Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000747 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000747
Unique NameTCONS_00000747
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2238

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000747 ID=TCONS_00000747|Name=TCONS_00000747|organism=Clytia hemisphaerica|type=transcript|length=2238bp
gtattttaatgaccagccgggcctttcatttgagggctatgcatgttagc
ctccactgatgcaagttaccctttttcacggtatgattgataaacttggt
ggagttatcaaaacaaatttgtcattaaaaagattttaacaGGTAACTGA
CAAAACTGATAATTCTGAGAAACAAGAAAAACTTAAACGTGACCCTCCTG
CGGCAAGGGTGAGATAATAAAATGGAAAAGCAATGCGTTCCTGATAAAGA
GCTACCTGAATGGGCAAAGCCAAAGCCCAAGGGTGCACCACCATCTCAGG
TGAAGAAGAATTTGCTGTCGTCAGCAATCCAATCAGCTTTCATCATTGGC
TCCTTTCTATTGGCTTTTGCATCCTTGAGAAATTCTTTAACATGGAAATT
TGAAGAACTTTGGGGAggctcaaaaacattttatcaAGATGTTTGGACAT
ACTTTTATCGtgatattttcaaaggaaatcgATTGCTTCTCTCAACGTTT
GGTGTACATGCGATCATTTTCGCTTGGTTTTGGCTTAACTCaatcttctt
cttcattctGGATGTTTTCGAACCGAAGTTCTTCATGAAATACAAAATCC
AAGAAGATAAGAAACCTACACGTGCTCAAATGCTAAAAGCAATCCGAGTT
GTCATGTTCAATCAATTGGTCGGATTGATTTTCAGTTTTCCAATCTATTA
TTTTGTCGCAAAACGTGGTATGACTTATGATGCTGAAGATTTACCAACTT
TCCAATGGTTTTTGGTTGAaatgtttgtttatatttgggTTGAAGAATTT
GGATTCTATTATTCGCATCGCCTTGGACACCACCCACGCCTTTATAAACA
CATCCACAAGATTCACCACGAATGGACTGCACCAATCTCAATCATTGGAA
TCTACAATCACTGGCTAGAACATATCGTTTCCAACATCTTGCCCGTCACT
CTCGGCCCCCTGATCATGGGCTCTCATATGGGGTCGCTGGTGATGTGGAC
CTGCATTGCGATCACTTCAACACAAATTTCACACGGGGGTTACCATTTAC
CGTTATTGCCTTCACCCGAAGCACACGATTATCACCATTTGAAgtTCATC
AATAATTTTGGTGTTCTTGGCGTTCTTGACCGTTTGCACGGTACCGACAG
TATGTTTGTCAAGTCAAATGCGTACGACCGCCATATCCTCTTACTTGGAT
TGGAACCGGCAAAAGCGCTTTTCCCTGATGATAAGAAAAAAGGATGcgag
aaaaaaacgaattaaaaaatgatataaacTTTTGCGTTTTATACCCtaaa
aatccacaagtaatgttTGGAATATGTtattcaaaaatcaaacaatATAT
GCATCGTATACcgtaaaaattgtattttaagatTGTTATGTTTTATGCGT
ATAATGTACctattatgtttttattttttatctgtaTGTAATATTTCTAA
AGCTTTCTTTTATAATcatctctctctaattcgaacctctactattcaaa
ttcaaaaatattgccCCTGAGGGGGCTTAGCTTAAAAGAagtactctctg
taattcgaatctttcttcaACTCGAAGAAGATTTTcggtcccttgaaaat
cgaattaaaaaGAGAGTACTGTACTCATATTTTGGTTGGCTTTATTCTTC
ATCGATTCTTTCATAAAGCTGTTCTGAAAAGTTAAAGAtggattttttag
aaattgtgGGTCACTAGAATCTACTAGAGTTAGAGAAACCAGCTCTAAAT
GAGAAAACATTTTGGTGAAAATATCATAATTCAGAGCgagaaattttgtg
aaatttagaAGCCCGTTAGAAttacttttctttttggttttcGCAAAAAT
TCGATACTCTTGCAGAGGTAATTATGGAAACAAACCAAACTTACCGTCCG
CATACACCCAGCAGTCAATTTTTCCCGAAACCCCTTATTTACTATTTTTG
CAACCTTCGTTTCATATTATCAATGTAGAATGAAATTCTTTTGCTTTTCA
CGCCTCTTAACTTTAGCCTAGTACTAGATTGAGTATTTGATATATGCTCA
CTATGTATGTACTTATCTTTAACTAATAGTTTGCAGAATAAAATAATATG
TTTAGTTTTGTTAGCAAAACTAGTTTGAGTTTTTATTGATTAATGCCCCC
TACGCCCCCAGCGGAGTTTCCGATCACATCATCACACAAAAAGATTGGAC
GTCATCATAcaaatcttttttcttcatcttgCGCCGTA
Run BLAST on NCBI

protein sequence of TCONS_00000747-protein

>TCONS_00000747-protein ID=TCONS_00000747-protein|Name=TCONS_00000747-protein|organism=Clytia hemisphaerica|type=polypeptide|length=347bp
MEKQCVPDKELPEWAKPKPKGAPPSQVKKNLLSSAIQSAFIIGSFLLAFA
SLRNSLTWKFEELWGGSKTFYQDVWTYFYRDIFKGNRLLLSTFGVHAIIF
AWFWLNSIFFFILDVFEPKFFMKYKIQEDKKPTRAQMLKAIRVVMFNQLV
GLIFSFPIYYFVAKRGMTYDAEDLPTFQWFLVEMFVYIWVEEFGFYYSHR
LGHHPRLYKHIHKIHHEWTAPISIIGIYNHWLEHIVSNILPVTLGPLIMG
SHMGSLVMWTCIAITSTQISHGGYHLPLLPSPEAHDYHHLKFINNFGVLG
VLDRLHGTDSMFVKSNAYDRHILLLGLEPAKALFPDDKKKGCEKKTN
Run BLAST on NCBI

transcript from alignment at sc0000005:1362307..1368218+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000747 ID=TCONS_00000747|Name=TCONS_00000747|organism=Clytia hemisphaerica|type=transcript|length=5912bp|location=Sequence derived from alignment at sc0000005:1362307..1368218+ (Clytia hemisphaerica)
gtattttaatgaccagccgggcctttcatttgagggctatgcatgttagc ctccactgatgcaagttaccctttttcacggtatgattgataaacttggt ggagttatcaaaacaaatttgtcattaaaaagattttaacagtaagtgaa aatacagaccagatatcaaccagtcccttGTTAccaccaatcgtcccaag ttagagcagttgacggttcCTCTCTTACAACAGTCTTAACTTGACATCTT GAGGTTGTAAacattttatttaataaaaattttctggaCTTGCACATGGT TTTTTCTtgctgtttgtttttattttgttggtgAAATCAGGTGAAATATA GTTATTTAAAAGACTGTtgttgacatccctcatctGATTCTGACACCGTT TTTAAGAGATTGTAAAATAAGAAGATCCTAATAAATGCACATATACTGCA AAAAATTCCAACTTTTCTAGATAAAATATTAGAGgggtttttgtggtaaa aaatgccttttatatttattttgcaCGAATTTATGCTGAGTTTGGGGAGA TTCCtaattttcattcaatctttaaagattttgtgcTTACCTGGCTGTTC AAAAAAAGTCTTTCTCATTTTCTAAAGTTCTCATAttaaaaattttagtt tatataCACAGTGACTTATTATATACAAATGAAAAAGTTGTTTAAAGGGG AATGTAATTCATTAAACCCTTACTTAGGTTcaatttcaattctgtttttt AGGGTAACTGACAAAACTGATAATTCTGAGAAACAAGAAAAACTTAAACG TGACCCTCCTGCGGCAAGGGTGAGATAATAAAATGGAAAAGCAATGCGTT CCTGATAAAGAGCTACCTGAATGGGCAAAGCCAAAGCCCAAGGGTGCACC ACCATCTCAGGTTACACCTTTAATTTTGCATCTGTGTTATTTTCTGTGAG aactttttttaattacaaattgattttcacaaatataaaataaaaaaggt aaTTGTGTAAGCTTGCCAATCATGTCTTTGTATTCATGTCAATTTGTTGT CAGTTTCGGCTATACAATGATTTTGTAATGTTTACTGTACTCAACTTTCT ATTTATTGACAATCTAGGTGAAGAAGAATTTGCTGTCGTCAGCAATCCAA TCAGCTTTCATCATTGGCTCCTTTCTATTGGCTTTTGCATCCTTGAGAAA TTCTTTAACATGGTATATTtcattttaatcaaaataattcTTCTGAACGA TATTTTGCAGTAAAACATTTTTAACTATACTTACAGCtgtaatatttttc aataatgGTGAGACTTTGCTGATATCCTTTATGACCCCTTGCTCCTACAT AAATTTATGTTATATATTTTCCACGAGAGAATCTTTTGGCACAGGTActg caaaattttatcaatGTTGATCCTGGATGGGGAAATGATCATAATGATAT TATCCAAGCGAACGTAGATCTTTAAACACATACCATAAGAAGGCTTTAAA TTTGTCTTTTAGCTTTTAAGAGAGCTTTAAAAGATTTTACTTTGTGTACA GAAGTAGCGAATATTCTTCTTGATAGGTAAGAttcttcatttttgtaatt ttactatttttgtattttcattacaGGAAATTTGAAGAACTTTGGGGAgg ctcaaaaacattttatcaAGATGTTTGGACATACTTTTATCGtgatattt tcaaaggaaatcgATTGCTTCTCTCAACGTTTGGTAAGTTTAATAATAAA TAAGAGAAGAATAGAAAACTATCCAAATGTTTTCGAAAAGTTTTACGTTC tagaattttgaaagaatgcTTTTTTTAATACAATTCATTGAACATCAGGA AGTGTTGTTTTCCTTCATAAAAGGTCAAGTTATAAATTTATAAACGAGGT ATCATGAAGGAGCAGTTTAATTGCAAGATAATCAATAAGTTATACCACCT ACTGTTCAATAAACAGAAAGGTCTTTAAATGCTAATTGCACCATTTCGAC ACTTTGCTATGGAGATAAActattaaaaattaaacaagcCTTTTCTTGTA TATTCACTAGGCGTAATAATTAATGCCGTTTTCGTTAGCTTTAACGCGGA AGGCAATTGACTGATTCCCATATGTTATGTTTTATTCAGGAAGTTCTTCA AAGTGTACACTTTGAAGTTAAAAATGAATTCTCAAATTTGTCTTTTAACT CTCAGAAAACGTTGATTCATTATAGCATAGGAAAAAATATCAGCTAgaca actttcaaaactacaCATTATTTTTCCGACAATACCGGATGTTTCATGTT CACAATACGTAAAACTTTGACATCACATAATAAGATAATGTTATCGTTAT CGATCTCCTTGCTGTTTTGCccgaaaataacaaaaacatgaCATTATCAa tcaggggataaaaatataaaaatatacaaatataCAGCCGAGCATCAAAA TGTCTcgtgcttataaaaagagtGTATTCAGACAACACCACAACATATAC ATATTTTAGAATCTGGTCTTGCTTatcattctagctcattttatgaaaat tttgctttgatatTGTACCATCATGCTGATTGCGTCAAGGGCTATTATCT GTCATaattagattatctaaaaagcttaattctttacgagatagtgaaaa ttttttggtaaatttaaggGCTCGAGTTTTAGCAagctggttgcttataa aaaatatacagCTAACATTGTCATTTCCATATTCCTATTTTAATTGCACA GGTGTACATGCGATCATTTTCGCTTGGTTTTGGCTTAACTCaatcttctt cttcattctGGATGTTTTCGAACCGAAGTTCTTCATGAAATACAAAATCC AAGAAGATAAGAAACCTACACGTGCTCAAATGCTAAAAGCAATCCGAGTT GTCATGTTCAATCAATTGGTCGGATTGATTTTCAGTTTTCCAATCTATTA TTTTGTCGCAAAACGTGGTATGACTTATGATGCTGAAGATTTACCAACTT TCCAATGGTTTTTGGTTGAaatgtttgtttatatttgggTTGAAGAATTT GGATTCTATTATTCGCATCGGTGAGTAGTTTTTCGTTTAAGGAGCCCCCC CCCAGTGGCatccctaatcacgccatcacgcaaaaaaaatttctccatca cgcatcacgaaaatcgctaaaatttgtcatcaNCCTACACGTGCTCAAAT GCTAAAAGCAATCCGAGTTGTCATGTTCAATCAATTGGTCGGATTGATTT TCAGTTTTCCAATCTATTATTTTGTCGCAAAACGTGGTATGACTTATGAT GCTGAAGATTTACCAACTTTCCAATGGTTTTTGGTTGAaatgtttgttta tatttgggTTGAAGAATTTGGATTCTATTATTCGCATCGGTGAGTAGTTT TTCGTTTAAGgaggcccccccccagcggtatccctaatcacgccatcacg caacacgaaaatcgctaaaatttgtcatcacgcaaaaaatagcgaaaaat agcccaaatcacgcatcacgcctcaaatatttgccctatcacgcatcacg caaaaatcttgatcacgtcatcgcgccaaaaaaaatctctagtcacgcca tcacgcaagaaaaaagttccaatcacgccatcacgcaaaccgctgggttT AAGAGATGTATCAAGTATGGATAACATTCTCCAGATGCAAGAAATAAGAA CTCGTTGTTATCATTTTAACAAAGCTTGTTGTTAGATgaaattttaactt tattttttttaatctcgCTAAATTCTCTTACCTTTCTAAAAACTAACATT TACTAACATTTACCCCACTAGTGCTAAATTTATGAAGAAATCCCATGGAA ATGGCAGTTCTTTTCATCAATTTCCCAAATTAAAGGCTTGTAAGGCTAGG CACTACATCTTTCTCCTCTCGATTTATGATGGTTTGAATTTAAGACGAGT TGGACATTCTTACCTTATTTTGTAGCCTTGGACACCACCCACGCCTTTAT AAACACATCCACAAGATTCACCACGAATGGACTGCACCAATCTCAATCAT TGGAATCTACAATCACTGGCTAGAACATATCGTTTCCAACATCTTGCCCG TCACTCTCGGCCCCCTGATCATGGGCTCTCATATGGGGTCGCTGGTGATG TGGACCTGCATTGCGATCACTTCAACACAAATTTCACACGGGGGTTACCA TTTACCGTTATTGCCTTCACCCGAAGCACACGATTATCACCATTTGAAGT gagttaaaagaaaaaattttttttaacaaaaacaacGCCCAAACATAAGT TTTGTATATTTAAAATCTAGTCCCTTACTGTATTCTTCATCGATATGTCA TTTTAGCCAATTACTAAACATGTAGGGATTTTTCCAAGCACCAAGCAATG CCTCCGTTTTTactttcaaattgaatttttaacaaagTCTAACGGGGGCA TTTGGGTGCTTGGAAAAAACACTGACATGATATTTGGTCCTGTCGTGGAG TTTCTTTATGTTAGCTACCCTGCTCTATTTCCTTTTCCATTGTCAGAGAT GAATAATATAGGAAGGGTTGGGTTGAATTGCTGATTTAAGCCTTGGCTAG AAAATTTTATGAACAACCAGGTATTCCGAACTTTCTGTCTCTAATAGTCA ATAACAAATGAATAATAACCGCTTGTTGTATCTTGTTCAGTAAAGCAGCA TGCTCGAACTTCAATGCAAATAGACagttttctttttatcttgtccgtaa taatttcttttttttaggtTCATCAATAATTTTGGTGTTCTTGGCGTTCT TGACCGTTTGCACGGTACCGACAGTATGTTTGTCAAGTCAAATGCGTACG ACCGCCATATCCTCTTACTTGGATTGGAACCGGCAAAAGCGCTTTTCCCT GATGATAAGAAAAAAGGATGcgagaaaaaaacgaattaaaaaatgatata aacTTTTGCGTTTTATACCCtaaaaatccacaagtaatgttTGGAATATG TtattcaaaaatcaaacaatATATGCATCGTATACcgtaaaaattgtatt ttaagatTGTTATGTTTTATGCGTATAATGTACctattatgtttttattt tttatctgtaTGTAATATTTCTAAAGCTTTCTTTTATAATcatctctctc taattcgaacctctactattcaaattcaaaaatattgccCCTGAGGGGGC TTAGCTTAAAAGAagtactctctgtaattcgaatctttcttcaACTCGAA GAAGATTTTcggtcccttgaaaatcgaattaaaaaGAGAGTACTGTACTC ATATTTTGGTTGGCTTTATTCTTCATCGATTCTTTCATAAAGCTGTTCTG AAAAGTTAAAGAtggattttttagaaattgtgGGTCACTAGAATCTACTA GAGTTAGAGAAACCAGCTCTAAATGAGAAAACATTTTGGTGAAAATATCA TAATTCAGAGCgagaaattttgtgaaatttagaAGCCCGTTAGAAttact tttctttttggttttcGCAAAAATTCGATACTCTTGCAGAGGTAATTATG GAAACAAACCAAACTTACCGTCCGCATACACCCAGCAGTCAATTTTTCCC GAAACCCCTTATTTACTATTTTTGCAACCTTCGTTTCATATTATCAATGT AGAATGAAATTCTTTTGCTTTTCACGCCTCTTAACTTTAGCCTAGTACTA GATTGAGTATTTGATATATGCTCACTATGTATGTACTTATCTTTAACTAA TAGTTTGCAGAATAAAATAATATGTTTAGTTTTGTTAGCAAAACTAGTTT GAGTTTTTATTGATTAATGCCCCCTACGCCCCCAGCGGAGTTTCCGATCA CATCATCACACAAAAAGATTGGACGTCATCATAcaaatcttttttcttca tcttgCGCCGTA

Coding sequence (CDS) from alignment at sc0000005:1362307..1368218+

>TCONS_00000747 ID=TCONS_00000747|Name=TCONS_00000747|organism=Clytia hemisphaerica|type=CDS|length=6264bp|location=Sequence derived from alignment at sc0000005:1362307..1368218+ (Clytia hemisphaerica)
ATGGAAAAGCAATGCGTTCCTGATAAAGAGCTACCTGAATGGGCAAAGCC
AAAGCCCAAGGGTGCACCACCATCTCAGGTGAAGAAGAATTTGCTGTCGT
CAGCAATCCAATCAGCTTTCATCATTGGCTCCTTTCTATTGGCTTTTGCA
TCCTTGAGAAATTCTTTAACATGGAAATTTGAAGAACTTTGGGGAggctc
aaaaacattttatcaAGATGTTTGGACATACTTTTATCGtgatattttca
aaggaaatcgATTGCTTCTCTCAACGTTTGGTGTACATGCGATCATTTTC
GCTTGGTTTTGGCTTAACTCaatcttcttcttcattctGGATGTTTTCGA
ACCGAAGTTCTTCATGAAATACAAAATCCAAGAAGATAAGAAACCTACAC
GTGCTCAAATGCTAAAAGCAATCCGAGTTGTCATGTTCAATCAATTGGTC
GGATTGATTTTCAGTTTTCCAATCTATTATTTTGTCGCAAAACGTGGTAT
GACTTATGATGCTGAAGATTTACCAACTTTCCAATGGTTTTTGGTTGAaa
tgtttgtttatatttgggTTGAAGAATTTGGATTCTATTATTCGCATCGC
CTTGGACACCACCCACGCCTTTATAAACACATCCACAAGATTCACCACGA
ATGGACTGCACCAATCTCAATCATTGGAATCTACAATCACTGGCTAGAAC
ATATCGTTTCCAACATCTTGCCCGTCACTCTCGGCCCCCTGATCATGGGC
TCTCATATGGGGTCGCTGGTGATGTGGACCTGCATTGCGATCACTTCAAC
ACAAATTTCACACGGGGGTTACCATTTACCGTTATTGCCTTCACCCGAAG
CACACGATTATCACCATTTGAAgtTCATCAATAATTTTGGTGTTCTTGGC
GTTCTTGACCGTTTGCACGGTACCGACAGTATGTTTGTCAAGTCAAATGC
GTACGACCGCCATATCCTCTTACTTGGATTGGAACCGGCAAAAGCGCTTT
TCCCTGATGATAAGAAAAAAGGATGcgagaaaaaaacgaattaaATGGAA
AAGCAATGCGTTCCTGATAAAGAGCTACCTGAATGGGCAAAGCCAAAGCC
CAAGGGTGCACCACCATCTCAGGTGAAGAAGAATTTGCTGTCGTCAGCAA
TCCAATCAGCTTTCATCATTGGCTCCTTTCTATTGGCTTTTGCATCCTTG
AGAAATTCTTTAACATGGAAATTTGAAGAACTTTGGGGAggctcaaaaac
attttatcaAGATGTTTGGACATACTTTTATCGtgatattttcaaaggaa
atcgATTGCTTCTCTCAACGTTTGGTGTACATGCGATCATTTTCGCTTGG
TTTTGGCTTAACTCaatcttcttcttcattctGGATGTTTTCGAACCGAA
GTTCTTCATGAAATACAAAATCCAAGAAGATAAGAAACCTACACGTGCTC
AAATGCTAAAAGCAATCCGAGTTGTCATGTTCAATCAATTGGTCGGATTG
ATTTTCAGTTTTCCAATCTATTATTTTGTCGCAAAACGTGGTATGACTTA
TGATGCTGAAGATTTACCAACTTTCCAATGGTTTTTGGTTGAaatgtttg
tttatatttgggTTGAAGAATTTGGATTCTATTATTCGCATCGCCTTGGA
CACCACCCACGCCTTTATAAACACATCCACAAGATTCACCACGAATGGAC
TGCACCAATCTCAATCATTGGAATCTACAATCACTGGCTAGAACATATCG
TTTCCAACATCTTGCCCGTCACTCTCGGCCCCCTGATCATGGGCTCTCAT
ATGGGGTCGCTGGTGATGTGGACCTGCATTGCGATCACTTCAACACAAAT
TTCACACGGGGGTTACCATTTACCGTTATTGCCTTCACCCGAAGCACACG
ATTATCACCATTTGAAgtTCATCAATAATTTTGGTGTTCTTGGCGTTCTT
GACCGTTTGCACGGTACCGACAGTATGTTTGTCAAGTCAAATGCGTACGA
CCGCCATATCCTCTTACTTGGATTGGAACCGGCAAAAGCGCTTTTCCCTG
ATGATAAGAAAAAAGGATGcgagaaaaaaacgaattaaATGGAAAAGCAA
TGCGTTCCTGATAAAGAGCTACCTGAATGGGCAAAGCCAAAGCCCAAGGG
TGCACCACCATCTCAGGTGAAGAAGAATTTGCTGTCGTCAGCAATCCAAT
CAGCTTTCATCATTGGCTCCTTTCTATTGGCTTTTGCATCCTTGAGAAAT
TCTTTAACATGGAAATTTGAAGAACTTTGGGGAggctcaaaaacatttta
tcaAGATGTTTGGACATACTTTTATCGtgatattttcaaaggaaatcgAT
TGCTTCTCTCAACGTTTGGTGTACATGCGATCATTTTCGCTTGGTTTTGG
CTTAACTCaatcttcttcttcattctGGATGTTTTCGAACCGAAGTTCTT
CATGAAATACAAAATCCAAGAAGATAAGAAACCTACACGTGCTCAAATGC
TAAAAGCAATCCGAGTTGTCATGTTCAATCAATTGGTCGGATTGATTTTC
AGTTTTCCAATCTATTATTTTGTCGCAAAACGTGGTATGACTTATGATGC
TGAAGATTTACCAACTTTCCAATGGTTTTTGGTTGAaatgtttgtttata
tttgggTTGAAGAATTTGGATTCTATTATTCGCATCGCCTTGGACACCAC
CCACGCCTTTATAAACACATCCACAAGATTCACCACGAATGGACTGCACC
AATCTCAATCATTGGAATCTACAATCACTGGCTAGAACATATCGTTTCCA
ACATCTTGCCCGTCACTCTCGGCCCCCTGATCATGGGCTCTCATATGGGG
TCGCTGGTGATGTGGACCTGCATTGCGATCACTTCAACACAAATTTCACA
CGGGGGTTACCATTTACCGTTATTGCCTTCACCCGAAGCACACGATTATC
ACCATTTGAAgtTCATCAATAATTTTGGTGTTCTTGGCGTTCTTGACCGT
TTGCACGGTACCGACAGTATGTTTGTCAAGTCAAATGCGTACGACCGCCA
TATCCTCTTACTTGGATTGGAACCGGCAAAAGCGCTTTTCCCTGATGATA
AGAAAAAAGGATGcgagaaaaaaacgaattaaATGGAAAAGCAATGCGTT
CCTGATAAAGAGCTACCTGAATGGGCAAAGCCAAAGCCCAAGGGTGCACC
ACCATCTCAGGTGAAGAAGAATTTGCTGTCGTCAGCAATCCAATCAGCTT
TCATCATTGGCTCCTTTCTATTGGCTTTTGCATCCTTGAGAAATTCTTTA
ACATGGAAATTTGAAGAACTTTGGGGAggctcaaaaacattttatcaAGA
TGTTTGGACATACTTTTATCGtgatattttcaaaggaaatcgATTGCTTC
TCTCAACGTTTGGTGTACATGCGATCATTTTCGCTTGGTTTTGGCTTAAC
TCaatcttcttcttcattctGGATGTTTTCGAACCGAAGTTCTTCATGAA
ATACAAAATCCAAGAAGATAAGAAACCTACACGTGCTCAAATGCTAAAAG
CAATCCGAGTTGTCATGTTCAATCAATTGGTCGGATTGATTTTCAGTTTT
CCAATCTATTATTTTGTCGCAAAACGTGGTATGACTTATGATGCTGAAGA
TTTACCAACTTTCCAATGGTTTTTGGTTGAaatgtttgtttatatttggg
TTGAAGAATTTGGATTCTATTATTCGCATCGCCTTGGACACCACCCACGC
CTTTATAAACACATCCACAAGATTCACCACGAATGGACTGCACCAATCTC
AATCATTGGAATCTACAATCACTGGCTAGAACATATCGTTTCCAACATCT
TGCCCGTCACTCTCGGCCCCCTGATCATGGGCTCTCATATGGGGTCGCTG
GTGATGTGGACCTGCATTGCGATCACTTCAACACAAATTTCACACGGGGG
TTACCATTTACCGTTATTGCCTTCACCCGAAGCACACGATTATCACCATT
TGAAgtTCATCAATAATTTTGGTGTTCTTGGCGTTCTTGACCGTTTGCAC
GGTACCGACAGTATGTTTGTCAAGTCAAATGCGTACGACCGCCATATCCT
CTTACTTGGATTGGAACCGGCAAAAGCGCTTTTCCCTGATGATAAGAAAA
AAGGATGcgagaaaaaaacgaattaaATGGAAAAGCAATGCGTTCCTGAT
AAAGAGCTACCTGAATGGGCAAAGCCAAAGCCCAAGGGTGCACCACCATC
TCAGGTGAAGAAGAATTTGCTGTCGTCAGCAATCCAATCAGCTTTCATCA
TTGGCTCCTTTCTATTGGCTTTTGCATCCTTGAGAAATTCTTTAACATGG
AAATTTGAAGAACTTTGGGGAggctcaaaaacattttatcaAGATGTTTG
GACATACTTTTATCGtgatattttcaaaggaaatcgATTGCTTCTCTCAA
CGTTTGGTGTACATGCGATCATTTTCGCTTGGTTTTGGCTTAACTCaatc
ttcttcttcattctGGATGTTTTCGAACCGAAGTTCTTCATGAAATACAA
AATCCAAGAAGATAAGAAACCTACACGTGCTCAAATGCTAAAAGCAATCC
GAGTTGTCATGTTCAATCAATTGGTCGGATTGATTTTCAGTTTTCCAATC
TATTATTTTGTCGCAAAACGTGGTATGACTTATGATGCTGAAGATTTACC
AACTTTCCAATGGTTTTTGGTTGAaatgtttgtttatatttgggTTGAAG
AATTTGGATTCTATTATTCGCATCGCCTTGGACACCACCCACGCCTTTAT
AAACACATCCACAAGATTCACCACGAATGGACTGCACCAATCTCAATCAT
TGGAATCTACAATCACTGGCTAGAACATATCGTTTCCAACATCTTGCCCG
TCACTCTCGGCCCCCTGATCATGGGCTCTCATATGGGGTCGCTGGTGATG
TGGACCTGCATTGCGATCACTTCAACACAAATTTCACACGGGGGTTACCA
TTTACCGTTATTGCCTTCACCCGAAGCACACGATTATCACCATTTGAAgt
TCATCAATAATTTTGGTGTTCTTGGCGTTCTTGACCGTTTGCACGGTACC
GACAGTATGTTTGTCAAGTCAAATGCGTACGACCGCCATATCCTCTTACT
TGGATTGGAACCGGCAAAAGCGCTTTTCCCTGATGATAAGAAAAAAGGAT
GcgagaaaaaaacgaattaaATGGAAAAGCAATGCGTTCCTGATAAAGAG
CTACCTGAATGGGCAAAGCCAAAGCCCAAGGGTGCACCACCATCTCAGGT
GAAGAAGAATTTGCTGTCGTCAGCAATCCAATCAGCTTTCATCATTGGCT
CCTTTCTATTGGCTTTTGCATCCTTGAGAAATTCTTTAACATGGAAATTT
GAAGAACTTTGGGGAggctcaaaaacattttatcaAGATGTTTGGACATA
CTTTTATCGtgatattttcaaaggaaatcgATTGCTTCTCTCAACGTTTG
GTGTACATGCGATCATTTTCGCTTGGTTTTGGCTTAACTCaatcttcttc
ttcattctGGATGTTTTCGAACCGAAGTTCTTCATGAAATACAAAATCCA
AGAAGATAAGAAACCTACACGTGCTCAAATGCTAAAAGCAATCCGAGTTG
TCATGTTCAATCAATTGGTCGGATTGATTTTCAGTTTTCCAATCTATTAT
TTTGTCGCAAAACGTGGTATGACTTATGATGCTGAAGATTTACCAACTTT
CCAATGGTTTTTGGTTGAaatgtttgtttatatttgggTTGAAGAATTTG
GATTCTATTATTCGCATCGCCTTGGACACCACCCACGCCTTTATAAACAC
ATCCACAAGATTCACCACGAATGGACTGCACCAATCTCAATCATTGGAAT
CTACAATCACTGGCTAGAACATATCGTTTCCAACATCTTGCCCGTCACTC
TCGGCCCCCTGATCATGGGCTCTCATATGGGGTCGCTGGTGATGTGGACC
TGCATTGCGATCACTTCAACACAAATTTCACACGGGGGTTACCATTTACC
GTTATTGCCTTCACCCGAAGCACACGATTATCACCATTTGAAgtTCATCA
ATAATTTTGGTGTTCTTGGCGTTCTTGACCGTTTGCACGGTACCGACAGT
ATGTTTGTCAAGTCAAATGCGTACGACCGCCATATCCTCTTACTTGGATT
GGAACCGGCAAAAGCGCTTTTCCCTGATGATAAGAAAAAAGGATGcgaga
aaaaaacgaattaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000465XLOC_000465Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000747-proteinTCONS_00000747-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000747-exon-sc0000005-1491911889:1362307..1362447TCONS_00000747-exon-sc0000005-1491911889:1362307..1362447Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1510915933:1362307..1362447TCONS_00000747-exon-sc0000005-1510915933:1362307..1362447Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1575043694:1362307..1362447TCONS_00000747-exon-sc0000005-1575043694:1362307..1362447Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1491911889:1363059..1363216TCONS_00000747-exon-sc0000005-1491911889:1363059..1363216Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1510915933:1363059..1363216TCONS_00000747-exon-sc0000005-1510915933:1363059..1363216Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1575043694:1363059..1363216TCONS_00000747-exon-sc0000005-1575043694:1363059..1363216Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1491911889:1363424..1363518TCONS_00000747-exon-sc0000005-1491911889:1363424..1363518Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1510915933:1363424..1363518TCONS_00000747-exon-sc0000005-1510915933:1363424..1363518Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1575043694:1363424..1363518TCONS_00000747-exon-sc0000005-1575043694:1363424..1363518Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1491911889:1363933..1364039TCONS_00000747-exon-sc0000005-1491911889:1363933..1364039Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1510915933:1363933..1364039TCONS_00000747-exon-sc0000005-1510915933:1363933..1364039Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1575043694:1363933..1364039TCONS_00000747-exon-sc0000005-1575043694:1363933..1364039Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1491911889:1365058..1365376TCONS_00000747-exon-sc0000005-1491911889:1365058..1365376Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1510915933:1365058..1365376TCONS_00000747-exon-sc0000005-1510915933:1365058..1365376Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1575043694:1365058..1365376TCONS_00000747-exon-sc0000005-1575043694:1365058..1365376Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1491911889:1366282..1366554TCONS_00000747-exon-sc0000005-1491911889:1366282..1366554Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1510915933:1366282..1366554TCONS_00000747-exon-sc0000005-1510915933:1366282..1366554Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1575043694:1366282..1366554TCONS_00000747-exon-sc0000005-1575043694:1366282..1366554Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1491911889:1367074..1368218TCONS_00000747-exon-sc0000005-1491911889:1367074..1368218Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1510915933:1367074..1368218TCONS_00000747-exon-sc0000005-1510915933:1367074..1368218Clytia hemisphaericaexon
TCONS_00000747-exon-sc0000005-1575043694:1367074..1368218TCONS_00000747-exon-sc0000005-1575043694:1367074..1368218Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:1362307..1368218 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
32.3538 31.5057 21.9401 21.7582 7.65664 7.14833 28.8117 32.5037 75.1999 65.7897 125.467 62.0735 70.1082 72.7016 34.5576 38.2122 59.0157 67.2685 53.1777 86.1375 82.3642 83.2059 44.1517 51.3787 106.201 94.8135 54.9125 61.8876 68.4691 56.6132
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006694Fatty_acid_hydroxylase
Vocabulary: Biological Process
TermDefinition
GO:0008610lipid biosynthetic process
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0005506iron ion binding
GO:0016491oxidoreductase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008610 lipid biosynthetic process
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0005506 iron ion binding
molecular_function GO:0016491 oxidoreductase activity
Blast
BLAST of TCONS_00000747 vs. Swiss-Prot (Human)
Match: FXDC2 (Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens GN=FAXDC2 PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.146e-85
Identity = 146/319 (45.77%), Postives = 197/319 (61.76%), Query Frame = 3
Query:  294 SQVKKNLLSSAIQSAFIIGSFLLAFASLRNSLTWKFEELWGGSKTFYQDVWTYFYRDIFKGNRLLLSTFGVHAIIFAWFW-LNSIFFFILDVFEPKFFMKYKIQEDKKP--TRAQMLKAIRVVMFNQLVGLIFSFPIYYFV---AKRGMTYDAEDLPTFQWFLVEMFVYIWVEEFGFYYSHRLGHHPRLYKHIHKIHHEWTAPISIIGIYNHWLEHIVSNILPVTLGPLIMGSHMGSLVMWTCIAITSTQISHGGYHLPLLPSPEAHDYHHLKFINNFGVLGVLDRLHGTDSMFVKSNAYDRHILLLGLEPAKALFPDD 1232
            S+ + ++  S  ++AFI+GS LL+F +  NS+TW  +  WG S  F+Q  W       F+G   +L   G   +   +FW  N +   +    +P F  +Y+IQ  K       ++ ++IR V+FNQ    + SFP+  F+    K        +LPTF WFL+E+ ++  +EE  FYYSHRL HHP  YK IHK HHEWTAPI +I +Y H +EH VSN+LPV +GPL+MGSH+ S+ MW  +A+  T ISH GYHLP LPSPE HDYHHLKF   +GVLGVLD LHGTD+MF ++ AY+RH+LLLG  P     PD 
Sbjct:   14 SKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLL-TTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQC---MISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDS 328          
The following BLAST results are available for this feature:
BLAST of TCONS_00000747 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
FXDC21.146e-8545.77Fatty acid hydroxylase domain-containing protein 2... [more]
back to top