628923TCONS_00000922-exon-sc0000005-1510915933:627037..628923Clytia hemisphaericaexon
TCONS_00000922-exon-sc0000005-1575043694:627037..628923TCONS_00000922-exon-sc0000005-1575043694:627037..628923Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:627037..628923 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
2.863 2.53852 0.651815 0.627449 0.0330351 0.080743 0.0698934 0.157146 0.0257051 0.214941 0.0225042 0.176375 0.0783754 0.150308 0.070068 0.0748006 0.283012 0.371354 0.313818 0.271482 0.221648 0.206635 1.64592 1.70214 0.366405 0.537919 0.0464959 0 0.455268 0.806677
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013762Integrase-like_cat
IPR002104Integrase_catalytic
IPR011010DNA_brk_join_enz
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006310DNA recombination
GO:0015074DNA integration
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015074 DNA integration
biological_process GO:0006310 DNA recombination
molecular_function GO:0003677 DNA binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000922 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top