Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000734 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000734
Unique NameTCONS_00000734
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2995

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000734 ID=TCONS_00000734|Name=TCONS_00000734|organism=Clytia hemisphaerica|type=transcript|length=2995bp
TATGAATTCATAATTTCTTCtcacaaaaaataaacaataatttTAACAGA
GACACTTTAATTCTTCAtccttttttcatttaaaatcttCAAGAGTTTGA
TAGAACATGTTGTCTGAAAGGTTCTTCATAATTTCGGTAGAAATCTTCAC
AGTACTTATTTGCCTGgttatttcaaatatttctacAACGACGGATAACT
TGAACTTTTATGTTACGACTGGTAATTCGTCTTCAAATGTTAATTCGGTC
TGTCTCTCGGAGCCTTGGAAATGTAAACTCGATTATCACCTGATCCACAA
TGGAAACCAGttGCTGGCAATTACTAACCAAGATATCCACAAAACATTAT
TTAATAAATCGACTCATACCAACACGAAAAGTTTCTTCGTTACCTATGGT
GTATGTCATCATATTCGTGGCTTTTACATCATGAAGCTTTCTGGCTTCCT
TGATATTTATTGCTCACCCCTATCCATAGAACCTTTCATTACCAATGATA
TTATCAGCCATTTTAGCCACCTAGAAGATCTTCATATTCTCTTACATCCA
GACTTGCTCACTGTTTTCTTGGATATAATGGATCAAGAAATTACTttaag
aaatttctttttctacatTGTGGCAATATCAGAGAAAGAAATGGAAACTT
TAAAAATGCAATTTCCTCATTTGATGTTGGAGAGATCTGGTACTCGTGCA
GCGGCTAATATGCTGAGTGATTTCATCGCAAGCGTGGAACAGAATCAAAG
GTTCACAACTAAAAAGAACAGTCTTCACCAAAGAAGAACCGTTGACCGTC
GAACTAACAGTCTACGTAAACTGGCTTTAAGTAAGCGGAAAAAACGTCTC
ATTCGAGTTGTTACCACGTGGTTTCCTCCTTATGTTGAAGAAATGACATC
TGCCATATTCCCTAAATGTAGCCCTGGTCATCAATGCGACATACCAGTCC
GTGATGATAACAACACCAAGACATTATCCTGGAGAAAATCATGTTGCTCA
GGGATGTCTGTCGAGATTTTTGAGACTTTGGCAAGGGAATTAGACTTTAA
GTATACTTTGTATGCAGTTGAGGATGGAAAGTTTGGATCTGAAGAAAATG
GTACTTGGAATGGTATGGTGGGCGATTTGGTTCGAGATAAAGCTGATATG
GCAATTAATGTTCTCAGTATTGTCTCCAAGAGAGCCACTGTAGTTCATTT
CACTAGCCACTACTTGGAGAGCTCTTTTGGGATTTTAAGAATCAAGCAGC
CGGTCATTCCGTTTCCAAGTTGGGaatttctaaagcctttgactGTTGAA
TTGGAGCTGGTGATTTTATCATGTACTTTGGTGTCAATTCTGTTGATTAT
GATGTTGGAGAATGTTGGTTACTTAATGAAAGCAAATCAAAGGTTTTCAT
TTCGAGAAGTGATGACCTATGTCTTTGGATTAACATTTCAAAGAGACATG
GGTGGTACAAATCCTCGAATGTGGTCAGGACGTCTTGCTGCTCTTGGTTA
TGCATCTGCAATGACCATCATCATGTCTATCTATACTGCCAGAATCACTG
CGAATTCCATCGCTCAAAATGTTAATGATGATTTCAAAGGCTTCCAAGAT
GAGAGATTTAGAAACCCAACATCAAAGTACAAGTTCTCAGTGGTTGGTGG
ACAAGGTTATTCACAAGAATTGTACTTTGAGAACCACAATGATCCAGCCT
TCAGGAGAATGCATGAATTTATGAAACCGTATTttgttgatgatgatgaa
gTGGGTGTTCGAATGTTGATGGAAGGAAAATTTCAAGCCTATATTACAGA
GCTTGGATCATTTGAAGCTTACTTCCCACCAATGATGGCAAGAATTGGTT
GCAGTCAAGAGATCgaattttatccaaaaagtGTTGGAAAACACGGCCTT
GGTTTTGCATATCGTAAAGATTTCCCGTTCGGTAAAACAATATCAAATCT
CATGGTTAAAATGAGGCAGCATGGagattttgaagatttgaagatTCGAT
GGTATAGTTCATCGCCATGTAATGGTATCAAACCGGTGGAGCAATTCAAT
TGGACCTATTTCTCTGGGATTATGGTCATTGTTGGGGTAATGATGGCTAT
AGGTATATGCATCAATCTCTTTGAGCATAGCTTTGTTTTCATTAGAAAAC
ATTACTTGAAGCATAAAGAAGAATCGGACCTGAAACATTTTTCTGAAATG
AACACGAATGGTTTGAAGCATCATCAAAATGGTGGAAATGATGAAGGTTT
GGTCAAAGCCAACAGAAATTTAAGTTTGTTTTTGGAAGATCTTGAAACAA
GAATAGCTGAGAAAAGAAATCGTCTAATTTAGAGTGAGAGAGGTAATGCT
ATCATATCTTCGGGATAATGGATTCGAAAATGCAGACTTTTCACAACCTA
TTGTGCTTTTTATAataacatccccttctcacagaccagtTAAGGTTGCG
AGGAAATAAAGCAGACTGCAAGCTGACGTGGATtgatatttcaatgtttt
tttatgaCCGGGGAGCTGAGTTACATTATTGTTTTCAATCATAAAATTCA
ATCGCAATGAAAAAGAGCACCATATTTAGCAAtgaggatttttttattta
attattttcagctgggacaaaaattggagtataatttttcgGCGGgtaca
atattttggccaatttttccagtgggagaaCCTAGAACcactttttaatt
aattttactAATAGACGTGATACCATTGCCCTGGAAGACACTGCTGCTGC
ATATCCTCATCTGTACATATTTTGCACAAATTTAAATTCGCATAATTTAA
ATacttatttttagaaattttccaTAGATAAAGTTATAGATTgtagattt
tgtagatttttagaaaatttcaagTTGATCCATTATAACAtttaattttg
atcattttgggcTCGAAAAGAACACTGTACATTGTgcgttgaaaatttta
ttttcaataatttacCTCTAGACAGTGGTTTTACCCTGTGACATC
Run BLAST on NCBI

protein sequence of TCONS_00000734-protein

>TCONS_00000734-protein ID=TCONS_00000734-protein|Name=TCONS_00000734-protein|organism=Clytia hemisphaerica|type=polypeptide|length=741bp
MLSERFFIISVEIFTVLICLVISNISTTTDNLNFYVTTGNSSSNVNSVCL
SEPWKCKLDYHLIHNGNQLLAITNQDIHKTLFNKSTHTNTKSFFVTYGVC
HHIRGFYIMKLSGFLDIYCSPLSIEPFITNDIISHFSHLEDLHILLHPDL
LTVFLDIMDQEITLRNFFFYIVAISEKEMETLKMQFPHLMLERSGTRAAA
NMLSDFIASVEQNQRFTTKKNSLHQRRTVDRRTNSLRKLALSKRKKRLIR
VVTTWFPPYVEEMTSAIFPKCSPGHQCDIPVRDDNNTKTLSWRKSCCSGM
SVEIFETLARELDFKYTLYAVEDGKFGSEENGTWNGMVGDLVRDKADMAI
NVLSIVSKRATVVHFTSHYLESSFGILRIKQPVIPFPSWEFLKPLTVELE
LVILSCTLVSILLIMMLENVGYLMKANQRFSFREVMTYVFGLTFQRDMGG
TNPRMWSGRLAALGYASAMTIIMSIYTARITANSIAQNVNDDFKGFQDER
FRNPTSKYKFSVVGGQGYSQELYFENHNDPAFRRMHEFMKPYFVDDDEVG
VRMLMEGKFQAYITELGSFEAYFPPMMARIGCSQEIEFYPKSVGKHGLGF
AYRKDFPFGKTISNLMVKMRQHGDFEDLKIRWYSSSPCNGIKPVEQFNWT
YFSGIMVIVGVMMAIGICINLFEHSFVFIRKHYLKHKEESDLKHFSEMNT
NGLKHHQNGGNDEGLVKANRNLSLFLEDLETRIAEKRNRLI
Run BLAST on NCBI

transcript from alignment at sc0000005:1069280..1091729+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000734 ID=TCONS_00000734|Name=TCONS_00000734|organism=Clytia hemisphaerica|type=transcript|length=22450bp|location=Sequence derived from alignment at sc0000005:1069280..1091729+ (Clytia hemisphaerica)
TATGAATTCATAATTTCTTCtcacaaaaaataaacaataatttTAACAGA GACACTTTAATTCTTCAtccttttttcatttaaaatcttCAAGAGTTTGA TAGAACATGTTGTCTGAAAGGTTCTTCATAATTTCGGTAGAAATCTTCAC AGTACTTATTTGCCTGgttatttcaaatatttctacAACGACGGATAACT TGAACTTTTATGTTACGACTGGTAATTCGTCTTCAAATGTTAATTCGGTC TGTCTCTCGGAGCCTTGGAAATGTAAACTCGATTATCACCTGATCCACAA TGGAAACCAGgtaagcatcaaattttaagatttaagaTTATAAGAGACCC GAGTAGACCCTTAAGTGTTGTAAGGGCGCATTGGAAAAATTAGTCGAAAA ATTGTCCCCGCGGAAGCTCCATTTCGAAAAATCACAACAGTCATATTCAC ACAAAAAAGACGCTAGTTTTTAGTATCCCATCCCATCTTGATTTCTGAGC TTTAATTCATTTAAATAGCTGTTTTTTAAGCACAACTTTATAATTAGAAA CTTTAAAATtaggaataaaaaaaaaaccgtcaaaattttcaaaataaatt tagcATATCTGATTTTGACGCGGCCAAATTTTGTTGGGGTCATACTTAGT GCGACGACGACTATATGCCGGAGGACCATATAACTCTATGGTAATTTATA AAGGTAGGAAAAAATTACACCCTGTGGTATCACAGAGACGACTTTATTGC CCAATTGTtcagatttttgttttgtttttatttagttGCTGGCAATTACT AACCAAGATATCCACAAAACATTATTTAATAAATCGACTCATACCAACAC GAAAAGTTTCTTCGTTACCTATGGTGTATGTCATCATATTCGTGGCTTTT ACATCATGAAGCTTTCTGGCTTCCTTGATATTTATTGCTCACCCCTATCC ATAGAACCTTTCATTACCAATGATATTATCAGCCATTTTAGCCACCTAGA AGATCTTCATATTCTCTTACATCCAGACTTGCTCACTGTTTTCTTGGATA TAATGGATCAAGAAATTACTttaagaaatttctttttctacatTGTGGCA ATATCAGAGAAAGAAATGGAAACTTTAAAAATGCAATTTCCTCATTTGAT GTTGGAGAGATCTGGTACTCGTGCAGCGGCTAATATGCTGAGTGATTTCA TCGCAAGCGTGGAACAGAATCAAAGGTTCACAACTAAAAAGTAAGAAATC GAAAGATTATTTTCTCAGAATTGTTTAACTGTTTTTGCGGTTGAATTAAC AGTAAAAAGAGATCCAAAAGAACCAATTGGTTACGCTCCTCCTCGAACAG AATTTTAGTCTCGctttaaagaagaaattttggcgggagcTTAATTTGGC AGACAACGCGGGAAAGAATTAAATTGGGAGGAAACTTTATTTGGTGGATT GTAACCAAATtttttcctttaaggtatttcgAACGTCTCCGCTAACTGGT GTCTAAGCGTGTCAACCAGTTGTAAACTtacattattttatttatacCGA AACCTTTTTGCCCCACAGATGCGTTTGTTGCTTTACAGTAGCGAACTTGC TCGcctgaaaaatattcatgtcgTTGATCTTCCGATTATGAGCGGGCCGC CGCGGTTAAAAAATGTGcactttttattattattatatctCTTTTGTTTG CTACTGGTACCGATTTCCTAGCTATGTAAGGGTGACAGAGAGGGTAGTTT TCCTAGCTATCCACGACGTTTGAAATTTGACTTATGACTTGCTCTGCTGG CTTCCATCAGTTCACTACTGTTCGTGAACAAACAGAAAAAGGTAAATATT CAAATATCTATGAAAATATCCCAAAAAATAACCAAGAGCCGTCTTCAGAA GGAATTTCTatgaaaattagagaaattcTAGTTGTTATCAGCGATCCAGT TTTCCTCAGAAAATCTCCAATTGGttttatatcaaatttacagaccagaa taaacTCGCGACAGagactttttagaaatatgtgttctcatcttctagga gaccacatgCTACGACTTTCAGTTTGCAAGGAAATACATTTTGCTAAGAT ATACTTGTAAGATCTGTATTTGCttttttcacaaaagatgtgttctgaaa gtTTACAGGGTTATGAGGCAACAATGTTAAATCAATTTTGTCTTAATTAT ACCCCTTTGTCTATTCTGTATGGCGTGCCATATGTAGTTTTATCATTTTC AGGGAGATGgcaatttttgccattttataTTAACTTTTTTCGGGATGTTT CAACATCAATATTTTCTCGACATCTTGAAGTCTTTTGTCGTGACTTACTT ATTTACTTACTTACAAAATAAGGGGATAATATAAAGGGAGTTCCAATATA ATATTGTGATACACTGTTTGATAATTTTGAACTTTATTTTGAATTCAGCC AACAGCGGTTAAACAGTTCAAACAAACCACACCTTCATTATTAtgtaaat atttgatttttttgggggGCATCCAAAGTAACGAGATCACAGGATCAGAC TCTTTTTTGAGCGCGGTATTTCGGGATTCGCATGAAAATAAAAAGGGAAT ATAGGACTAGAGCTCTATGCCGATACCGGGATTCTACCCTTAAATCTAAC GGTAAAATGGTAATCAAGCAAATATTTCTCGGGATTTCGATATTTAGACA TGTTAACGTTTTGTTCATCACAAAGTTTAGACGTGTAAACGTGGCCATAA AATACCTTAACAAAAAAACTAAAGTGTAGAGAAAACTATAACAAGACGac cttgaagtcgaaaattttgcctagaatttgaactgcatgggaaaaacaag aagtagagattgaggCTAATGTGAAATCTACTTCACATCGAGCCtcgatg aaacaattttacaagaacaacgaggcttaaaatcgctaaaaaattaaagt ctattcacgataagtgtgcactcttttttcttttacttataacttttgaa ggaattcttcaatctttttaaatttggtatcattggaNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNaatatctttccaatgatgccaaatttataaagat tgaagaattccttcaaaagttataagtaaaagaaaaaagagtgcacactt atcgtgaatagactttaagaccgatttaagaacaattgttgtttaatttt taagaactcttataaagtatatgctcataaaagataaatatgctcatatg gcacgtcatcccttgtttattttgtaagaactaattacggaaaggtatat caccgtctatccaAGAGTTAAAACAAGACTTAGAGTTAACGGGCATCATG GACAAAAGATGAAAACGTTTCAAGTGTCCTTTTTCAAGTCTCTGTTTTGA TTGAGACTATGTAGTTTCTTTAATATAaccaaaagcagtttgtttccAAA AGGCTAACCTGTGATTATCACGGTACGAAAAAAAAACgggataaaatcaa atcaagTGAAAATTGAGTTGGAAAGTAAAACTCaaagaagaaattcaaac tGCTAATAATTACGTACTAACCCTAAAATAAtatgaagaaattcaaatta ttaTTAATTACATAGATACTACCCATAAAATAATATGATAAGAAATTCAT ATTGACCCAGCCAAAAGATAAAACGTATAGTACACCATTGTACTTCCTTT TTTGTTTTAGCTTCCATCCCAGGAAAAATTTACTGTATAAACgtttaaaa aattatcattacATCAAAAGTCCACAGATTGTCAAACATCGATTATAATT CAGCACTGGAATTTAAGTTAAGTATACGTTTGTTTTTTATACATCTTTCA tccatcaaaaaaataataccttTAATTCGCTTGGAAAAATAATCAGGCTG TTTGTTCCAAGGTAATCGAACCATTTGTGTATCCGTAATTCAGTTGGTTT ACGATATCGATGATGTCATTGGTGACTGTTGGTTGATTGTCTGCTCCAGA TGTAAAGGGGTTTAGTGGAGTATTCATATCCAATTCTTGATCTCCCTGTT GCGTTGGGGAAGGCCCTTGACCATTCTTTGGCTTGGTTCCGTCGTCTGGT GTTATAGTGAACGGCTGTAAGACAGTGTTGACTTGATATTTAGTTTGCCA AAGCCAAAAGATGCGATCGACATTTGCCATGTGTAAGAAAAACAAAGGAT CGAAAGCTGCCATTTCTTTTGCACCCAAATCGCCATGGGAACCAGCTACC AACTCTATTTGAAACTCTTTGGATGGCGGGCTATTCCCACCTAAGGTGTG AAGCATATTAATACTGGCTTGCTCAAGAGAGATCTGACCACCTGTTGCTG ACACGatgtttgaaaattgattgTAATTATCAATATCAAGGCATCTTTCG TACATCTCTTTAATTGGTATGAGGGGATGGTGCAAATTATTCAGAGAGTG GACGATGTTTTGATTCAAGTAATCTTCTGGGTAACGGAGGAGCAGGTTGA GATAATTATTTTGGAGTTGTGAATTGGTGGTATATTTGCTTGGATTTCGA GGATTCATAAGACCAGAGAATGGATATCGGCAGGTAGTGTATCCAGCTGC TTTTGTATACTTCTGGTTTGCTTCATTTAATGGGATTGCATTTGGTAAAA TATATCCCAAGAGAGGGTTGGGAATAGTGTTTCCAAAATCATCAATCTCA ACAAAATCGACAGTCAAAAGGCTTGGAAGACCGTCTTTTAACGATTCATC TGATGTTTCATCCCAGTAATGCAATGCTCCCTTGTCCTGATCACCGACTG GAGTATTGTTGACCAAAGCGTTTTCCAATCGCAAGAGATATGCACGGTAC CAGGAGAGGAAAAGAACATTTTCATGCTGGCTGTCTCCTCGCCATACCTT TTTTGTCTGAGGTGCTGATGTTCTCGGCGATTTAAACGGTTGTCCATTAA TTGATGCTATATTCCAATAGGTTTCCGGATCGTCAGGACTaagatgattt ttgattttatcaaacGCCTTCAAAAATGCGTATCGGGCTTGGGTATTCTC ATCTTTTTCCAATTCTCGGATCGACATTCGATTTCTACAAACATAATTAA AGTTTAAATACCTACCTTATtgcacgaatattactaggcaagtattaaac ggccttgaaattaacacgagtTTTATTTGCTTAAGTGCTTTGATCATAgt tggaaaattgattttagtatctgaacatgaaagttatgttttagattctt taacacttttaacaaagaattgcctttataaattgctttttaatcaaNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNagaaaatgtataacatgccatagttttgtt ggttacatcagtcagaaaacacattttaaacacggcaattatgaaaaatt cactatggtcagagcccttaatatcAAGGACACCACGGTTGGTTTTGATT AAGgtggtttttattaacacgaaatttttcaattcgtgttaataaaatga ctaataatattcgtgtaataaggtagtttAGAGCTTTCTTTCCTGGACTT GCTTTAATTTTCGGAAATTCCAATGGTCAAGTATTTTGGTAACAAAAAAA CATCATAATTATCAAGGCTGTTCTTCATATAAATATAAAAGGCTATTCCC ATTTTTTCGTAGCTCATATTAGTAATCAGACGCACATTGTCCATGCAAGa gtaagggagtggtcagaaagtatctactagggagGGGTGGAGGATTCTAT GGGGGGTTCCAAATAtttttcgagggtttagggggggggttcaatatttt ttgagggtttagggggggttccaatttttttgggcaaCTCAAGGGAAAAT GTgggaagtctaatttcatagttttacgtttcaagatttaaaaaattttt cggccTCACGGCTGACAACTCATAATTAATTTTATTGGATATATGCACAT GTCATACTAgcattatttgggcatcatagccttgcccttttggtttgtag CATTGAGTTAGATGAGGGAAGTAGATTTGTGGCTttcacagctcatcaga gtggtttgaaaaagtactttttagaatgaaatttgtcaaaacaaagtgtc ttttagctCAAATGGTGGGtaaaaacatcgaaattttCTCCCGTCGGTGT AAACCATagttgcgcctccttagacttTACTAATATCTTTTAAATTACAT ACACAGAGCtttgacagaccctggaaaacctgaaaaatataggtttacag ggaaatttcaaattcagagaattttattttttagactccttttaacaaca gaatagcttgtattttagggtctcgagtacctgatcttcaaaattttctc tcttcggggccaaccatggtggtCCCTCAGGATATCTTGAGTAATTGAGA TGCCTCTGTAATGTATGATGAAAAATGGCACTCGACATCTCACCATCAAG TTTCAAAATAGACTCAGGGAGATCGTGTATCAGGGAAAATAAGCCTTAAT TTTCTCCCAAAACTTAGGGAGACTCAGAGAAAATAACTTGttgattctta ttttaaccCTGGACTATTCCTTTAGGAGATCacactaccattttgattga cgtttacatcacgggttttttcttttgcttacTTCGTAACCATGGAAatt gacgaaaaaaaacccgtggtgtaaacgtcaatcaaaacgGTAGATCTCCT AAAGAACTATACTCAACTTAACAGGGCTAAACTATCTCCCTTAcctaatt ttgacataaaaaactgtcacacaaacaaataatactctttgtaccgcatc tgtatgaattatttttttgcgtaaaaatttttctagtagggggggggggg gggaaaaatttTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNgggggggggggtgcgaaaaat tttcaaaatatcctataccccccctagtagatactttctgaccactccct aaatAACATAAATATCATAAATAAAGTAAATAACAATACCTTACGACTGG TTGTCAACAAGGTCACCctgaataataaaaaataaagtacTTGTTAGCAA AGGGAGGCACTTACATCCAAACGTTTAaactgacagggtccacttttcaa actcaagCGGTACGTCCAGGTCGGCTGTCAACGTCGAGCTTGGTTActaa agggttaaaaatctaggttttcagaagtacaatctCGAACCCCCCCCCAC GAAGTTAGGTTTTCCCCgtttttaaaatttcgaaaattttctaaccatcc tgtttattttgaaactaAGAGTACTGAATCCTATCTGAATATTCAATCTC AGAACGAGAGTAAAGTCTCCAATTTTTGATATAACTTCTTTAAAGCCAAG ATCTAGTAATTTGAAATCCTGGGTTCTTCCACTACGTTTCAGTAGGCAAC TGCCCCCCCATCAGTGGCTGATTTGGGGGCGCTGAAAGCAAGAGACACAG AAAGGCTTCTCTGGTTACTAATTTAGGCGCCCCTTTACTTTTTCACACCT TAAGATTAGCAGTTTTTagccaaaaatattttaggcagCGAACAGGAAGA TAGAGGTGATCGCAAACCATAGTATTAAACCTAAATATcttccagctggc acacaacgtcgtttcaacgtttatctaatgctcATATGATACGTCCATat gacgttagatgaacgttgaaacgacgttgtgtgccagctgggttggtaaa atttgataaataatCTAACTTACATCAATGGGTATTTGCTCAACCAATAA ATCTTGCAGGTTTCCTGATTCATTCTTTCCTTCAATTGAAGCCATTTCTC TGTCTGCTACCTTCCCAGCCATTTTTGATTTTACAGTAACTTCCTTCCTT CTTTTATCACATTTATTGTATTTGTCTGAAAGTAAATTTGTTCAAGCTTA TACTTATACGGAATTCGCCCCCTTACAATAACAATTTAATCCAAAAATGA CCACGCATCACATGAGGTAATACCTCAATTTCGTGGAAAAGTATTTACCA TGAACAGATTTATTATTTCCATATGAAGtcaaattcttttgtttgttCCA AAAATAACCATGCCATGCATCATGATTCTCAGATTTCGtggaaaaacatt tcaaaaagtgCATGGGATGGGAATCAACATATGTTTCTATGTGGGACAAA GTTCTGAAAGTTCacttcaaaaaatcatttcttgTAAATTACTTAACATA AGATTAGCTAGAATTATCTATTCCAATAGCGGCTAGGTATAAGTaatacg aagcgataaacgtgagatacacactctggtacagagtatttttaccccca ctggctgaaaaaatcctaccggatctgtgagaaaggggtgtaaaatacGC TAACAAAAGCTACatagaaatattttagaaatgCTCTTTAAAGCTGTTAT TTGATCACTTCCTATTCTGTAAACTGTTTTCCGGATAACGTTACCCTTAC ACTTAccctttcttttatttttctttacttctGTCCCCTCCATTCAGCTG AGTGAAAATCGTCAAGGCTGATACTAAAAAACAGCACCAGTTAAAGTACT TGAAAGTAGACCACATCCATAGATTTTCCTAAATCCCTGAATGACTGAAT ACCACTGTCtcactttttcttttccattgcttcaataaaatttgatttGC TTTataacacacccctgtctcacagccccggtggaactttttccttagtg gggataaaaattcatattgaaatctcaatgtggatggaaattttattgtt ccaaggttaaaaaatccagtgtggatggttttggagtgcaattttcaaaC ATTAGATCTCGAacggggatgaaatcaaagtcaaattcccagtggggctg aaattccggGGTAGTTTCCCACCGGGGGTCAGTGACACAGAGGTGTTTTA TGCATCTCTATCTTATGTATATTGTGATATTTTATAGCTTTACAAAAAGC AATAACTAAACAGTAAAGTAGCAATGAAAGAAAATACCTATATCTGTTTA AGTTATATATTCTGTTTTCTCACACCGCGTGCATTTTTCGAAAGACAAAA TTTTACACTTCAAAAGCGTAAATCttcttatagtttttttgaCATCTTTT CGTCGATTTCCAGGtaaaaaactttatttcaaatgtttatttgaaagata aaagaaatatgTTAATATGAGTAAAGAGCCTTTTgtaaagtacacgtttt ttttattagaacacctaaaatttggctgagcctggatgtgcctatttttt ttagcaattttcagcctaaaatgttcttaaatgcgttcttaatttttgag actactctaaatcgacaatatgatacaaaataaagagNttcttaaatgcg ttcttaatttttcagactactcaaAATCGACGATATCATttgcacttaaa attggtaaaatttggacaatatttgactctcgattttagaaaatccatgc ctaagttcggttaaaactgcttgaaaagaggaaaaattgtagtttcttgt catctttttccaaactgaagctgggcatgttcttacgatgtttttgaatt tcagcctcaatattcttataaactgggttctaataaaaaaaacgtgtacg ctTCGCTATTGATTTTCGACTTTACAatatttgaacaaaaatttgttgtt aTACCTGTTTACGCAAGTAAACACAGTTCAGGACGTGCATTCGGAGGGAC TGTTATCCTCCTTAACCGCAAGTTATTCACATCAATAGACATCAACATTT CAGAGCATCATGTTACAATCATCAAAACTAtgctaaaaaaaacatttccc tAATCGTCACTGGGATCTACTTACCTTCCACAGGCTCTTAGAATTACACA GACAATTACAAAGTTCAACTAGCGACCATCCAAGGAATCCACACCAAATT CTCCCCATCGAGTGAATCAATCGTAATGGATGGACTTTCAATGCTACCCT GACATCCCGGATTCATAACGGTGTTCGCAAACTAATACACTCTATCACCC ATTTGACAGAGTTTATCATCGGGAACGTTGACCGGACGTTTCCCAGACGG ACCTTTCCCCGACAGTCATTTCCCCGACTGACAATTCTCCGACGGACTTT TACCCGACCCTGACATTTCCCCGACTGACTTTTCCCCGAACGGACGTTTC CCCGACTATAACCGGACATTTCCCTTAACGGACGTTTCCCCGATAGACAT ACTTCATACCTGTTGACATCACCATGGACTTTGATCCCACGTATACATAC CACAATCAGAGTATGTTAAATTCAACATATATCAACCACAAGATTTTCTA AACAACATGATCTCATCTTCAGTCATTCTTCCGGAACCAACAAACACAAG TGATCATTTACCTGTAACTGCTTCAAATACCTTGTGCACTCGTTGATAAC CTCGATTCAACTCCACCACCAACCATTACAAGAAGGGTACCTAATTATAT GtggaaaatgcacttttttagaCAAATATCGAGAGAGCgaactttaaatt attttaactCTTTTCTAATAATtaagttaagtaaatcggtaaaatcacaa cgatgacgaacgaaaatttaacaggctagtgagtttcaaccaatcaaatt tcgtattctCACTAgtctattacatttttcgtccgtcgtcgtgattaatC TGGTACGCTTAACCTCAGTAATACTTCAATTGACAAGGATCAACCTACAG GAACATCTTTAAAAGAATTCGCTTACGAAAGTTACGACGAAATTGAGCAA AAACACCACAGAATTGAACCCACATTGTGTTGGAACAGCACCCAAACTAA TAGTAGAAAACATTTACAAACCATGTTCAACGTATGgaaatctcaaaact ttccaAGAAACGAGAAAAGCATTTCTTACAATCGATAAAAATTTGTTCGA AAACGATTTCGTCAGCTCGTTCGAAATGCCAAAAATCCATCCTCTGTAGA ATATTATATCAAGATCGACAAACTTAACAAAGTAAGACCCAAAGACTTAT TGGAAAAACATAAAAGTTCACCGTTCATCTTCACAAAAACTTTTCACCAT CAACGGGAAAACTCCCAAAACTGATATTAACTCCAAGCACTTCAACACCA TTCTGAACACCCCTGGTATCGACTCAATCGATAATAACACAAGTAATTCT CATCTTGCCGACATTTTTAACAATTTACCCTCAGGACGAGAATTTTTATA TCACACATTCTGAAATGCAGAAAGCTATCAATCGCTTGAATGAGGAAAAG TCCCCGGACCCTTTCCACGTTTTGAGAGAGCATTATCTACACGCAATCAG TGTTGACTTCCTCAACTATCTTACAAAACTCATCAATCACATTTTTACTG AAAAGCACATTCCATCATTACTTGGAAAGTCCATCATCATTCTTTTAGTG AAGTCGTAtaataaaactttaaaagacCCCAATAATTACAGAGGTATAAG TATAATGCCAATACTGAccaagccaatcaaaataattaTACTGAACAAAT GTCCTATTCTCGAAGCTTCTCATTCCTCTCAATTCGGCTTTACGAGCCAA TCATCTCCAATCCATGCCGAGTTTTACTGCAAGTCACCATCAGATTCTAC AACAGTAACAATTCACTATTATATATTTGCAGCTTGGATGTGTCTAAAGC ATTTGACAGCTGTAACTGGAATCTCCTATTTGAGAAACTACTATCCAAAG AATCAATACCCACACCGATTGCAGGGATGAGATATCTCATGCTACACATC TAAGCAGTGAATCCATTGTTGTTTATGGTGGTATCCAATCCGACAGTTTT AAACTCTCTCAGAGGGTCAAACAAGGTTCTATCATCTCTCCCTACTTATT CAATCTTTATACCGAAGACTTACTATCGAAACTTATCAATcagaaaacac ccctgtctcagtgccccggtggaaccttttcccacagtggggatgaaaat ttctatcgaaatcccaatggggatagaaaatctattgtttccagctcaaa aattccagtggggatgggatagttttggagtccaattttttccattcaat tttcaatggggaaTAGAATCATAGgccaatttcccagtggggttgaaaat gtagggtattttttccaccggggacgatttttggcctatttttccaccgc gGTGGGgagtccaccgggtctgtgacacaggggtgtcagaAATATGGAGC CTCTCTCCCAAACGGCACCGTCACGTCAGTCATCGCTTTCGCAGACAATT TGATCTTGATAAGCTCAACTCTCTCTGGTTTGCAATCCTTAATAGAGATT TGTATTCGTTATGGTCACAAACACAACCTCAAATATAAAACCACACAAAA ACTCAGTATCTTACATCAGGAAAAAGTCTCCTCGCAGATCTTACAATCCA GCTCGATGGCAAAATTATTCATCCtcagaaaaattaaaacacCTAGTTTT TTTCGTCCAAGCATCCTTCAGCTGAAACACCATATCGACTACCGTGTTGC AGAGTATATGGTCCGTCGTCTCATCCTTGATCACAGGTGGAGTTCGCCAC CTGCATCCTAACCAAATTGTAAACGTTTTTTAAGATTCTAGTGATAACTA AACTCCTTTATGGACTAGACCTGGTCACACTTACTAACCACTACCGTGAC TTAATAGGCAGACAAGCAAGATGTGCCTTGAAATCTCTACTTGGCGTTTC GTGATGTCTTTTGGATCAATGAAATCGCTAGAATCTAACCCTAGTCACGA ATACGGTTGTTACTGACCATGTATATCCCTTATCCCACCTCGAGAAAATC ATGTAACTAATAatatcccacctccacgtgatgtcgtttgaccaatgaaa tcgctagaatcttactgatgcgggatAATGCTTGTTATTTTTAAACCATA ACGTAATGTAAATCACATGGAAGATAATAACACCTCTGTCTCTGTGCTCA AGTGCGGTTGGAATCTGAAATTCACTGAGGTACAAGATTTGATTTAAAAT GTTGGTTGGGGTTGATTTTCACTGGAAtctaagaaaaattttgacaacTT ATTACTTAAGCTAGAGTACCTTTGGTTTACTGCTGGTCAGGATAAAATTT TTGCACTAAATGAGGAGCATGTATGAATTTGATAGAATGAATCCGTTCGT ACACTGTGACGGATATATGGATAAAGTAATAGTGTTTTCTTGCCAGTATT TGCGCGCAATTGAGAAAGCCTCTAGAATGTAGGTTTAAAGGaaacactcc tgtctcacaaCACCGGTgaaatttcgattgaaatctcaatggggataaaa gttgtttcaaggttaaaaaatccagtggggatgattttggagtgcaattt ctaaacaatgaatttcgaatggggatattttctccaccggggacgaaatt tttgccaaactttccagtggggctgtgacacaggggtggaGGAAAGGGAG AAAGGGCACAGAATTGGGATAAAATAGTGACAAAGGAGTGGGAAAATTCT AATTTTCAACCCGCCCTCCCATTTGGCTAAAATCACTCCTTTTGTTCTCA AATCTTGATAAGGCAATTATATGATTTATTTTACACACACAGCAATGTCA CGGACCCGCAGGGTTAGCCAACTACATAATTTGGATTAGATAAAGGCAAT ATATTGAAGTGGAACATTTTGATAGCAAGCGGAGTGagctaaaatcattt ttaatggGGCCATTTTTGTTTGGGGCCATTTCTGGGGCCATTTTTAAGGC CAATAcctcaaaggaagaaattttggcgtgAATTTAAATTGGTGGATGGT CAAATAAGTTTTTTCAGTAGGAATTCGCTTTGGCGGATAGCAGAACAATT TAAActtggcgagaatttaatttggtggatgagggatatttttggccaaa aaatgcTATTAAATTGGATAAAACGTGCCTGAAATAATACGCTTTTGTGG AATGACTACAATTATttaaatttggcaggaattcAATTTAGCAGGTGGGG GGATTGTATTTGGTGGGAACATATATTGGCGGATTTATGCCTATTTTCTT ACTTATTTAAGGTATCTGTTATTAAGACATGAAAGTTCTAGTAAGTATCA ATTTTATACGTTTTTAGGAACAGTCTTCACCAAAGAAGAACCGTTGACCG TCGAACTAACAGTCTACGTAAACTGGCTTTAAGTAAGCGGAAAAAACGTC TCATTCGAGTTGTTACCACGTGGTTTCCTCCTTATGTTGAAGAAATGACA TCTGCCATATTCCCTAAATGTAGCCCTGGTCATCAATGCGACATACCAGT CCGTGATGATAACAACACCAAGACATTATCCTGGAGAAAATCATGTTGCT CAGGGATGTCTGTCGAGATTTTTGAGACTTTGGCAAGGGAATTAGACTTT AAGTATACTTTGTATGCAGTTGAGGATGGAAAGTTTGGATCTGAAGAAAA TGGTACTTGGAATGGTATGGTGGGCGATTTGGTTCGAGATAAAGCTGATA TGGCAATTAATGTTCTCAGTATTGTCTCCAAGAGAGCCACTGTAGTTCAT TTCACTAGCCACTACTTGGAGAGCTCTTTTGGGATTTTAAGAATCAAGCA GCCGGTCATTCCGTTTCCAAGTTGGGaatttctaaagcctttgactGTTG AATTGGAGCTGGTGATTTTATCATGTACTTTGGTGTCAATTCTGTTGATT ATGATGTTGGAGAATGTTGGTTACTTAATGAAAGCAAATCAAAGGTTTTC ATTTCGAGAAGTGATGACCTATGTCTTTGGATTAACATTTCAAAGAGACA TGGGTGGTACAAATCCTCGAATGTGGTCAGGACGTCTTGCTGCTCTTGGT TATGCATCTGCAATGACCATCATCATGTCTATCTATACTGCCAGAATCAC TGCGAATTCCATCGCTCAAAATGTTAATGATGATTTCAAAGGCTTCCAAG ATGAGAGAGTAAGCAATAATTCATGTATCGTTGAAAATATAATTCCGAGT AGCGATCGGAgcttgataaatcaaaaaaggaaaaaaataatttcccttCT TGGAATGCGCCTTCAAATCAAAGTTCATAAAGTCAATAGATGATTGTTTT GTCTTAAAAATACGGAGTTATAGGATGGGCGATGCTTCCACCAGTGTGAT ATCTTCCGAAATTTGAAGCTCAAAGTGTCATAAAAGCACGTGTACAACAT GTGTACAGATTTAAAGACACAAAATAATTAAGCAAAAGATATTTCCCTAA ATGACAATAGAACGGTTTCCTTTGAAGGATTAGCTTTGTGTCCATCGCAC AGTGCGATAAATATGAAATCTTGTTATATCTATACACTATGCGATAGTGG CTATCGCACATCATCACGAGTTACTATTACCATCACTATTGCAGTGTAGT TCCCATTGCTATTTctgcggctttcttatactatgattatACACACTGTG ATAGAACTACGTAACCActgcttcttccttttcttctaaTCAAAATgagt acacacttttttttataagaatggtgtaaatccatttgatcttggatatt cttaattttttgtgaaaatcatcctagaatattcttacagcatattctta ggttaaggtcctaattcagactagatttaacatttagtacatacgtctca agcataagatggTATTTTTGTGagcttacttgggggtaattgacaattta taattgaaaatgctctaaaaatagcATTCTTAGCTCGAGTAGCAAAAtcc catgatggtgatattcttagcatattcttaattttttggccattttcatc atggacattcttataaagtgtattcttataaaaaaagcgtgtacttcaTC TATATAGTTTAGAAACCCAACATCAAAGTACAAGTTCTCAGTGGTTGGTG GACAAGGTTATTCACAAGAATTGTACTTTGAGAACCACAATGATCCAGCC TTCAGGAGAATGCATGAATTTATGAAACCGTATTttgttgatgatgatga agTGGGTGTTCGAATGTTGATGGAAGGGTAtggaaatcattttaatttta taCCGGGtccgccacaaaaaagtttctctctttaaaactaattttcttga aatctaaaagttttaaaagaaccatccctatttcattggaaagaagaaag atgaacttaaattttgatgggtcatttatttaactcgattcattagatca aaagttatgctcaattgaataaaaaagttactttcggaaaatgctcaaaa acggtAAAAAATCGACCTATAGAATTAAACATAAGCATGATTTcatgata tatcagtattttcgttacagtcattaaaaatgataattagctgtctaaat gacctttagttatttaaaggaaggttgaatttcaatgaaaggaagaaaat ccgtcgaaaaaggccaaataatctggtaaaattcctaaaaatacatcaaa tatgggttttgaggtagatccagccttacatagactttatccagtctaga acaaaaaatttgaggaaaatttcggtaaaactaaattaaattgattttga tgaagattttaaaccctttcgagccttcagtttcaaaatttatgtgtttt gttactgaaaaatgctcttaatcatgtaaaggctaatgcaattgccaaat ttaaagtaaaaatttgataggtcNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNtcagaaagtaacttttttattcaattgag cataacttttgatctaatgaatcgaatttaataaatgacccatcaaaatt taagtctatctttcttctttccaatgattTAGGAGTGGTTCTtctaaaac ttttagatttcgagaaaattagtctcaaagagagaaacttttttgtggcg cacccggtattataCTTTTTCTAATGTATTCCTATCTTTGGAAAGGGTAT AAAGGTGATAAAAGCGCACAACTGTTGAGGCACCGTACTCGTCCTCAAAA AACAACCTTATATCTAATTACCATccataaattcaaattttttactactt tgaaaaaaaaaaccgggAAAATTACCCTTAAAGTATCATCTGATAGATAA TATTTCCATTTTGCAGTTTGATAACAATATCATATCTATTAAGTTAAAAA GCATTTGCCTCCACAGATTGTATCTCAAAAAATTCCTCATAGCAACTTGA GGAAGATGGTGAATAACCCAAAATTATTTCTATAGAAGGGCTATTGAGTA AATGAATATGAAGACCTTTACAATTTTTCTCCATGggataaaaatttaca aaaatttgatacTAATGACCAAATACACCCCAGTCTCCCGGTGGAACTTT CTCCCCctatggggataaaaatttctatcgaaatctaTTGTTCCCGAGCT TAAAATATCCTGTGGGAATGGTTTAGGACAGcaaatttttgaattgaatt tcgaatagggatgaaatcaaagtctatttcccagtggggatgaaattacG AAGATTTGGCCAAATCTCTCAGTGGGGCTGGAGTCTCAGggggtctgtga tacagggaTGTCCTAATGGGTTCTCTAAATTCTATCACCTATAGTTTAAA GATGATTCTACCgtggtcactgagacagggacgCATTTCAGAAAACTGAT GTCTTTTTCTGTTTCAGACATAAAATTATTCACATTATTTCAaccgtagc tgccaattgccgcgcaGGCACTTTTGTCCGTTCTATTCTTTTTTCACATC TAAAGACCGtagaaaaatgtgtaaaaaaagattggatcgagtatagggtg gtaaattaaataataaagtggtaTGTGCCTAACCGCGNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcaaaaaaatc aaaaaatcacagaaaaaatcaaaaaatcacaaaaaaatcaaaaatcaaaa atcatttcgtacgcttttttcgaagtgatttacccctcgcctAACCGCGC GactatggtcgaaaaggtgtattcacaTTTATCATAATTTTGAAACTCGC TAGACCAATATCTTTTCAATCTTCCTTCTAGAAAATTTCAAGCCTATATT ACAGAGCTTGGATCATTTGAAGCTTACTTCCCACCAATGATGGCAAGAAT TGGTTGCAGTCAAGAGATCgaattttatccaaaaagtGTTGGAAAACACG GCCTTGGTTTTGCATATCGTAAAGATTTCCCGTTCGGTAAAACAATATCA AATCTCATGGTTAAAATGAGGCAGCATGGagattttgaagatttgaagat TCGATGGTATAGTTCATCGCCATGTAATGGTATCAAACCGGTGGAGCAAT TCAATTGGACCTATTTCTCTGGGATTATGGTCATTGTTGGGGTAATGATG GCTATAGGTATATGCATCAATCTCTTTGAGCATAGCTTTGTTTTCATTAG AAAACATTACTTGAAGCATAAAGAAGAATCGGACCTGAAACATTTTTCTG AAATGAACACGAATGGTTTGAAGCATCATCAAAATGGTGGAAATGATGAA GGTTTGGTCAAAGCCAACAGAAATTTAAGTTTGTTTTTGGAAGATCTTGA AACAAGAATAGCTGAGAAAAGAAATCGTCTAATTTAGAGTGAGAGAGGTA ATGCTATCATATCTTCGGGATAATGGATTCGAAAATGCAGACTTTTCACA ACCTATTGTGCTTTTTATAataacatccccttctcacagaccagtTAAGG TTGCGAGGAAATAAAGCAGACTGCAAGCTGACGTGGATtgatatttcaat gtttttttatgaCCGGGGAGCTGAGTTACATTATTGTTTTCAATCATAAA ATTCAATCGCAATGAAAAAGAGCACCATATTTAGCAAtgaggattttttt atttaattattttcagctgggacaaaaattggagtataatttttcgGCGG gtacaatattttggccaatttttccagtgggagaaCCTAGAACcactttt taattaattttactAATAGACGTGATACCATTGCCCTGGAAGACACTGCT GCTGCATATCCTCATCTGTACATATTTTGCACAAATTTAAATTCGCATAA TTTAAATacttatttttagaaattttccaTAGATAAAGTTATAGATTgta gattttgtagatttttagaaaatttcaagTTGATCCATTATAACAtttaa ttttgatcattttgggcTCGAAAAGAACACTGTACATTGTgcgttgaaaa ttttattttcaataatttacCTCTAGACAGTGGTTTTACCCTGTGACATC

Coding sequence (CDS) from alignment at sc0000005:1069280..1091729+

>TCONS_00000734 ID=TCONS_00000734|Name=TCONS_00000734|organism=Clytia hemisphaerica|type=CDS|length=11130bp|location=Sequence derived from alignment at sc0000005:1069280..1091729+ (Clytia hemisphaerica)
ATGTTGTCTGAAAGGTTCTTCATAATTTCGGTAGAAATCTTCACAGTACT
TATTTGCCTGgttatttcaaatatttctacAACGACGGATAACTTGAACT
TTTATGTTACGACTGGTAATTCGTCTTCAAATGTTAATTCGGTCTGTCTC
TCGGAGCCTTGGAAATGTAAACTCGATTATCACCTGATCCACAATGGAAA
CCAGttGCTGGCAATTACTAACCAAGATATCCACAAAACATTATTTAATA
AATCGACTCATACCAACACGAAAAGTTTCTTCGTTACCTATGGTGTATGT
CATCATATTCGTGGCTTTTACATCATGAAGCTTTCTGGCTTCCTTGATAT
TTATTGCTCACCCCTATCCATAGAACCTTTCATTACCAATGATATTATCA
GCCATTTTAGCCACCTAGAAGATCTTCATATTCTCTTACATCCAGACTTG
CTCACTGTTTTCTTGGATATAATGGATCAAGAAATTACTttaagaaattt
ctttttctacatTGTGGCAATATCAGAGAAAGAAATGGAAACTTTAAAAA
TGCAATTTCCTCATTTGATGTTGGAGAGATCTGGTACTCGTGCAGCGGCT
AATATGCTGAGTGATTTCATCGCAAGCGTGGAACAGAATCAAAGGTTCAC
AACTAAAAAGAACAGTCTTCACCAAAGAAGAACCGTTGACCGTCGAACTA
ACAGTCTACGTAAACTGGCTTTAAGTAAGCGGAAAAAACGTCTCATTCGA
GTTGTTACCACGTGGTTTCCTCCTTATGTTGAAGAAATGACATCTGCCAT
ATTCCCTAAATGTAGCCCTGGTCATCAATGCGACATACCAGTCCGTGATG
ATAACAACACCAAGACATTATCCTGGAGAAAATCATGTTGCTCAGGGATG
TCTGTCGAGATTTTTGAGACTTTGGCAAGGGAATTAGACTTTAAGTATAC
TTTGTATGCAGTTGAGGATGGAAAGTTTGGATCTGAAGAAAATGGTACTT
GGAATGGTATGGTGGGCGATTTGGTTCGAGATAAAGCTGATATGGCAATT
AATGTTCTCAGTATTGTCTCCAAGAGAGCCACTGTAGTTCATTTCACTAG
CCACTACTTGGAGAGCTCTTTTGGGATTTTAAGAATCAAGCAGCCGGTCA
TTCCGTTTCCAAGTTGGGaatttctaaagcctttgactGTTGAATTGGAG
CTGGTGATTTTATCATGTACTTTGGTGTCAATTCTGTTGATTATGATGTT
GGAGAATGTTGGTTACTTAATGAAAGCAAATCAAAGGTTTTCATTTCGAG
AAGTGATGACCTATGTCTTTGGATTAACATTTCAAAGAGACATGGGTGGT
ACAAATCCTCGAATGTGGTCAGGACGTCTTGCTGCTCTTGGTTATGCATC
TGCAATGACCATCATCATGTCTATCTATACTGCCAGAATCACTGCGAATT
CCATCGCTCAAAATGTTAATGATGATTTCAAAGGCTTCCAAGATGAGAGA
TTTAGAAACCCAACATCAAAGTACAAGTTCTCAGTGGTTGGTGGACAAGG
TTATTCACAAGAATTGTACTTTGAGAACCACAATGATCCAGCCTTCAGGA
GAATGCATGAATTTATGAAACCGTATTttgttgatgatgatgaagTGGGT
GTTCGAATGTTGATGGAAGGAAAATTTCAAGCCTATATTACAGAGCTTGG
ATCATTTGAAGCTTACTTCCCACCAATGATGGCAAGAATTGGTTGCAGTC
AAGAGATCgaattttatccaaaaagtGTTGGAAAACACGGCCTTGGTTTT
GCATATCGTAAAGATTTCCCGTTCGGTAAAACAATATCAAATCTCATGGT
TAAAATGAGGCAGCATGGagattttgaagatttgaagatTCGATGGTATA
GTTCATCGCCATGTAATGGTATCAAACCGGTGGAGCAATTCAATTGGACC
TATTTCTCTGGGATTATGGTCATTGTTGGGGTAATGATGGCTATAGGTAT
ATGCATCAATCTCTTTGAGCATAGCTTTGTTTTCATTAGAAAACATTACT
TGAAGCATAAAGAAGAATCGGACCTGAAACATTTTTCTGAAATGAACACG
AATGGTTTGAAGCATCATCAAAATGGTGGAAATGATGAAGGTTTGGTCAA
AGCCAACAGAAATTTAAGTTTGTTTTTGGAAGATCTTGAAACAAGAATAG
CTGAGAAAAGAAATCGTCTAATTTAGATGTTGTCTGAAAGGTTCTTCATA
ATTTCGGTAGAAATCTTCACAGTACTTATTTGCCTGgttatttcaaatat
ttctacAACGACGGATAACTTGAACTTTTATGTTACGACTGGTAATTCGT
CTTCAAATGTTAATTCGGTCTGTCTCTCGGAGCCTTGGAAATGTAAACTC
GATTATCACCTGATCCACAATGGAAACCAGttGCTGGCAATTACTAACCA
AGATATCCACAAAACATTATTTAATAAATCGACTCATACCAACACGAAAA
GTTTCTTCGTTACCTATGGTGTATGTCATCATATTCGTGGCTTTTACATC
ATGAAGCTTTCTGGCTTCCTTGATATTTATTGCTCACCCCTATCCATAGA
ACCTTTCATTACCAATGATATTATCAGCCATTTTAGCCACCTAGAAGATC
TTCATATTCTCTTACATCCAGACTTGCTCACTGTTTTCTTGGATATAATG
GATCAAGAAATTACTttaagaaatttctttttctacatTGTGGCAATATC
AGAGAAAGAAATGGAAACTTTAAAAATGCAATTTCCTCATTTGATGTTGG
AGAGATCTGGTACTCGTGCAGCGGCTAATATGCTGAGTGATTTCATCGCA
AGCGTGGAACAGAATCAAAGGTTCACAACTAAAAAGAACAGTCTTCACCA
AAGAAGAACCGTTGACCGTCGAACTAACAGTCTACGTAAACTGGCTTTAA
GTAAGCGGAAAAAACGTCTCATTCGAGTTGTTACCACGTGGTTTCCTCCT
TATGTTGAAGAAATGACATCTGCCATATTCCCTAAATGTAGCCCTGGTCA
TCAATGCGACATACCAGTCCGTGATGATAACAACACCAAGACATTATCCT
GGAGAAAATCATGTTGCTCAGGGATGTCTGTCGAGATTTTTGAGACTTTG
GCAAGGGAATTAGACTTTAAGTATACTTTGTATGCAGTTGAGGATGGAAA
GTTTGGATCTGAAGAAAATGGTACTTGGAATGGTATGGTGGGCGATTTGG
TTCGAGATAAAGCTGATATGGCAATTAATGTTCTCAGTATTGTCTCCAAG
AGAGCCACTGTAGTTCATTTCACTAGCCACTACTTGGAGAGCTCTTTTGG
GATTTTAAGAATCAAGCAGCCGGTCATTCCGTTTCCAAGTTGGGaatttc
taaagcctttgactGTTGAATTGGAGCTGGTGATTTTATCATGTACTTTG
GTGTCAATTCTGTTGATTATGATGTTGGAGAATGTTGGTTACTTAATGAA
AGCAAATCAAAGGTTTTCATTTCGAGAAGTGATGACCTATGTCTTTGGAT
TAACATTTCAAAGAGACATGGGTGGTACAAATCCTCGAATGTGGTCAGGA
CGTCTTGCTGCTCTTGGTTATGCATCTGCAATGACCATCATCATGTCTAT
CTATACTGCCAGAATCACTGCGAATTCCATCGCTCAAAATGTTAATGATG
ATTTCAAAGGCTTCCAAGATGAGAGATTTAGAAACCCAACATCAAAGTAC
AAGTTCTCAGTGGTTGGTGGACAAGGTTATTCACAAGAATTGTACTTTGA
GAACCACAATGATCCAGCCTTCAGGAGAATGCATGAATTTATGAAACCGT
ATTttgttgatgatgatgaagTGGGTGTTCGAATGTTGATGGAAGGAAAA
TTTCAAGCCTATATTACAGAGCTTGGATCATTTGAAGCTTACTTCCCACC
AATGATGGCAAGAATTGGTTGCAGTCAAGAGATCgaattttatccaaaaa
gtGTTGGAAAACACGGCCTTGGTTTTGCATATCGTAAAGATTTCCCGTTC
GGTAAAACAATATCAAATCTCATGGTTAAAATGAGGCAGCATGGagattt
tgaagatttgaagatTCGATGGTATAGTTCATCGCCATGTAATGGTATCA
AACCGGTGGAGCAATTCAATTGGACCTATTTCTCTGGGATTATGGTCATT
GTTGGGGTAATGATGGCTATAGGTATATGCATCAATCTCTTTGAGCATAG
CTTTGTTTTCATTAGAAAACATTACTTGAAGCATAAAGAAGAATCGGACC
TGAAACATTTTTCTGAAATGAACACGAATGGTTTGAAGCATCATCAAAAT
GGTGGAAATGATGAAGGTTTGGTCAAAGCCAACAGAAATTTAAGTTTGTT
TTTGGAAGATCTTGAAACAAGAATAGCTGAGAAAAGAAATCGTCTAATTT
AGATGTTGTCTGAAAGGTTCTTCATAATTTCGGTAGAAATCTTCACAGTA
CTTATTTGCCTGgttatttcaaatatttctacAACGACGGATAACTTGAA
CTTTTATGTTACGACTGGTAATTCGTCTTCAAATGTTAATTCGGTCTGTC
TCTCGGAGCCTTGGAAATGTAAACTCGATTATCACCTGATCCACAATGGA
AACCAGttGCTGGCAATTACTAACCAAGATATCCACAAAACATTATTTAA
TAAATCGACTCATACCAACACGAAAAGTTTCTTCGTTACCTATGGTGTAT
GTCATCATATTCGTGGCTTTTACATCATGAAGCTTTCTGGCTTCCTTGAT
ATTTATTGCTCACCCCTATCCATAGAACCTTTCATTACCAATGATATTAT
CAGCCATTTTAGCCACCTAGAAGATCTTCATATTCTCTTACATCCAGACT
TGCTCACTGTTTTCTTGGATATAATGGATCAAGAAATTACTttaagaaat
ttctttttctacatTGTGGCAATATCAGAGAAAGAAATGGAAACTTTAAA
AATGCAATTTCCTCATTTGATGTTGGAGAGATCTGGTACTCGTGCAGCGG
CTAATATGCTGAGTGATTTCATCGCAAGCGTGGAACAGAATCAAAGGTTC
ACAACTAAAAAGAACAGTCTTCACCAAAGAAGAACCGTTGACCGTCGAAC
TAACAGTCTACGTAAACTGGCTTTAAGTAAGCGGAAAAAACGTCTCATTC
GAGTTGTTACCACGTGGTTTCCTCCTTATGTTGAAGAAATGACATCTGCC
ATATTCCCTAAATGTAGCCCTGGTCATCAATGCGACATACCAGTCCGTGA
TGATAACAACACCAAGACATTATCCTGGAGAAAATCATGTTGCTCAGGGA
TGTCTGTCGAGATTTTTGAGACTTTGGCAAGGGAATTAGACTTTAAGTAT
ACTTTGTATGCAGTTGAGGATGGAAAGTTTGGATCTGAAGAAAATGGTAC
TTGGAATGGTATGGTGGGCGATTTGGTTCGAGATAAAGCTGATATGGCAA
TTAATGTTCTCAGTATTGTCTCCAAGAGAGCCACTGTAGTTCATTTCACT
AGCCACTACTTGGAGAGCTCTTTTGGGATTTTAAGAATCAAGCAGCCGGT
CATTCCGTTTCCAAGTTGGGaatttctaaagcctttgactGTTGAATTGG
AGCTGGTGATTTTATCATGTACTTTGGTGTCAATTCTGTTGATTATGATG
TTGGAGAATGTTGGTTACTTAATGAAAGCAAATCAAAGGTTTTCATTTCG
AGAAGTGATGACCTATGTCTTTGGATTAACATTTCAAAGAGACATGGGTG
GTACAAATCCTCGAATGTGGTCAGGACGTCTTGCTGCTCTTGGTTATGCA
TCTGCAATGACCATCATCATGTCTATCTATACTGCCAGAATCACTGCGAA
TTCCATCGCTCAAAATGTTAATGATGATTTCAAAGGCTTCCAAGATGAGA
GATTTAGAAACCCAACATCAAAGTACAAGTTCTCAGTGGTTGGTGGACAA
GGTTATTCACAAGAATTGTACTTTGAGAACCACAATGATCCAGCCTTCAG
GAGAATGCATGAATTTATGAAACCGTATTttgttgatgatgatgaagTGG
GTGTTCGAATGTTGATGGAAGGAAAATTTCAAGCCTATATTACAGAGCTT
GGATCATTTGAAGCTTACTTCCCACCAATGATGGCAAGAATTGGTTGCAG
TCAAGAGATCgaattttatccaaaaagtGTTGGAAAACACGGCCTTGGTT
TTGCATATCGTAAAGATTTCCCGTTCGGTAAAACAATATCAAATCTCATG
GTTAAAATGAGGCAGCATGGagattttgaagatttgaagatTCGATGGTA
TAGTTCATCGCCATGTAATGGTATCAAACCGGTGGAGCAATTCAATTGGA
CCTATTTCTCTGGGATTATGGTCATTGTTGGGGTAATGATGGCTATAGGT
ATATGCATCAATCTCTTTGAGCATAGCTTTGTTTTCATTAGAAAACATTA
CTTGAAGCATAAAGAAGAATCGGACCTGAAACATTTTTCTGAAATGAACA
CGAATGGTTTGAAGCATCATCAAAATGGTGGAAATGATGAAGGTTTGGTC
AAAGCCAACAGAAATTTAAGTTTGTTTTTGGAAGATCTTGAAACAAGAAT
AGCTGAGAAAAGAAATCGTCTAATTTAGATGTTGTCTGAAAGGTTCTTCA
TAATTTCGGTAGAAATCTTCACAGTACTTATTTGCCTGgttatttcaaat
atttctacAACGACGGATAACTTGAACTTTTATGTTACGACTGGTAATTC
GTCTTCAAATGTTAATTCGGTCTGTCTCTCGGAGCCTTGGAAATGTAAAC
TCGATTATCACCTGATCCACAATGGAAACCAGttGCTGGCAATTACTAAC
CAAGATATCCACAAAACATTATTTAATAAATCGACTCATACCAACACGAA
AAGTTTCTTCGTTACCTATGGTGTATGTCATCATATTCGTGGCTTTTACA
TCATGAAGCTTTCTGGCTTCCTTGATATTTATTGCTCACCCCTATCCATA
GAACCTTTCATTACCAATGATATTATCAGCCATTTTAGCCACCTAGAAGA
TCTTCATATTCTCTTACATCCAGACTTGCTCACTGTTTTCTTGGATATAA
TGGATCAAGAAATTACTttaagaaatttctttttctacatTGTGGCAATA
TCAGAGAAAGAAATGGAAACTTTAAAAATGCAATTTCCTCATTTGATGTT
GGAGAGATCTGGTACTCGTGCAGCGGCTAATATGCTGAGTGATTTCATCG
CAAGCGTGGAACAGAATCAAAGGTTCACAACTAAAAAGAACAGTCTTCAC
CAAAGAAGAACCGTTGACCGTCGAACTAACAGTCTACGTAAACTGGCTTT
AAGTAAGCGGAAAAAACGTCTCATTCGAGTTGTTACCACGTGGTTTCCTC
CTTATGTTGAAGAAATGACATCTGCCATATTCCCTAAATGTAGCCCTGGT
CATCAATGCGACATACCAGTCCGTGATGATAACAACACCAAGACATTATC
CTGGAGAAAATCATGTTGCTCAGGGATGTCTGTCGAGATTTTTGAGACTT
TGGCAAGGGAATTAGACTTTAAGTATACTTTGTATGCAGTTGAGGATGGA
AAGTTTGGATCTGAAGAAAATGGTACTTGGAATGGTATGGTGGGCGATTT
GGTTCGAGATAAAGCTGATATGGCAATTAATGTTCTCAGTATTGTCTCCA
AGAGAGCCACTGTAGTTCATTTCACTAGCCACTACTTGGAGAGCTCTTTT
GGGATTTTAAGAATCAAGCAGCCGGTCATTCCGTTTCCAAGTTGGGaatt
tctaaagcctttgactGTTGAATTGGAGCTGGTGATTTTATCATGTACTT
TGGTGTCAATTCTGTTGATTATGATGTTGGAGAATGTTGGTTACTTAATG
AAAGCAAATCAAAGGTTTTCATTTCGAGAAGTGATGACCTATGTCTTTGG
ATTAACATTTCAAAGAGACATGGGTGGTACAAATCCTCGAATGTGGTCAG
GACGTCTTGCTGCTCTTGGTTATGCATCTGCAATGACCATCATCATGTCT
ATCTATACTGCCAGAATCACTGCGAATTCCATCGCTCAAAATGTTAATGA
TGATTTCAAAGGCTTCCAAGATGAGAGATTTAGAAACCCAACATCAAAGT
ACAAGTTCTCAGTGGTTGGTGGACAAGGTTATTCACAAGAATTGTACTTT
GAGAACCACAATGATCCAGCCTTCAGGAGAATGCATGAATTTATGAAACC
GTATTttgttgatgatgatgaagTGGGTGTTCGAATGTTGATGGAAGGAA
AATTTCAAGCCTATATTACAGAGCTTGGATCATTTGAAGCTTACTTCCCA
CCAATGATGGCAAGAATTGGTTGCAGTCAAGAGATCgaattttatccaaa
aagtGTTGGAAAACACGGCCTTGGTTTTGCATATCGTAAAGATTTCCCGT
TCGGTAAAACAATATCAAATCTCATGGTTAAAATGAGGCAGCATGGagat
tttgaagatttgaagatTCGATGGTATAGTTCATCGCCATGTAATGGTAT
CAAACCGGTGGAGCAATTCAATTGGACCTATTTCTCTGGGATTATGGTCA
TTGTTGGGGTAATGATGGCTATAGGTATATGCATCAATCTCTTTGAGCAT
AGCTTTGTTTTCATTAGAAAACATTACTTGAAGCATAAAGAAGAATCGGA
CCTGAAACATTTTTCTGAAATGAACACGAATGGTTTGAAGCATCATCAAA
ATGGTGGAAATGATGAAGGTTTGGTCAAAGCCAACAGAAATTTAAGTTTG
TTTTTGGAAGATCTTGAAACAAGAATAGCTGAGAAAAGAAATCGTCTAAT
TTAGATGTTGTCTGAAAGGTTCTTCATAATTTCGGTAGAAATCTTCACAG
TACTTATTTGCCTGgttatttcaaatatttctacAACGACGGATAACTTG
AACTTTTATGTTACGACTGGTAATTCGTCTTCAAATGTTAATTCGGTCTG
TCTCTCGGAGCCTTGGAAATGTAAACTCGATTATCACCTGATCCACAATG
GAAACCAGttGCTGGCAATTACTAACCAAGATATCCACAAAACATTATTT
AATAAATCGACTCATACCAACACGAAAAGTTTCTTCGTTACCTATGGTGT
ATGTCATCATATTCGTGGCTTTTACATCATGAAGCTTTCTGGCTTCCTTG
ATATTTATTGCTCACCCCTATCCATAGAACCTTTCATTACCAATGATATT
ATCAGCCATTTTAGCCACCTAGAAGATCTTCATATTCTCTTACATCCAGA
CTTGCTCACTGTTTTCTTGGATATAATGGATCAAGAAATTACTttaagaa
atttctttttctacatTGTGGCAATATCAGAGAAAGAAATGGAAACTTTA
AAAATGCAATTTCCTCATTTGATGTTGGAGAGATCTGGTACTCGTGCAGC
GGCTAATATGCTGAGTGATTTCATCGCAAGCGTGGAACAGAATCAAAGGT
TCACAACTAAAAAGAACAGTCTTCACCAAAGAAGAACCGTTGACCGTCGA
ACTAACAGTCTACGTAAACTGGCTTTAAGTAAGCGGAAAAAACGTCTCAT
TCGAGTTGTTACCACGTGGTTTCCTCCTTATGTTGAAGAAATGACATCTG
CCATATTCCCTAAATGTAGCCCTGGTCATCAATGCGACATACCAGTCCGT
GATGATAACAACACCAAGACATTATCCTGGAGAAAATCATGTTGCTCAGG
GATGTCTGTCGAGATTTTTGAGACTTTGGCAAGGGAATTAGACTTTAAGT
ATACTTTGTATGCAGTTGAGGATGGAAAGTTTGGATCTGAAGAAAATGGT
ACTTGGAATGGTATGGTGGGCGATTTGGTTCGAGATAAAGCTGATATGGC
AATTAATGTTCTCAGTATTGTCTCCAAGAGAGCCACTGTAGTTCATTTCA
CTAGCCACTACTTGGAGAGCTCTTTTGGGATTTTAAGAATCAAGCAGCCG
GTCATTCCGTTTCCAAGTTGGGaatttctaaagcctttgactGTTGAATT
GGAGCTGGTGATTTTATCATGTACTTTGGTGTCAATTCTGTTGATTATGA
TGTTGGAGAATGTTGGTTACTTAATGAAAGCAAATCAAAGGTTTTCATTT
CGAGAAGTGATGACCTATGTCTTTGGATTAACATTTCAAAGAGACATGGG
TGGTACAAATCCTCGAATGTGGTCAGGACGTCTTGCTGCTCTTGGTTATG
CATCTGCAATGACCATCATCATGTCTATCTATACTGCCAGAATCACTGCG
AATTCCATCGCTCAAAATGTTAATGATGATTTCAAAGGCTTCCAAGATGA
GAGATTTAGAAACCCAACATCAAAGTACAAGTTCTCAGTGGTTGGTGGAC
AAGGTTATTCACAAGAATTGTACTTTGAGAACCACAATGATCCAGCCTTC
AGGAGAATGCATGAATTTATGAAACCGTATTttgttgatgatgatgaagT
GGGTGTTCGAATGTTGATGGAAGGAAAATTTCAAGCCTATATTACAGAGC
TTGGATCATTTGAAGCTTACTTCCCACCAATGATGGCAAGAATTGGTTGC
AGTCAAGAGATCgaattttatccaaaaagtGTTGGAAAACACGGCCTTGG
TTTTGCATATCGTAAAGATTTCCCGTTCGGTAAAACAATATCAAATCTCA
TGGTTAAAATGAGGCAGCATGGagattttgaagatttgaagatTCGATGG
TATAGTTCATCGCCATGTAATGGTATCAAACCGGTGGAGCAATTCAATTG
GACCTATTTCTCTGGGATTATGGTCATTGTTGGGGTAATGATGGCTATAG
GTATATGCATCAATCTCTTTGAGCATAGCTTTGTTTTCATTAGAAAACAT
TACTTGAAGCATAAAGAAGAATCGGACCTGAAACATTTTTCTGAAATGAA
CACGAATGGTTTGAAGCATCATCAAAATGGTGGAAATGATGAAGGTTTGG
TCAAAGCCAACAGAAATTTAAGTTTGTTTTTGGAAGATCTTGAAACAAGA
ATAGCTGAGAAAAGAAATCGTCTAATTTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000461XLOC_000461Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000734-exon-sc0000005-1491911889:1069280..1069589TCONS_00000734-exon-sc0000005-1491911889:1069280..1069589Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1510915933:1069280..1069589TCONS_00000734-exon-sc0000005-1510915933:1069280..1069589Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1575043694:1069280..1069589TCONS_00000734-exon-sc0000005-1575043694:1069280..1069589Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1491911889:1070065..1070519TCONS_00000734-exon-sc0000005-1491911889:1070065..1070519Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1510915933:1070065..1070519TCONS_00000734-exon-sc0000005-1510915933:1070065..1070519Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1575043694:1070065..1070519TCONS_00000734-exon-sc0000005-1575043694:1070065..1070519Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1491911889:1085147..1085987TCONS_00000734-exon-sc0000005-1491911889:1085147..1085987Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1510915933:1085147..1085987TCONS_00000734-exon-sc0000005-1510915933:1085147..1085987Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1575043694:1085147..1085987TCONS_00000734-exon-sc0000005-1575043694:1085147..1085987Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1491911889:1086887..1087056TCONS_00000734-exon-sc0000005-1491911889:1086887..1087056Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1510915933:1086887..1087056TCONS_00000734-exon-sc0000005-1510915933:1086887..1087056Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1575043694:1086887..1087056TCONS_00000734-exon-sc0000005-1575043694:1086887..1087056Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1491911889:1090511..1091729TCONS_00000734-exon-sc0000005-1491911889:1090511..1091729Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1510915933:1090511..1091729TCONS_00000734-exon-sc0000005-1510915933:1090511..1091729Clytia hemisphaericaexon
TCONS_00000734-exon-sc0000005-1575043694:1090511..1091729TCONS_00000734-exon-sc0000005-1575043694:1090511..1091729Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000734-proteinTCONS_00000734-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000005supercontigsc0000005:1069280..1091729 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0127343 0 0.0144184 0 0.0515187 0.0135703 0.311067 0.321872 0.67605 0.39876 0.425751 0.432529 2.37137 1.29291 0.404933 0.543194 0.659611 0.803458 2.59907 2.39394 1.72371 1.24313 1.27028 2.62832 2.62507 3.9901 0.69845 0.372702 0.0424022 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
Vocabulary: Molecular Function
TermDefinition
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
molecular_function GO:0005234 extracellular-glutamate-gated ion channel activity
molecular_function GO:0004970 ionotropic glutamate receptor activity
Blast
BLAST of TCONS_00000734 vs. Swiss-Prot (Human)
Match: NMD3A (Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens GN=GRIN3A PE=1 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 2.341e-42
Identity = 121/452 (26.77%), Postives = 200/452 (44.25%), Query Frame = 2
Query:  917 CSPGHQCDIPVRDD--------------NNTKTLSWRKSCCSGMSVEIFETLARELDFKYTLYAVEDGKFGSEENGTWNGMVGDLVRDKADMAINVLSIVSKRATVVHFTSHYLESSFGIL-RIKQPVIPFPSWEFLKPLTVELEL---VILSCTLVSILLIMMLENVGYLMKANQR---FSFREVMTYVFGLTFQRDMGGTNPRMWSGRLAALGYASAMTIIMSIYTARITANSIAQNVNDDFKGFQDERFRNPTSKYKFSVVGGQGYSQELYFENHNDPAFRRMHEFMKPYFVDDDEVGVRMLMEG--KFQAYITELGSFEAYFPPMMARIGCSQEIEFYPKSVGKHGLGFAYRKDFPFGKTISNLMVKMRQHGDFEDLKIRWYSSSPCN----GIKPVEQFNWTYFSGIMVIVGVMMAIGICINLFEHSFVFIRKHYLKHKEESDLKHF 2191
            C  G  C  P+ +D              N+T  + ++K CC G  +++ E +A +++F + LY V DGK+G+ +NG W G+VGDL+R  A MA+   SI + R+ V+ FTS +  +S GIL R +    P  +  F+ PL   + L   V L  T V + L       G   K   R   FSF   +   + L F R +    P+ W+GR     +A      +S YTA + A  + + + ++  G  D +  +P+  ++F  V      +E   E++   +F  MHE+M+ Y V     GV  L     K  A+I +    +         I    ++    K     G G     + P    IS L+ + + HG  + L  +WY   PC      +    Q    +FSG+ V++ +   + I   + EH  +  R    + K +S L+++
Sbjct:  537 CPAGQLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKK-CCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGA--FMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTV------RESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLDAFIMDKALLD-----YEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEH--IVYRLLLPRIKNKSKLQYW 972          
The following BLAST results are available for this feature:
BLAST of TCONS_00000734 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NMD3A2.341e-4226.77Glutamate receptor ionotropic, NMDA 3A OS=Homo sap... [more]
back to top