Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000612 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000612
Unique NameTCONS_00000612
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1597

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000612 ID=TCONS_00000612|Name=TCONS_00000612|organism=Clytia hemisphaerica|type=transcript|length=1597bp
AAAAAGCAAGCGATTTAGAAGATTGGCTTTGTTGGCGGAACACACGAAGG
TGGCGACCCGTCTTTCTTTTAAGAAGGACGATGAAACGGTTTTTGGTTTC
GGTGTTGTGTTTGGTACTTCTTATTCAAAATGTTGAATCACAACGCAAAA
ACAAAAGCATCAAAAAGGTAATGTTGCTGAGGGTTACTCCAACGAACGAA
CAGCAATTGGACTTTCTGACATCATTGAAGACATATAAAGGTGACTTGAA
GATTCAACTTTGGAGACATCCAGACGAAGTTGATCGCCACGTCGATGTCT
GGATATCACCAAAATCAAttgacaaatttaaaaaactttctgGAGCTTTG
AACATGACATATgaagttttgacaaaaaatattttcgatgaATGGGACAA
AGAATATTCTATGAATAATATCGAAGATTTTGATATGGTCTATCAAAAAT
ATGACGAGATAGTTGGAGAATTGAAACGACTTGCATCTGTTTATTCAGAC
ATTATGGAGTTACAAAGTATCGGAAAATCTTACGAGAAAAATGATATATA
CTCAGTTCATATTAGTTTAAATCGAAGTGACAGTCGTGAAATCATTTATT
TGAACTGTGGATCACACGCAAGAGAATTCTTATCCGTCTCTTCATGCAAA
TATGTCATTCGAAAGATTCTGTTCGATTCTAAATATGAtgataaaatcaa
agatttGTTGCATAATTTCGACATTGTGATGACACCGCTATTGAATCCAG
ATGGTTATATTTTTGCACACAATAAAAAACTCAAGCTGAACAGACTATGG
CGTAAATCACGTTCACCGACTTCTGATCGAACTTGTTATGGAGTTGATTT
GAACCGGAATTTCGATCATCGATGGGGAGGATACGGTGGTTCTGGTGATC
CATGTGATAACATATACAGCGGGCCACGTCCTTTTTCCGAACAAGAAACG
CTGTCTTTAGCACGCTACCTATACAAATTACGACGTCGTCTGGTATCTTA
CATGGACGTCCACGTTTNGCACGCTACCTGTACAAATTACGACGTCGTCT
GGTATCTTACATGGATGTCCACGTTTTTGGTCAACTCTGGATGAGTCCAT
GGGGATATTCAAGTACAACACCAAAGCATGCTGCTATACATGAGGCCATG
CTGAAACAAATTAAAGCAAATTTATTCAAAGAGCAGAACATCGTTTACGA
AGTTGGACAGTCTGCAGTAGTATTATatCAAACAAGCGGCGACTCTATCG
ATTGGGTATACGGCCGTCTTGGTGTCGTTCACTCTTATGGCGTCGAATTA
CGCCCTAACCTGACTGTAAGGCGTGGTTTCCGATATCATTCCAACTTTAC
AAAACCTACTGGAGAAGATCTTCTCGTAGGTATTATGACGATCTCAAATG
AATTGTCAAGAGAGAGAAATGAGAGAATGGGTGCTATGCTATGATGAATA
GTTGGTatctttttctgaaagattttctaaaagattattttattttttga
atatttaacaaatgaaataaaaattttataccATAACTTGGACCTATCTT
TATTCATGGCGTTTCGAAATTATTAGAGTATCGATATTTCATTGGGG
Run BLAST on NCBI

protein sequence of Secreted carboxypeptidase

>TCONS_00000612-protein ID=TCONS_00000612-protein|Name=Secreted carboxypeptidase|organism=Clytia hemisphaerica|type=polypeptide|length=363bp
KASDLEDWLCWRNTRRWRPVFLLRRTMKRFLVSVLCLVLLIQNVESQRKN
KSIKKVMLLRVTPTNEQQLDFLTSLKTYKGDLKIQLWRHPDEVDRHVDVW
ISPKSIDKFKKLSGALNMTYEVLTKNIFDEWDKEYSMNNIEDFDMVYQKY
DEIVGELKRLASVYSDIMELQSIGKSYEKNDIYSVHISLNRSDSREIIYL
NCGSHAREFLSVSSCKYVIRKILFDSKYDDKIKDLLHNFDIVMTPLLNPD
GYIFAHNKKLKLNRLWRKSRSPTSDRTCYGVDLNRNFDHRWGGYGGSGDP
CDNIYSGPRPFSEQETLSLARYLYKLRRRLVSYMDVHVXHATCTNYDVVW
YLTWMSTFLVNSG
Run BLAST on NCBI

transcript from alignment at sc0000002:1545150..1556722-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000612 ID=TCONS_00000612|Name=TCONS_00000612|organism=Clytia hemisphaerica|type=transcript|length=11573bp|location=Sequence derived from alignment at sc0000002:1545150..1556722- (Clytia hemisphaerica)
AAAAAGCAAGCGATTTAGAAGATTGGCTTTGTTGGCGGAACACACGTAAG GAACTGATATTTCGTGCATTCACAAGAATTGACACACCAAGGAGCAATCT CTCTGAAGTTGTGCATGCCGGATGGAAGAACAAAGGGAACATAGGATTAA GCTTGGGAGAAACCTGTACTTTTGACGTCAAGAAAAGCCTTCTTCTTTCC CAGAACATAAAGGATTTTGAGATGAGAATGGGAGTTGAACCTTCGATTGT GGAATTCCAGGAGAGGAGACCTGAACGACAAGCTGAAGCAGCAAGTCGAT TCAGTGGAGATCTATTGGATTTTGGAGTNGGAATTCCAGGAGAGGAGAGC TGAACGACAAGCTGAAGCAGCAAGTCGATTCGGTGGAGATCTATTGGATT TTGGAGACTCGAAGGTCGCTCCACAAAAGAAAGGAACCCCAAGTACAGAA AAAGAGGGATGTAATCCCCCTGCGAAAAAGAAAATTGCTAGATATAAAAT GGTCACAAATTTTTCTTAAGAACTTCTGTTAAGAAAAGTAACGTTAAAAT AAGTTTTCGGGGAAAACAGGCTCACATTATCGGGAAATTGGGCACACAGA ATCGGGAAATTGAGAAATAAAAGATATTGTTAAATTATGCTTTAAAAATT CATGAGATTTCTCAATGTTTGCAAACTTTGCTCTTTGAAGGCCAGGGATT AAAAAAGCTATGAAAATCGGAATAAACGTTGAAATAGCTTGTGGAGTATG AAAATCGGGGAAACTTTTTAAGAAGCCTAAATGTAGTAAAATAAAAATTA TATAATACTAAGTTTTGATATCACAAAATTTATTAGAAAGTCTCGGTTTT AACACTCTTCACCATGACACCCACCACATGCGGCATCACAATAAAGCCCA TTACGACATAAGTTTGAGCTGTATGGTCGCCGGGAACTTGTTTTGCAATT GCATCGTAAGAAGCCACTCTGGTGCATAGGATAGTCCTCTTTCCACATTC AACACACCTATCTGCATCACCGTCACTTTGGTCTGTCAGGAATCCTTGCT TCTTGAACGCAGAGGAAAGCATTTTGATCAACTGAACTTTGTTGGATGGG TTAGATAAGAACAATTCTCTGTTGGTAGTCACTTTACCATCTAGTGAGAT GGCAACAGAAGCTGATGTTTTCCCCGATCGTCGATCATGTTCTTGTCCGT TTATTGACATTTCATCCTCGTATCCATCGAAATTTGAAATTGTTCTTGAG GAATTTGACATATTCTTCGATCACTGCTGAATATGTTGTTTTCGACCACG AGTTTTTGTGAGTAGCAATGAACCGCCATCAACGATGCATACATCGTGAG ATTTTAACTGGCATGCGTTTCTTTTGTTGATGAAGTGATTACGAAGGTTT GACTTTTGAGGTTTTTGCATCATTCCAAGCTTGAGTAATGATTTAGACTC GGGGGTTAGAAACAATAAACTCACCGGTTTCGTGAGCTGAGAACCAGTCG CTCTGTCTCCGAGATACGACGTTGACATCGTTGGATTCATCAGGCGGTAA CCTCCACAGCGTTTTCTCTTTCGCCCCTAGCTGCGACAGACTATGGAGGC GGAGGGCACCTCCCATGAGGTATCCTACCAACGTGGTGACTGACTCCTTA AGTTTGCAACGTCCCTCTTGGTCCAAATGAACCGAATTGTATTCTCAACA GTTTCCTCGATCTGTTCAACCATTTTCTTTCCTTCAGTACGATTAAAACC AAGATGCTTTAGTAGGCCATTGTTCTGAGACCAACAAAACCTCTGACTCC GACTTCAACGGGTAGACAAGTGACAGTCCAACCGTGATCCTTGCAATCGT TCACCAAATGATCATAGCGATCCTCTTTTCGTATCCTTGCAGCTTCCCAG GTCTCGACAGCTTCCCAGGTCTCGACTGGGAAATTGTACTCTTCGCCTGC AGGATCAGCCACTATTGTCCATAACCCAACCCAATAAGGATCGTTGATTA AAGCATTTTCTCGAGACGCTTTGAATGATTTCCCTTCCCTATGGAAAGGT ATNTCAGGATCGTTGATTGCCTTTTCTCGAGACGCTTTGAACGATTTTCT TTCCCTATGGAAAGGTATAGGTAAACGTACATCTCTGACCTTTGGGTTCT TGCCATCGTTTATCTCCCTAATCTTCACTCTGACAACATCAGCAATAACT TCCCAGGACGTGCATTGACCTTGCTGCGAGCACTGAGCTAGCTGGCGATG CCTCTTTCTTTCTACATCTTTCTTTCCAATTCCGACAATCTCTTTCCTTC TTTCCTACCGGCTCATGCACGAGAAACGTTTAAAGGTTGCATTTCCGAGT CCTTGTCAAGAGGTTTGCATCGAACCAACAATATCCTTGTGCTTCAGGTC AGTAATGATGAGATCTGTCTCTTCCTCAGCCTTCCACTTCCTTCCAGTTC TGATATCTGGAAGAGAGAAACGGATAAAGTCGTCAGTTGTTTCACGAAAC GTTAGCACGTGCCTTATCTTTTCAAATTTGTACAGGTCAACGATTGATGG AAAGGGCAACTGAAGGGGATACTTGTTTTTGTAGATTCCAGCCGTGACGA ACATCTTAGGGAGACCCCAGCCAGTTCCTTATCTTCAGTTATCTTCAGGG ACATTTTCTGTTGAATAATATTCACCCTTGAAACAGCAACTTCACAGATT GTTAAGGGCCACAACAGCTTAATCGTGAGTACAAATTGTATACACCAGAT TTTGAAAATCCCCGGTAACCTTGATTTTTCAATTTTATCAAGACCATCCT CTGACTCCCCAGACTCTTAACAGGCCCTTCTTTCAAAGTTGGCATTATTT CCCCAGCAACTGAGAACTTTGTTTCGATTTGTCTTCCTTTCGTTAACACC AGGTTTCTCGATTCATTAGCTTTGAACTTCATTCTACAATCAATGACAAA ATACTTGGCACAAAAGGGAAATTCACCGGGGTGTTTTGAAACCACAATCG ATTTGTAAGTGCTCTAAAGTAGGTTCGAAGGGTAGAGTTTTAACGCTAGC AATAAGACTTAGGACCTTAGGATCTGAGGATCCAAAAGTTAAAAAATGGT CCAGTAGGGCTTGAAATATAGCTTAGAAACCAATAAATCCCTCCCAGATC GAAATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNTCAAGTTGAAGGCCTGAAATTGA CATTCTCGCTCGAACTTCAATTTTCGAAAAATGGTAAATTAGCCAAAAGT GCCAATATATTATGGCACGGATTGTAGCCCAAGCAATCAAAATCTCTAGC CGCTCAAGAACCTCGCTTATCTTATCGTGTCTCCTTGTCAAAATGGTGAT ATCATCCATGAATGGCCTTTATAGTGGGTCGCTGACAGCTACCATGAAGT TCTGTTCCTCTCAAGATAAGTTCCATCGCAAGTATAAACCAAATGGGAGA AATAGTACAACCTGCAGAGATCTCAACCTCTAATCTTTGCCGTTCTGTTG TAAATGATCTTGTCGTGAAACTCATGACAAATTTTTGATAATAGCTCATC AACAAATCATCTATGTCATCAGGGATCCAGAAATGTCTCATTGAATACTC TAGCACCTTGTGGGGCACTAGCCCAAAAGCATTTGCTAGATCAAGAAAAA CAACGACTAAATCGAGCTTCTCTTTTTTGGCAATTTGTATTTCATCCCAA ATCATTGCTGAGTGTTCTATGAAACCTGGAGAACCTGGAATGCACGCTTT CTGAACGGTTTCATCGATGAACTGATTTCTAATGAGGAAATTCCTGACCC TTTTAGCCAGGATACCAAGGAAAATTTTACCATTCGTGTTCCCCAGTGCG ATTGATCTGAACTGAGAAATTGATTTGACGTCCGCTTCTTTGGGAATATA AATTCGTTCTGTGCGTGCCCATCTCTGGTTGATGAATTTCTTCTCCCACG CCTTCTTCAGGATTAGGAAAAGCCACTTAACAAGTTTCGGACATCTCTTA TAAACCTTGTAAGGTACACCATCTTGTCCAGGCGAACTCTCTTTGCTCTA GCTTTCTTTACAAAACTTCTCATCTCGTCCATTGCTAAATCCCCTGGTCT TGGAATGCCATTCATGTGATCAAGCGGCATCTTGCTCCCTTTTCCTCCCG TGAAAAGTAGAAATACATTTAATTTCTGGAGACAGCTTCTAATTTGCCAT TTTTGTCCTTGATTGTAGTCTCGTAAAAAGAGCTATTATTTGAAGAATGT TGAACTTGATACTGTAGCAAGTTGGTTTGAACTCACCAAGACCAGGGTAT TCTTAAGAAGTTACTGGTATATCTTGAGTTGACAAAATTCATCAGTGTGT CAGTCAACTACTAAATAAAAGTGTGTTTATTCAAGGATGACAAAATTCTG TCAAAAGCACAGAGATCCACCGAACACAGGTCCTTATTGTCACGTCATCA TTGACTTAGATCCTTCATCCACACATGCACTCCTCCTTCCTTTCGTTCAC AGCTCATGAACACTTTATATAAACCTTACAAAGATACGAAACAACGGGGG AGAGATAGTGTTTGACAGTTAAGTCAGACTGCAAACAAAAATAACTTTTT TTTTCAGTTCATTGATATCCTTTTATGATTTTTTCATAGAAGTCAAGGAA AACATGGATTTTTAACGTTGTAGAGAAAAACTTATCACGGATTTACTTAT AGAAAAAGTTAATTTTTTGACAAATTTTATTGGAATGGAAAGTTGATTTT TGCTAAATTTATTATAGTGAAATTTTTTTTTCATAACAATTCAGCAAGCA AAAACCGCTATTTGATTATAATTTCTTCAATCAAAAATTACAGCATCTTT CTTGTTCACTGCAGATTATTTTGAGACAGACTTTATATCCCTTCTCTAGA CCTTCTCTTAACTTTTATATAAGTAAATTTTTGCAAAACACGTGACCTTG TCAACAGATCTATAATTATTTATTTCAAGGAAGGTGGCGACCCGTCTTTC TTTTAAGAAGGACGATGAAACGGTTTTTGGTTTCGGTGTTGTGTTTGGTA CTTCTTATTCAAAATGTTGAATCACAACGCAAAAACAAAAGCATCAAAAA GTAAGTTAATTTCTCTCATATTCTCAAAATAGGCTGTTAAAACATACAGG GGGATGGACGAACCTCTTCAAGACAAAAAAATTATTGAAAATGTGTGGAT ACCCCCCCTGGAAAATGGCAAAACTTGCAAAAATACCCTAGGAAAGATTC TTTTCATACCTTAAAGTGAAGGTAGACGAACTGAAATCAGTCTTTTATCC CCTTGGAAAAATGAAAAAAAACCCTGGAAATTCTGCTCGGATCACCCACT GGAAATCTTCGTCCACCCCCCCCCCCTGTATGGATAAAAAATGGAGTGGC CCAATACTACGGGTTATAAGACAGGGTGAAGAGTCTACGTAGTAAAATTT TAAGTATGCTTTTCTCGAATTCGATCTTCAAGGAGTGTCTAAGACTTTTC CTCAGAAATTCGTTCTACCCAAATTTGATAAATTTGGAATCCAAATTTGG AATCATATTGCCTTAAAATAGTTTTCCGTCATTCAGCAAGTTAACAAAGT TTCTATGACTTCGATCTTACCACAACTAAGGGGTTGTTAGGACGAGAGAA AAAAACTTCGATGGGCTTTAAACGCACTGTAAGTGTAAGTGGTACCGGAA ATGTTTGAATATCAAAAGTTATTGTTTAGTTTGTTTTGTTTATGGTTTGA ATGACAGTTATGTAAACAAACAGTCAACACAAAAAATTCTTAACTTTGGT CGTCAACCCCATTCTAAAATAGAGTTCTGAAAATAACCTTTTTTATAAGC ATCTCTGCCCGCATTCTTGACTGTATTTCTCTTCTAATAATAAATACTTG CTTTGCCCTATCTACACTTTGTCAAACTCTCGATGTTTTATAAACACACC TCTGCCTCGCTAATACAAAGAGGACATTGCAACACACATAATGAAAAGTA TATTGCAACAAAAGGGGCAACTAAGCTCTGTCTCTGTTCTCAATAAAACC AATCCAAAATTGCAATCTAATATCGCACAACCGTCTTTAAAAGCCAAATT CTTTAAAAGTAAATCAATCTATTCATGACATCCCATTCTCACAGACTCGG TAGGACTTTTTCAGCCAGTGGGGATAGAAATAGCAGACTAAAACTCGATG GGGATTGATATTCCCATATTTTTTATGGCTGGGGATTTAAATTGCATTGC TTTCAAGTCAGAAAAATAGTGGGGATGGGGAAAACAGCATGATATTATGT AGTGAGGATTGGTTTGTTTGATTATTTTCAGTGGGGACAAAAATTGGAGT ACAATTTTCACTGGGGACGTTATTTTGGCCATTTTTTCCAGTGGGAAGGA TTCCCAGTGGATCTGTGAGAAGGGGGTGTTTTATGTCAGTGTGGAGGAGG GGACTTTTAAATCTCATGAAACTGATAAAACGACTTGTTGTTGGGAAAAA AGTTTGGATGTTTTGCATCTATGAAGGCTTACTATACCTTTCTTAGGGTA ATGTTGCTGAGGGTTACTCCAACGAACGAACAGCAATTGGACTTTCTGAC ATCATTGAAGACATATAAAGGTGACTTGAAGGTACGAGGTTAGATCTCCA CATTCACTGATTGAAGCCTTCCCCCAGCGGACCCAAAATTCACGCCATTA CGTCAATTCTTTTCAAATTTCACGATGTCACGCCTGTGAAATTCGATATT CACGATAAAGCCATTTTTTCTCGAAAATCACGCCACGGAAAACCCTGGGA GTTGCTAAATTCAAGCCACTCAAGCTCACGACTTGATTTTCATCAAAGCC AATCAAAAAATTAAAAGCGATGAGTCGTTTTTAAATAGGAAGCCCTTCGA TACTTTCTGTAGGTCAATACAAAGACAAGTATTTCCACAAAATTGGGGTG TCACTATTCTTTAGACTTATCCACGGCATCAATCATAGAAAACAAAAAGC CTTAGCCCGGGGGGGGGGTACTTAGGCAAAATTGGTGCCGGGTATGTGCG AGCCATAAGGGTACCTTTTCTCATTCCTCAAAAGTCTGAAAGGGTCCCAA AATCACGAAAATCAAAAATTTCTCTCTCAAAGGGTCACGATTTCCAAAAA TTTTGACCAAAATTTGCGTGAAAATCAAACCAAAATTTAGGAAAAAGTCT CTCAAAGGGTCCCAAAATCACCAAAATTTTGTCTCTCCAAGGGTCGATTT TCGATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNCCCCCCCCCCGGGAGCCTTAGCCTCACCATAT GAATTAATTCGATAAATTAGTCATGAGAAAAGGCATTTCTAGCGTGACTG TATTGTTGTTAACCACACTCTGAAGTTCTTAACTTCTGTCAACACAGATT CAACTTTGGAGACATCCAGACGAAGTTGATCGCCACGTCGATGTCTGGAT ATCACCAAAATCAATTGACAAATTTAAAAAACTTTCTGGAGCTTTGAACA TGACATATGAAGTTTTGACAAAAAATATTTTCGATGAATGGGACAAAGAA TATTCTATGAATAATATCGAAGATTTTGATATGGTCTATCAAAAATATGA CGAGGTATGTAATTATCACACCCGAAATATGTTTGCAATCTAATTATAAT TAGATGTAAAGCATGCAATCTTTAACTTCTTCACTACTGTTGGAAAGATT TTTCAATGCAATTTTCTCGGCTCGGCTTAAGCAAAATAGGTTATGTTTTG GTCTGTTGGAAAGCTCTTTTCAGGATCTATATTTTCAGTATGCCACATTT TGAAGCAGGTCCTCAATCAAAATCACCGGAAGCCAAAAGAATCGTTTATA AATGAAGGAATTTCAGTTTGGCAGTACTCATGAAGTAGAGAGCTGCCAGT GTATTATTACTATATTCAGAAACTCCACTGTGCCAGGAATACCTCCTTTT ACTCTTTTATTAAAGTAATAATACCCAATTCCCCTCACATTACATGAGTT GACTTGGGCGAAGGTATATTTACTTGCTAAGTGGATGTTAGCACTGAATA GGTATCGAAGCCCGACCTGCTGGACAGAAGTTAAAGCGGATAATCTCAAC ACCACACGTATCCATGAGAACTAGTGTATACATTATCAAGGTTTTCAGAA AAAAACAACTCAGATTTTGTCTCTTTGATTTCTGCTAACAGGGTCATTCG TCTTAAACTCTTGTTTAGATAGTTGGAGAATTGAAACGACTTGCATCTGT TTATTCAGACATTATGGAGTTACAAAGTATCGGAAAATCTTACGAGAAAA ATGATATATACTCAGTTCATGTAAGTTTATTTATTTTTGTTTATCTAACG TCTATCATTCTTTAACTATTCATGCATCCACAGCTGACATAAAACAGGCC CGAGGCTACATACGAAAAACAGGTGACGGGTATGTGCAAGCCATAAGGGT ACCCTTATTCATAACACCTTTATGTCATAGACCCAGACCCCCTTTCTACA ATCAGATTCCTATGCTTTATCCTCACAGAGAAAGCTTTTGGGTTATTATC AAGTATAGGTTCATTTAAAATGTTGAAGTTTTTCTGTTTCTCAGATTAGT TTAAATCGAAGTGACAGTCGTGAAATCATTTATTTGAACTGTGGATCACA CGCAAGAGAATTCTTATCCGTCTCTTCATGCAAATATGTCATTCGAAAGG TAAGACACTTTCATGAGCTAAATACATCATTTATCCAACTAACCTACTAG CTTTCAAAGAAGTTATCATTCAAAACCGCGCTGTCGATCGCAGAATTTTC TCCTTGATTGAATCTGAAAATAACCGCAATGTGAAACATGGTTCTCTCTC GTCTGTCTTTTTTAGATTCTGTTCGATTCTAAATATGATGATAAAATCAA AGATTTGTTGCATAATTTCGACATTGTGATGACACCGCTATTGAATCCAG ATGGTTATATTTTTGCACACAATAAAAAACTCAAGGTAGGTGCATAAGTT AATAAAAACGCCGTTAACGATGAGGGAACTTTTCTAATCTTTTCAACTTT GAGAAACTTTTATTCTCATGAAAGATTTCACTTCAATAGTCCCTTCGTAA AAATATTAGTTATTTTTCCTTTTCTCGAGGTCAGATTTCTTATCTCCACA TGCAGTAGAGTCTCCATAACTCGACCACGCACGGGGAAAACAAATTTGTT CGAGAAATTTCGAGTTATGGAGTAAGGTTTATAAGACATTGTTAACTCAA AGATCGAGAAAACTTGTTCGAGTTAAAAAGACATTCAAGTTATAGAGGTT CGAATTAAAGATACATTGTGGTTCGGGGCTCTTATATTAATAACCAACCA TACGCGATAAAGGATAATTTCTTTACAGCTGAACAGACTATGGCGTAAAT CACGTTCACCGACTTCTGATCGAACTTGTTATGGAGTTGATTTGAACCGG AATTTCGATCATCGATGGGGAGGTGAGATAAATCAATGCTTTTGTAAATC GAACGTTGAAGGGTGTTGTGATGTTGAGAGTATTGCATATTTTTACATGT TATTTTATGCTAAATACCCAAACCTGATTATAAGCATAAAGTTGGCGAAT ATTTTAGTCAAATTTTTACGAAATTGGTGTACCAGTCGATATTACACCCC CTTCTCACAGACCCAGTAGGATTTTCTCAGCCAGTGGGGATAAAAATGAC GGACTGTAACTGGATGGGGATTTATATTCCCATATTTTTTATGACTGGGG ATTCAAATTCTTTTGTTTTCAAGTCAGAAAAATTCAGTGGAGATAAGAAA CATAGCATCATAATATTTTGCAATGAGGGTTGGTTTATTTTATTATTTTC CGTGGGGGAAAAATTGAAGTATAGTTTTCCACCGGGACGATATTTTGGCC AAATTTTTCTAGTGGGAAAGGGTCCCAGTGGGTCTGTGAGAAGGGGGTGT GATATTTAAAATAATCAACCTTGAATGTTGATCTAATTTTCACTCTAAGA AATTCACATTTAGTTTCATAAACCTTTCAAAAATAATTTCTACTTTCTAA GTGTTTCTACTGCAGGATACGGTGGTTCTGGTGATCCATGTGATAACATA TACAGCGGGCCACGTCCTTTTTCCGAACAAGAAACGCTGTCTTTAGCACG CTACCTATACAAATTACGACGTCGTCTGGTATCTTACATGGACGTCCACG TTTNGCACGCTACCTGTACAAATTACGACGTCGTCTGGTATCTTACATGG ATGTCCACGTTTTTGGTCAACTCTGGATGAGTCCATGGGGATATTCAAGT ACAACACCAAAGCATGCTGCTATACATGAGGCCATGCTGAAACAAATTAA AGCAAATTTATTCAAAGAGCAGAACATCGTTTACGAAGTTGGACAGTCTG CAGTAGTATTATGTAAGCATTTTTAAACTTTGTATAAACCTAAAGAGGTA CATGGTGTGGTTTTATCAGCCCTTTTCTGGCGGCGTATGAAAAATTGTGA CGGTATTTTGGTGGCTAACTTGCAATGCAAAGATTTCAGCAATTATTTCT GTCGGTGTTGACGGATATTCAAAATATATGTAGTGACACCACCCCTCCTG AACGCCCCACACTAGCTGTAGACAAATAAAAATACCCTGTGTCGGCTTTC GAGATTCTCGTTTAAGTCTGGTTTAAGTCAAAAATTAATTTAAAAAGTTT ACATTAACGTGATGTAGAAGACTGTTCATCTAACGTTTCCAGATCATCTA AAAAGAACGACAAATAACATTCAAAAAGCGACTAAAAGAACCCTAACCCT AACCCTAACCCTAACTATCAAAAACGACATAATTTGGATATTAAAGACGT AAAAAATTTGGATTTGAATTTTGGTTCGGGAAATAAATCGGGTTAAAGTT TTGGTCGGGAATAAAAAAACCGGATACAAGTTTTGGTCGAGTGATAAAAT GTCGAGGGAAAATTAGGTAGCCTCTTTTTATACTTATGACAGAAATCTGT GTGAGACAGAAAACTATTCAAGTAAATATAATTCCTAGCATTTTTATTTT AGATCAAACAAGCGGCGACTCTATCGATTGGGTATACGGCCGTCTTGGTG TCGTTCACTCTTATGGCGTCGAATTACGCCCTAACCTGACTGTAAGGCGT GGTTTCCGATATCATTCCAACTTTACAAAACCTACTGGAGAAGATCTTCT CGTAGGTATTATGACGATCTCAAATGAATTGTCAAGAGAGAGAAATGAGA GAATGGGTGCTATGCTATGATGAATAGTTGGTATCTTTTTCTGAAAGATT TTCTAAAAGATTATTTTATTTTTTGAATATTTAACAAATGAAATAAAAAT TTTATACCATAACTTGGACCTATCTTTATTCATGGCGTTTCGAAATTATT AGAGTATCGATATTTCATTGGGG

Coding sequence (CDS) from alignment at sc0000002:1545150..1556722-

>TCONS_00000612 ID=TCONS_00000612|Name=TCONS_00000612|organism=Clytia hemisphaerica|type=CDS|length=9828bp|location=Sequence derived from alignment at sc0000002:1545150..1556722- (Clytia hemisphaerica)
GATACGGTGGTTCTGGTGATCCATGTGATAACATATACAGCGGGCCACGT
CCTTTTTCCGAACAAGAAACGCTGTCTTTAGCACGCTACCTATACAAATT
ACGACGTCGTCTGGTATCTTACATGGACGTCCACGTTTNGCACGCTACCT
GTACAAATTACGACGTCGTCTGGTATCTTACATGGATGTCCACGTTTTTG
GTCAACTCTGGATGACTGAACAGACTATGGCGTAAATCACGTTCACCGAC
TTCTGATCGAACTTGTTATGGAGTTGATTTGAACCGGAATTTCGATCATC
GATGGGGAGATTCTGTTCGATTCTAAATATGATGATAAAATCAAAGATTT
GTTGCATAATTTCGACATTGTGATGACACCGCTATTGAATCCAGATGGTT
ATATTTTTGCACACAATAAAAAACTCAAGATTAGTTTAAATCGAAGTGAC
AGTCGTGAAATCATTTATTTGAACTGTGGATCACACGCAAGAGAATTCTT
ATCCGTCTCTTCATGCAAATATGTCATTCGAAAGATAGTTGGAGAATTGA
AACGACTTGCATCTGTTTATTCAGACATTATGGAGTTACAAAGTATCGGA
AAATCTTACGAGAAAAATGATATATACTCAGTTCATATTCAACTTTGGAG
ACATCCAGACGAAGTTGATCGCCACGTCGATGTCTGGATATCACCAAAAT
CAATTGACAAATTTAAAAAACTTTCTGGAGCTTTGAACATGACATATGAA
GTTTTGACAAAAAATATTTTCGATGAATGGGACAAAGAATATTCTATGAA
TAATATCGAAGATTTTGATATGGTCTATCAAAAATATGACGAGGGTAATG
TTGCTGAGGGTTACTCCAACGAACGAACAGCAATTGGACTTTCTGACATC
ATTGAAGACATATAAAGGTGACTTGAAGGAAGGTGGCGACCCGTCTTTCT
TTTAAGAAGGACGATGAAACGGTTTTTGGTTTCGGTGTTGTGTTTGGTAC
TTCTTATTCAAAATGTTGAATCACAACGCAAAAACAAAAGCATCAAAAAA
AAGCAAGCGATTTAGAAGATTGGCTTTGTTGGCGGAACACACGATACGGT
GGTTCTGGTGATCCATGTGATAACATATACAGCGGGCCACGTCCTTTTTC
CGAACAAGAAACGCTGTCTTTAGCACGCTACCTATACAAATTACGACGTC
GTCTGGTATCTTACATGGACGTCCACGTTTNGCACGCTACCTGTACAAAT
TACGACGTCGTCTGGTATCTTACATGGATGTCCACGTTTTTGGTCAACTC
TGGATGACTGAACAGACTATGGCGTAAATCACGTTCACCGACTTCTGATC
GAACTTGTTATGGAGTTGATTTGAACCGGAATTTCGATCATCGATGGGGA
GATTCTGTTCGATTCTAAATATGATGATAAAATCAAAGATTTGTTGCATA
ATTTCGACATTGTGATGACACCGCTATTGAATCCAGATGGTTATATTTTT
GCACACAATAAAAAACTCAAGATTAGTTTAAATCGAAGTGACAGTCGTGA
AATCATTTATTTGAACTGTGGATCACACGCAAGAGAATTCTTATCCGTCT
CTTCATGCAAATATGTCATTCGAAAGATAGTTGGAGAATTGAAACGACTT
GCATCTGTTTATTCAGACATTATGGAGTTACAAAGTATCGGAAAATCTTA
CGAGAAAAATGATATATACTCAGTTCATATTCAACTTTGGAGACATCCAG
ACGAAGTTGATCGCCACGTCGATGTCTGGATATCACCAAAATCAATTGAC
AAATTTAAAAAACTTTCTGGAGCTTTGAACATGACATATGAAGTTTTGAC
AAAAAATATTTTCGATGAATGGGACAAAGAATATTCTATGAATAATATCG
AAGATTTTGATATGGTCTATCAAAAATATGACGAGGGTAATGTTGCTGAG
GGTTACTCCAACGAACGAACAGCAATTGGACTTTCTGACATCATTGAAGA
CATATAAAGGTGACTTGAAGGAAGGTGGCGACCCGTCTTTCTTTTAAGAA
GGACGATGAAACGGTTTTTGGTTTCGGTGTTGTGTTTGGTACTTCTTATT
CAAAATGTTGAATCACAACGCAAAAACAAAAGCATCAAAAAAAAGCAAGC
GATTTAGAAGATTGGCTTTGTTGGCGGAACACACGATACGGTGGTTCTGG
TGATCCATGTGATAACATATACAGCGGGCCACGTCCTTTTTCCGAACAAG
AAACGCTGTCTTTAGCACGCTACCTATACAAATTACGACGTCGTCTGGTA
TCTTACATGGACGTCCACGTTTNGCACGCTACCTGTACAAATTACGACGT
CGTCTGGTATCTTACATGGATGTCCACGTTTTTGGTCAACTCTGGATGAC
TGAACAGACTATGGCGTAAATCACGTTCACCGACTTCTGATCGAACTTGT
TATGGAGTTGATTTGAACCGGAATTTCGATCATCGATGGGGAGATTCTGT
TCGATTCTAAATATGATGATAAAATCAAAGATTTGTTGCATAATTTCGAC
ATTGTGATGACACCGCTATTGAATCCAGATGGTTATATTTTTGCACACAA
TAAAAAACTCAAGATTAGTTTAAATCGAAGTGACAGTCGTGAAATCATTT
ATTTGAACTGTGGATCACACGCAAGAGAATTCTTATCCGTCTCTTCATGC
AAATATGTCATTCGAAAGATAGTTGGAGAATTGAAACGACTTGCATCTGT
TTATTCAGACATTATGGAGTTACAAAGTATCGGAAAATCTTACGAGAAAA
ATGATATATACTCAGTTCATATTCAACTTTGGAGACATCCAGACGAAGTT
GATCGCCACGTCGATGTCTGGATATCACCAAAATCAATTGACAAATTTAA
AAAACTTTCTGGAGCTTTGAACATGACATATGAAGTTTTGACAAAAAATA
TTTTCGATGAATGGGACAAAGAATATTCTATGAATAATATCGAAGATTTT
GATATGGTCTATCAAAAATATGACGAGGGTAATGTTGCTGAGGGTTACTC
CAACGAACGAACAGCAATTGGACTTTCTGACATCATTGAAGACATATAAA
GGTGACTTGAAGGAAGGTGGCGACCCGTCTTTCTTTTAAGAAGGACGATG
AAACGGTTTTTGGTTTCGGTGTTGTGTTTGGTACTTCTTATTCAAAATGT
TGAATCACAACGCAAAAACAAAAGCATCAAAAAAAAGCAAGCGATTTAGA
AGATTGGCTTTGTTGGCGGAACACACGATACGGTGGTTCTGGTGATCCAT
GTGATAACATATACAGCGGGCCACGTCCTTTTTCCGAACAAGAAACGCTG
TCTTTAGCACGCTACCTATACAAATTACGACGTCGTCTGGTATCTTACAT
GGACGTCCACGTTTNGCACGCTACCTGTACAAATTACGACGTCGTCTGGT
ATCTTACATGGATGTCCACGTTTTTGGTCAACTCTGGATGACTGAACAGA
CTATGGCGTAAATCACGTTCACCGACTTCTGATCGAACTTGTTATGGAGT
TGATTTGAACCGGAATTTCGATCATCGATGGGGAGATTCTGTTCGATTCT
AAATATGATGATAAAATCAAAGATTTGTTGCATAATTTCGACATTGTGAT
GACACCGCTATTGAATCCAGATGGTTATATTTTTGCACACAATAAAAAAC
TCAAGATTAGTTTAAATCGAAGTGACAGTCGTGAAATCATTTATTTGAAC
TGTGGATCACACGCAAGAGAATTCTTATCCGTCTCTTCATGCAAATATGT
CATTCGAAAGATAGTTGGAGAATTGAAACGACTTGCATCTGTTTATTCAG
ACATTATGGAGTTACAAAGTATCGGAAAATCTTACGAGAAAAATGATATA
TACTCAGTTCATATTCAACTTTGGAGACATCCAGACGAAGTTGATCGCCA
CGTCGATGTCTGGATATCACCAAAATCAATTGACAAATTTAAAAAACTTT
CTGGAGCTTTGAACATGACATATGAAGTTTTGACAAAAAATATTTTCGAT
GAATGGGACAAAGAATATTCTATGAATAATATCGAAGATTTTGATATGGT
CTATCAAAAATATGACGAGGGTAATGTTGCTGAGGGTTACTCCAACGAAC
GAACAGCAATTGGACTTTCTGACATCATTGAAGACATATAAAGGTGACTT
GAAGGAAGGTGGCGACCCGTCTTTCTTTTAAGAAGGACGATGAAACGGTT
TTTGGTTTCGGTGTTGTGTTTGGTACTTCTTATTCAAAATGTTGAATCAC
AACGCAAAAACAAAAGCATCAAAAAAAAGCAAGCGATTTAGAAGATTGGC
TTTGTTGGCGGAACACACGATACGGTGGTTCTGGTGATCCATGTGATAAC
ATATACAGCGGGCCACGTCCTTTTTCCGAACAAGAAACGCTGTCTTTAGC
ACGCTACCTATACAAATTACGACGTCGTCTGGTATCTTACATGGACGTCC
ACGTTTNGCACGCTACCTGTACAAATTACGACGTCGTCTGGTATCTTACA
TGGATGTCCACGTTTTTGGTCAACTCTGGATGACTGAACAGACTATGGCG
TAAATCACGTTCACCGACTTCTGATCGAACTTGTTATGGAGTTGATTTGA
ACCGGAATTTCGATCATCGATGGGGAGATTCTGTTCGATTCTAAATATGA
TGATAAAATCAAAGATTTGTTGCATAATTTCGACATTGTGATGACACCGC
TATTGAATCCAGATGGTTATATTTTTGCACACAATAAAAAACTCAAGATT
AGTTTAAATCGAAGTGACAGTCGTGAAATCATTTATTTGAACTGTGGATC
ACACGCAAGAGAATTCTTATCCGTCTCTTCATGCAAATATGTCATTCGAA
AGATAGTTGGAGAATTGAAACGACTTGCATCTGTTTATTCAGACATTATG
GAGTTACAAAGTATCGGAAAATCTTACGAGAAAAATGATATATACTCAGT
TCATATTCAACTTTGGAGACATCCAGACGAAGTTGATCGCCACGTCGATG
TCTGGATATCACCAAAATCAATTGACAAATTTAAAAAACTTTCTGGAGCT
TTGAACATGACATATGAAGTTTTGACAAAAAATATTTTCGATGAATGGGA
CAAAGAATATTCTATGAATAATATCGAAGATTTTGATATGGTCTATCAAA
AATATGACGAGGGTAATGTTGCTGAGGGTTACTCCAACGAACGAACAGCA
ATTGGACTTTCTGACATCATTGAAGACATATAAAGGTGACTTGAAGGAAG
GTGGCGACCCGTCTTTCTTTTAAGAAGGACGATGAAACGGTTTTTGGTTT
CGGTGTTGTGTTTGGTACTTCTTATTCAAAATGTTGAATCACAACGCAAA
AACAAAAGCATCAAAAAAAAGCAAGCGATTTAGAAGATTGGCTTTGTTGG
CGGAACACACGATACGGTGGTTCTGGTGATCCATGTGATAACATATACAG
CGGGCCACGTCCTTTTTCCGAACAAGAAACGCTGTCTTTAGCACGCTACC
TATACAAATTACGACGTCGTCTGGTATCTTACATGGACGTCCACGTTTNG
CACGCTACCTGTACAAATTACGACGTCGTCTGGTATCTTACATGGATGTC
CACGTTTTTGGTCAACTCTGGATGACTGAACAGACTATGGCGTAAATCAC
GTTCACCGACTTCTGATCGAACTTGTTATGGAGTTGATTTGAACCGGAAT
TTCGATCATCGATGGGGAGATTCTGTTCGATTCTAAATATGATGATAAAA
TCAAAGATTTGTTGCATAATTTCGACATTGTGATGACACCGCTATTGAAT
CCAGATGGTTATATTTTTGCACACAATAAAAAACTCAAGATTAGTTTAAA
TCGAAGTGACAGTCGTGAAATCATTTATTTGAACTGTGGATCACACGCAA
GAGAATTCTTATCCGTCTCTTCATGCAAATATGTCATTCGAAAGATAGTT
GGAGAATTGAAACGACTTGCATCTGTTTATTCAGACATTATGGAGTTACA
AAGTATCGGAAAATCTTACGAGAAAAATGATATATACTCAGTTCATATTC
AACTTTGGAGACATCCAGACGAAGTTGATCGCCACGTCGATGTCTGGATA
TCACCAAAATCAATTGACAAATTTAAAAAACTTTCTGGAGCTTTGAACAT
GACATATGAAGTTTTGACAAAAAATATTTTCGATGAATGGGACAAAGAAT
ATTCTATGAATAATATCGAAGATTTTGATATGGTCTATCAAAAATATGAC
GAGGGTAATGTTGCTGAGGGTTACTCCAACGAACGAACAGCAATTGGACT
TTCTGACATCATTGAAGACATATAAAGGTGACTTGAAGGAAGGTGGCGAC
CCGTCTTTCTTTTAAGAAGGACGATGAAACGGTTTTTGGTTTCGGTGTTG
TGTTTGGTACTTCTTATTCAAAATGTTGAATCACAACGCAAAAACAAAAG
CATCAAAAAAAAGCAAGCGATTTAGAAGATTGGCTTTGTTGGCGGAACAC
ACGATACGGTGGTTCTGGTGATCCATGTGATAACATATACAGCGGGCCAC
GTCCTTTTTCCGAACAAGAAACGCTGTCTTTAGCACGCTACCTATACAAA
TTACGACGTCGTCTGGTATCTTACATGGACGTCCACGTTTNGCACGCTAC
CTGTACAAATTACGACGTCGTCTGGTATCTTACATGGATGTCCACGTTTT
TGGTCAACTCTGGATGACTGAACAGACTATGGCGTAAATCACGTTCACCG
ACTTCTGATCGAACTTGTTATGGAGTTGATTTGAACCGGAATTTCGATCA
TCGATGGGGAGATTCTGTTCGATTCTAAATATGATGATAAAATCAAAGAT
TTGTTGCATAATTTCGACATTGTGATGACACCGCTATTGAATCCAGATGG
TTATATTTTTGCACACAATAAAAAACTCAAGATTAGTTTAAATCGAAGTG
ACAGTCGTGAAATCATTTATTTGAACTGTGGATCACACGCAAGAGAATTC
TTATCCGTCTCTTCATGCAAATATGTCATTCGAAAGATAGTTGGAGAATT
GAAACGACTTGCATCTGTTTATTCAGACATTATGGAGTTACAAAGTATCG
GAAAATCTTACGAGAAAAATGATATATACTCAGTTCATATTCAACTTTGG
AGACATCCAGACGAAGTTGATCGCCACGTCGATGTCTGGATATCACCAAA
ATCAATTGACAAATTTAAAAAACTTTCTGGAGCTTTGAACATGACATATG
AAGTTTTGACAAAAAATATTTTCGATGAATGGGACAAAGAATATTCTATG
AATAATATCGAAGATTTTGATATGGTCTATCAAAAATATGACGAGGGTAA
TGTTGCTGAGGGTTACTCCAACGAACGAACAGCAATTGGACTTTCTGACA
TCATTGAAGACATATAAAGGTGACTTGAAGGAAGGTGGCGACCCGTCTTT
CTTTTAAGAAGGACGATGAAACGGTTTTTGGTTTCGGTGTTGTGTTTGGT
ACTTCTTATTCAAAATGTTGAATCACAACGCAAAAACAAAAGCATCAAAA
AAAAGCAAGCGATTTAGAAGATTGGCTTTGTTGGCGGAACACACGATACG
GTGGTTCTGGTGATCCATGTGATAACATATACAGCGGGCCACGTCCTTTT
TCCGAACAAGAAACGCTGTCTTTAGCACGCTACCTATACAAATTACGACG
TCGTCTGGTATCTTACATGGACGTCCACGTTTNGCACGCTACCTGTACAA
ATTACGACGTCGTCTGGTATCTTACATGGATGTCCACGTTTTTGGTCAAC
TCTGGATGACTGAACAGACTATGGCGTAAATCACGTTCACCGACTTCTGA
TCGAACTTGTTATGGAGTTGATTTGAACCGGAATTTCGATCATCGATGGG
GAGATTCTGTTCGATTCTAAATATGATGATAAAATCAAAGATTTGTTGCA
TAATTTCGACATTGTGATGACACCGCTATTGAATCCAGATGGTTATATTT
TTGCACACAATAAAAAACTCAAGATTAGTTTAAATCGAAGTGACAGTCGT
GAAATCATTTATTTGAACTGTGGATCACACGCAAGAGAATTCTTATCCGT
CTCTTCATGCAAATATGTCATTCGAAAGATAGTTGGAGAATTGAAACGAC
TTGCATCTGTTTATTCAGACATTATGGAGTTACAAAGTATCGGAAAATCT
TACGAGAAAAATGATATATACTCAGTTCATATTCAACTTTGGAGACATCC
AGACGAAGTTGATCGCCACGTCGATGTCTGGATATCACCAAAATCAATTG
ACAAATTTAAAAAACTTTCTGGAGCTTTGAACATGACATATGAAGTTTTG
ACAAAAAATATTTTCGATGAATGGGACAAAGAATATTCTATGAATAATAT
CGAAGATTTTGATATGGTCTATCAAAAATATGACGAGGGTAATGTTGCTG
AGGGTTACTCCAACGAACGAACAGCAATTGGACTTTCTGACATCATTGAA
GACATATAAAGGTGACTTGAAGGAAGGTGGCGACCCGTCTTTCTTTTAAG
AAGGACGATGAAACGGTTTTTGGTTTCGGTGTTGTGTTTGGTACTTCTTA
TTCAAAATGTTGAATCACAACGCAAAAACAAAAGCATCAAAAAAAAGCAA
GCGATTTAGAAGATTGGCTTTGTTGGCGGAACACACGATACGGTGGTTCT
GGTGATCCATGTGATAACATATACAGCGGGCCACGTCCTTTTTCCGAACA
AGAAACGCTGTCTTTAGCACGCTACCTATACAAATTACGACGTCGTCTGG
TATCTTACATGGACGTCCACGTTTNGCACGCTACCTGTACAAATTACGAC
GTCGTCTGGTATCTTACATGGATGTCCACGTTTTTGGTCAACTCTGGATG
ACTGAACAGACTATGGCGTAAATCACGTTCACCGACTTCTGATCGAACTT
GTTATGGAGTTGATTTGAACCGGAATTTCGATCATCGATGGGGAGATTCT
GTTCGATTCTAAATATGATGATAAAATCAAAGATTTGTTGCATAATTTCG
ACATTGTGATGACACCGCTATTGAATCCAGATGGTTATATTTTTGCACAC
AATAAAAAACTCAAGATTAGTTTAAATCGAAGTGACAGTCGTGAAATCAT
TTATTTGAACTGTGGATCACACGCAAGAGAATTCTTATCCGTCTCTTCAT
GCAAATATGTCATTCGAAAGATAGTTGGAGAATTGAAACGACTTGCATCT
GTTTATTCAGACATTATGGAGTTACAAAGTATCGGAAAATCTTACGAGAA
AAATGATATATACTCAGTTCATATTCAACTTTGGAGACATCCAGACGAAG
TTGATCGCCACGTCGATGTCTGGATATCACCAAAATCAATTGACAAATTT
AAAAAACTTTCTGGAGCTTTGAACATGACATATGAAGTTTTGACAAAAAA
TATTTTCGATGAATGGGACAAAGAATATTCTATGAATAATATCGAAGATT
TTGATATGGTCTATCAAAAATATGACGAGGGTAATGTTGCTGAGGGTTAC
TCCAACGAACGAACAGCAATTGGACTTTCTGACATCATTGAAGACATATA
AAGGTGACTTGAAGGAAGGTGGCGACCCGTCTTTCTTTTAAGAAGGACGA
TGAAACGGTTTTTGGTTTCGGTGTTGTGTTTGGTACTTCTTATTCAAAAT
GTTGAATCACAACGCAAAAACAAAAGCATCAAAAAAAAGCAAGCGATTTA
GAAGATTGGCTTTGTTGGCGGAACACAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000358XLOC_000358Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000612-exon-sc0000002-1575043694:1556678..1556722TCONS_00000612-exon-sc0000002-1575043694:1556678..1556722Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1551523..1551643TCONS_00000612-exon-sc0000002-1575043694:1551523..1551643Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1549992..1550076TCONS_00000612-exon-sc0000002-1575043694:1549992..1550076Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1548969..1549175TCONS_00000612-exon-sc0000002-1575043694:1548969..1549175Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1548253..1548354TCONS_00000612-exon-sc0000002-1575043694:1548253..1548354Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1547874..1547978TCONS_00000612-exon-sc0000002-1575043694:1547874..1547978Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1547588..1547707TCONS_00000612-exon-sc0000002-1575043694:1547588..1547707Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1547101..1547194TCONS_00000612-exon-sc0000002-1575043694:1547101..1547194Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1546161..1546507TCONS_00000612-exon-sc0000002-1575043694:1546161..1546507Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1575043694:1545150..1545520TCONS_00000612-exon-sc0000002-1575043694:1545150..1545520Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1556678..1556722TCONS_00000612-exon-sc0000002-1510915933:1556678..1556722Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1551523..1551643TCONS_00000612-exon-sc0000002-1510915933:1551523..1551643Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1549992..1550076TCONS_00000612-exon-sc0000002-1510915933:1549992..1550076Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1548969..1549175TCONS_00000612-exon-sc0000002-1510915933:1548969..1549175Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1548253..1548354TCONS_00000612-exon-sc0000002-1510915933:1548253..1548354Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1547874..1547978TCONS_00000612-exon-sc0000002-1510915933:1547874..1547978Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1547588..1547707TCONS_00000612-exon-sc0000002-1510915933:1547588..1547707Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1547101..1547194TCONS_00000612-exon-sc0000002-1510915933:1547101..1547194Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1546161..1546507TCONS_00000612-exon-sc0000002-1510915933:1546161..1546507Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1510915933:1545150..1545520TCONS_00000612-exon-sc0000002-1510915933:1545150..1545520Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1556678..1556722TCONS_00000612-exon-sc0000002-1491911889:1556678..1556722Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1551523..1551643TCONS_00000612-exon-sc0000002-1491911889:1551523..1551643Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1549992..1550076TCONS_00000612-exon-sc0000002-1491911889:1549992..1550076Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1548969..1549175TCONS_00000612-exon-sc0000002-1491911889:1548969..1549175Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1548253..1548354TCONS_00000612-exon-sc0000002-1491911889:1548253..1548354Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1547874..1547978TCONS_00000612-exon-sc0000002-1491911889:1547874..1547978Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1547588..1547707TCONS_00000612-exon-sc0000002-1491911889:1547588..1547707Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1547101..1547194TCONS_00000612-exon-sc0000002-1491911889:1547101..1547194Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1546161..1546507TCONS_00000612-exon-sc0000002-1491911889:1546161..1546507Clytia hemisphaericaexon
TCONS_00000612-exon-sc0000002-1491911889:1545150..1545520TCONS_00000612-exon-sc0000002-1491911889:1545150..1545520Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
Secreted carboxypeptidaseTCONS_00000612-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1545150..1556722 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.21657 0.0355361 0 0.0566279 0 4.92368e-10 0.000669435 0.0545769 2.19525e-05 0.000273998 5.97549 4.19449 6.69515 8.78246 1.87471 8.27917 11.1406 16.134 62.0786 41.0293 10.5689 0.0196201 16.553 11.9878 2.61466 2.84043 3.21921 5.09261 23.8714 58.3769
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000834Peptidase_M14
IPR003146M14A_act_pep
IPR009020Peptidase/Inhibitor_I9
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0004181metallocarboxypeptidase activity
GO:0004180carboxypeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004180 carboxypeptidase activity
molecular_function GO:0004181 metallocarboxypeptidase activity
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00000612 vs. Swiss-Prot (Human)
Match: CBPA4 (Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 2.876e-39
Identity = 78/267 (29.21%), Postives = 130/267 (48.69%), Query Frame = 3
Query:  174 LLRVTPTNEQQLDFLTSLKTYKGDLKIQLWRHPDEVDRHVDVWISPKSIDKFKKLSGALNMTYEVLTKNI---FDEWDKEYSMNNIED-----FDM-VYQKYDEIVGELKRLASVYSDIMELQSIGKSYEKNDIYSVHISLNRSDSREIIYLNCGSHAREFLSVSSCKYVIRKILFDSKYDDKIKDLLHNFDIVMTPLLNPDGYIFAHXXXXXXXXXXXXXXXPTSDRTCYGVDLNRNFDHRWGGYGGSGDPCDNIYSGPRPFSEQE 947
            +LR+   N  ++  L+ L     +LK+  W+ P   +R VDV +   S+  FK    +  + Y V  +++    D  D E   N  ++     F+   Y   + I  E+  +A+ + D+     IG S+E   +Y +  S  +   R  ++LN G H+RE++S ++  +  RKI+ D + D  I  +L   DI + P+ NPDGY++             +SR+P S  +C G D NRN++  + G G S +PC  +Y GP   SE E
Sbjct:   26 VLRINVRNGDEISKLSQL-VNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQ--TQNRLWRKTRSRNPGS--SCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVE 287          

HSP 2 Score: 58.151 bits (139), Expect = 2.876e-39
Identity = 36/111 (32.43%), Postives = 53/111 (47.75%), Query Frame = 2
Query: 1061 MDVHVFGQLWMSPWGYSSTTPKHAAIHEAMLKQIKANLFKEQNIVYEVGQSAVVLYQTSGDSIDWVYGRLGVVHSYGVELRPNLTVRRGFRYHSNFTKPTGEDLLVGIMTI 1393
            +D+H + QL M P+GYS      A   + + +     L       Y+VG +   +Y  SG SIDW Y   G+  ++  ELR   T   GF   +N   PT E+  +G+ TI
Sbjct:  305 IDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDN-GIKFAFTFELRDTGTY--GFLLPANQIIPTAEETWLGLKTI 412          
The following BLAST results are available for this feature:
BLAST of TCONS_00000612 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CBPA42.876e-3929.21Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 S... [more]
back to top