Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000610 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000610
Unique NameTCONS_00000610
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1846

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000610 ID=TCONS_00000610|Name=TCONS_00000610|organism=Clytia hemisphaerica|type=transcript|length=1846bp
CACGGATTTACTTAtagaaaaagttaattttttgacaaattttattggaa
tggaaagttgatttttgctaaatttattatagtgaaatttttttttcata
acaattCAGCAAGCAAAAACCGCTATTTGATTATAATttcttcaatcaaa
aattacagCATCTTTCTTGTTCACTGcagattattttgagacagacttta
tatCCCTTCTCTAGACCTTCTCTTAACTTTTATATAAGTAAATTTTTGCA
AAACACGTGACCTTGTCAACAGATCTATAATTATTTATTTCAAGGAAGGT
GGCGACCCGTCTTTCTTTTAAGAAGGACGATGAAACGGTTTTTGGTTTCG
GTGTTGTGTTTGGTACTTCTTATTCAAAATGTTGAATCACAACGCAAAAA
CAAAAGCATCAAAAAGGTAATGTTGCTGAGGGTTACTCCAACGAACGAAC
AGCAATTGGACTTTCTGACATCATTGAAGACATATAAAGGTGACTTGAAG
ATTCAACTTTGGAGACATCCAGACGAAGTTGATCGCCACGTCGATGTCTG
GATATCACCAAAATCAAttgacaaatttaaaaaactttctgGAGCTTTGA
ACATGACATATgaagttttgacaaaaaatattttcgatgaATGGGACAAA
GAATATTCTATGAATAATATCGAAGATTTTGATATGGTCTATCAAAAATA
TGACGAGATAGTTGGAGAATTGAAACGACTTGCATCTGTTTATTCAGACA
TTATGGAGTTACAAAGTATCGGAAAATCTTACGAGAAAAATGATATATAC
TCAGTTCATATTAGTTTAAATCGAAGTGACAGTCGTGAAATCATTTATTT
GAACTGTGGATCACACGCAAGAGAATTCTTATCCGTCTCTTCATGCAAAT
ATGTCATTCGAAAGATTCTGTTCGATTCTAAATATGAtgataaaatcaaa
gatttGTTGCATAATTTCGACATTGTGATGACACCGCTATTGAATCCAGA
TGGTTATATTTTTGCACACAATAAAAAACTCAAGCTGAACAGACTATGGC
GTAAATCACGTTCACCGACTTCTGATCGAACTTGTTATGGAGTTGATTTG
AACCGGAATTTCGATCATCGATGGGGAGGATACGGTGGTTCTGGTGATCC
ATGTGATAACATATACAGCGGGCCACGTCCTTTTTCCGAACAAGAAACGC
TGTCTTTAGCACGCTACCTATACAAATTACGACGTCGTCTGGTATCTTAC
ATGGACGTCCACGTTTNGCACGCTACCTGTACAAATTACGACGTCGTCTG
GTATCTTACATGGATGTCCACGTTTTTGGTCAACTCTGGATGAGTCCATG
GGGATATTCAAGTACAACACCAAAGCATGCTGCTATACATGAGGCCATGC
TGAAACAAATTAAAGCAAATTTATTCAAAGAGCAGAACATCGTTTACGAA
GTTGGACAGTCTGCAGTAGTATTATatCAAACAAGCGGCGACTCTATCGA
TTGGGTATACGGCCGTCTTGGTGTCGTTCACTCTTATGGCGTCGAATTAC
GCCCTAACCTGACTGTAAGGCGTGGTTTCCGATATCATTCCAACTTTACA
AAACCTACTGGAGAAGATCTTCTCGTAGGTATTATGACGATCTCAAATGA
ATTGTCAAGAGAGAGAAATGAGAGAATGGGTGCTATGCTATGATGAATAG
TTGGTatctttttctgaaagattttctaaaagattattttattttttgaa
tatttaacaaatgaaataaaaattttataccATAACTTGGACCTATCTTT
ATTCATGGCGTTTCGAAATTATTAGAGTATCGATATTTCATTGGGG
Run BLAST on NCBI

transcript from alignment at sc0000002:1545150..1551937-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000610 ID=TCONS_00000610|Name=TCONS_00000610|organism=Clytia hemisphaerica|type=transcript|length=6788bp|location=Sequence derived from alignment at sc0000002:1545150..1551937- (Clytia hemisphaerica)
CACGGATTTACTTATAGAAAAAGTTAATTTTTTGACAAATTTTATTGGAA TGGAAAGTTGATTTTTGCTAAATTTATTATAGTGAAATTTTTTTTTCATA ACAATTCAGCAAGCAAAAACCGCTATTTGATTATAATTTCTTCAATCAAA AATTACAGCATCTTTCTTGTTCACTGCAGATTATTTTGAGACAGACTTTA TATCCCTTCTCTAGACCTTCTCTTAACTTTTATATAAGTAAATTTTTGCA AAACACGTGACCTTGTCAACAGATCTATAATTATTTATTTCAAGGAAGGT GGCGACCCGTCTTTCTTTTAAGAAGGACGATGAAACGGTTTTTGGTTTCG GTGTTGTGTTTGGTACTTCTTATTCAAAATGTTGAATCACAACGCAAAAA CAAAAGCATCAAAAAGTAAGTTAATTTCTCTCATATTCTCAAAATAGGCT GTTAAAACATACAGGGGGATGGACGAACCTCTTCAAGACAAAAAAATTAT TGAAAATGTGTGGATACCCCCCCTGGAAAATGGCAAAACTTGCAAAAATA CCCTAGGAAAGATTCTTTTCATACCTTAAAGTGAAGGTAGACGAACTGAA ATCAGTCTTTTATCCCCTTGGAAAAATGAAAAAAAACCCTGGAAATTCTG CTCGGATCACCCACTGGAAATCTTCGTCCACCCCCCCCCCCTGTATGGAT AAAAAATGGAGTGGCCCAATACTACGGGTTATAAGACAGGGTGAAGAGTC TACGTAGTAAAATTTTAAGTATGCTTTTCTCGAATTCGATCTTCAAGGAG TGTCTAAGACTTTTCCTCAGAAATTCGTTCTACCCAAATTTGATAAATTT GGAATCCAAATTTGGAATCATATTGCCTTAAAATAGTTTTCCGTCATTCA GCAAGTTAACAAAGTTTCTATGACTTCGATCTTACCACAACTAAGGGGTT GTTAGGACGAGAGAAAAAAACTTCGATGGGCTTTAAACGCACTGTAAGTG TAAGTGGTACCGGAAATGTTTGAATATCAAAAGTTATTGTTTAGTTTGTT TTGTTTATGGTTTGAATGACAGTTATGTAAACAAACAGTCAACACAAAAA ATTCTTAACTTTGGTCGTCAACCCCATTCTAAAATAGAGTTCTGAAAATA ACCTTTTTTATAAGCATCTCTGCCCGCATTCTTGACTGTATTTCTCTTCT AATAATAAATACTTGCTTTGCCCTATCTACACTTTGTCAAACTCTCGATG TTTTATAAACACACCTCTGCCTCGCTAATACAAAGAGGACATTGCAACAC ACATAATGAAAAGTATATTGCAACAAAAGGGGCAACTAAGCTCTGTCTCT GTTCTCAATAAAACCAATCCAAAATTGCAATCTAATATCGCACAACCGTC TTTAAAAGCCAAATTCTTTAAAAGTAAATCAATCTATTCATGACATCCCA TTCTCACAGACTCGGTAGGACTTTTTCAGCCAGTGGGGATAGAAATAGCA GACTAAAACTCGATGGGGATTGATATTCCCATATTTTTTATGGCTGGGGA TTTAAATTGCATTGCTTTCAAGTCAGAAAAATAGTGGGGATGGGGAAAAC AGCATGATATTATGTAGTGAGGATTGGTTTGTTTGATTATTTTCAGTGGG GACAAAAATTGGAGTACAATTTTCACTGGGGACGTTATTTTGGCCATTTT TTCCAGTGGGAAGGATTCCCAGTGGATCTGTGAGAAGGGGGTGTTTTATG TCAGTGTGGAGGAGGGGACTTTTAAATCTCATGAAACTGATAAAACGACT TGTTGTTGGGAAAAAAGTTTGGATGTTTTGCATCTATGAAGGCTTACTAT ACCTTTCTTAGGGTAATGTTGCTGAGGGTTACTCCAACGAACGAACAGCA ATTGGACTTTCTGACATCATTGAAGACATATAAAGGTGACTTGAAGGTAC GAGGTTAGATCTCCACATTCACTGATTGAAGCCTTCCCCCAGCGGACCCA AAATTCACGCCATTACGTCAATTCTTTTCAAATTTCACGATGTCACGCCT GTGAAATTCGATATTCACGATAAAGCCATTTTTTCTCGAAAATCACGCCA CGGAAAACCCTGGGAGTTGCTAAATTCAAGCCACTCAAGCTCACGACTTG ATTTTCATCAAAGCCAATCAAAAAATTAAAAGCGATGAGTCGTTTTTAAA TAGGAAGCCCTTCGATACTTTCTGTAGGTCAATACAAAGACAAGTATTTC CACAAAATTGGGGTGTCACTATTCTTTAGACTTATCCACGGCATCAATCA TAGAAAACAAAAAGCCTTAGCCCGGGGGGGGGGTACTTAGGCAAAATTGG TGCCGGGTATGTGCGAGCCATAAGGGTACCTTTTCTCATTCCTCAAAAGT CTGAAAGGGTCCCAAAATCACGAAAATCAAAAATTTCTCTCTCAAAGGGT CACGATTTCCAAAAATTTTGACCAAAATTTGCGTGAAAATCAAACCAAAA TTTAGGAAAAAGTCTCTCAAAGGGTCCCAAAATCACCAAAATTTTGTCTC TCCAAGGGTCGATTTTCGATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCGGGAGCC TTAGCCTCACCATATGAATTAATTCGATAAATTAGTCATGAGAAAAGGCA TTTCTAGCGTGACTGTATTGTTGTTAACCACACTCTGAAGTTCTTAACTT CTGTCAACACAGATTCAACTTTGGAGACATCCAGACGAAGTTGATCGCCA CGTCGATGTCTGGATATCACCAAAATCAATTGACAAATTTAAAAAACTTT CTGGAGCTTTGAACATGACATATGAAGTTTTGACAAAAAATATTTTCGAT GAATGGGACAAAGAATATTCTATGAATAATATCGAAGATTTTGATATGGT CTATCAAAAATATGACGAGGTATGTAATTATCACACCCGAAATATGTTTG CAATCTAATTATAATTAGATGTAAAGCATGCAATCTTTAACTTCTTCACT ACTGTTGGAAAGATTTTTCAATGCAATTTTCTCGGCTCGGCTTAAGCAAA ATAGGTTATGTTTTGGTCTGTTGGAAAGCTCTTTTCAGGATCTATATTTT CAGTATGCCACATTTTGAAGCAGGTCCTCAATCAAAATCACCGGAAGCCA AAAGAATCGTTTATAAATGAAGGAATTTCAGTTTGGCAGTACTCATGAAG TAGAGAGCTGCCAGTGTATTATTACTATATTCAGAAACTCCACTGTGCCA GGAATACCTCCTTTTACTCTTTTATTAAAGTAATAATACCCAATTCCCCT CACATTACATGAGTTGACTTGGGCGAAGGTATATTTACTTGCTAAGTGGA TGTTAGCACTGAATAGGTATCGAAGCCCGACCTGCTGGACAGAAGTTAAA GCGGATAATCTCAACACCACACGTATCCATGAGAACTAGTGTATACATTA TCAAGGTTTTCAGAAAAAAACAACTCAGATTTTGTCTCTTTGATTTCTGC TAACAGGGTCATTCGTCTTAAACTCTTGTTTAGATAGTTGGAGAATTGAA ACGACTTGCATCTGTTTATTCAGACATTATGGAGTTACAAAGTATCGGAA AATCTTACGAGAAAAATGATATATACTCAGTTCATGTAAGTTTATTTATT TTTGTTTATCTAACGTCTATCATTCTTTAACTATTCATGCATCCACAGCT GACATAAAACAGGCCCGAGGCTACATACGAAAAACAGGTGACGGGTATGT GCAAGCCATAAGGGTACCCTTATTCATAACACCTTTATGTCATAGACCCA GACCCCCTTTCTACAATCAGATTCCTATGCTTTATCCTCACAGAGAAAGC TTTTGGGTTATTATCAAGTATAGGTTCATTTAAAATGTTGAAGTTTTTCT GTTTCTCAGATTAGTTTAAATCGAAGTGACAGTCGTGAAATCATTTATTT GAACTGTGGATCACACGCAAGAGAATTCTTATCCGTCTCTTCATGCAAAT ATGTCATTCGAAAGGTAAGACACTTTCATGAGCTAAATACATCATTTATC CAACTAACCTACTAGCTTTCAAAGAAGTTATCATTCAAAACCGCGCTGTC GATCGCAGAATTTTCTCCTTGATTGAATCTGAAAATAACCGCAATGTGAA ACATGGTTCTCTCTCGTCTGTCTTTTTTAGATTCTGTTCGATTCTAAATA TGATGATAAAATCAAAGATTTGTTGCATAATTTCGACATTGTGATGACAC CGCTATTGAATCCAGATGGTTATATTTTTGCACACAATAAAAAACTCAAG GTAGGTGCATAAGTTAATAAAAACGCCGTTAACGATGAGGGAACTTTTCT AATCTTTTCAACTTTGAGAAACTTTTATTCTCATGAAAGATTTCACTTCA ATAGTCCCTTCGTAAAAATATTAGTTATTTTTCCTTTTCTCGAGGTCAGA TTTCTTATCTCCACATGCAGTAGAGTCTCCATAACTCGACCACGCACGGG GAAAACAAATTTGTTCGAGAAATTTCGAGTTATGGAGTAAGGTTTATAAG ACATTGTTAACTCAAAGATCGAGAAAACTTGTTCGAGTTAAAAAGACATT CAAGTTATAGAGGTTCGAATTAAAGATACATTGTGGTTCGGGGCTCTTAT ATTAATAACCAACCATACGCGATAAAGGATAATTTCTTTACAGCTGAACA GACTATGGCGTAAATCACGTTCACCGACTTCTGATCGAACTTGTTATGGA GTTGATTTGAACCGGAATTTCGATCATCGATGGGGAGGTGAGATAAATCA ATGCTTTTGTAAATCGAACGTTGAAGGGTGTTGTGATGTTGAGAGTATTG CATATTTTTACATGTTATTTTATGCTAAATACCCAAACCTGATTATAAGC ATAAAGTTGGCGAATATTTTAGTCAAATTTTTACGAAATTGGTGTACCAG TCGATATTACACCCCCTTCTCACAGACCCAGTAGGATTTTCTCAGCCAGT GGGGATAAAAATGACGGACTGTAACTGGATGGGGATTTATATTCCCATAT TTTTTATGACTGGGGATTCAAATTCTTTTGTTTTCAAGTCAGAAAAATTC AGTGGAGATAAGAAACATAGCATCATAATATTTTGCAATGAGGGTTGGTT TATTTTATTATTTTCCGTGGGGGAAAAATTGAAGTATAGTTTTCCACCGG GACGATATTTTGGCCAAATTTTTCTAGTGGGAAAGGGTCCCAGTGGGTCT GTGAGAAGGGGGTGTGATATTTAAAATAATCAACCTTGAATGTTGATCTA ATTTTCACTCTAAGAAATTCACATTTAGTTTCATAAACCTTTCAAAAATA ATTTCTACTTTCTAAGTGTTTCTACTGCAGGATACGGTGGTTCTGGTGAT CCATGTGATAACATATACAGCGGGCCACGTCCTTTTTCCGAACAAGAAAC GCTGTCTTTAGCACGCTACCTATACAAATTACGACGTCGTCTGGTATCTT ACATGGACGTCCACGTTTNGCACGCTACCTGTACAAATTACGACGTCGTC TGGTATCTTACATGGATGTCCACGTTTTTGGTCAACTCTGGATGAGTCCA TGGGGATATTCAAGTACAACACCAAAGCATGCTGCTATACATGAGGCCAT GCTGAAACAAATTAAAGCAAATTTATTCAAAGAGCAGAACATCGTTTACG AAGTTGGACAGTCTGCAGTAGTATTATGTAAGCATTTTTAAACTTTGTAT AAACCTAAAGAGGTACATGGTGTGGTTTTATCAGCCCTTTTCTGGCGGCG TATGAAAAATTGTGACGGTATTTTGGTGGCTAACTTGCAATGCAAAGATT TCAGCAATTATTTCTGTCGGTGTTGACGGATATTCAAAATATATGTAGTG ACACCACCCCTCCTGAACGCCCCACACTAGCTGTAGACAAATAAAAATAC CCTGTGTCGGCTTTCGAGATTCTCGTTTAAGTCTGGTTTAAGTCAAAAAT TAATTTAAAAAGTTTACATTAACGTGATGTAGAAGACTGTTCATCTAACG TTTCCAGATCATCTAAAAAGAACGACAAATAACATTCAAAAAGCGACTAA AAGAACCCTAACCCTAACCCTAACCCTAACTATCAAAAACGACATAATTT GGATATTAAAGACGTAAAAAATTTGGATTTGAATTTTGGTTCGGGAAATA AATCGGGTTAAAGTTTTGGTCGGGAATAAAAAAACCGGATACAAGTTTTG GTCGAGTGATAAAATGTCGAGGGAAAATTAGGTAGCCTCTTTTTATACTT ATGACAGAAATCTGTGTGAGACAGAAAACTATTCAAGTAAATATAATTCC TAGCATTTTTATTTTAGATCAAACAAGCGGCGACTCTATCGATTGGGTAT ACGGCCGTCTTGGTGTCGTTCACTCTTATGGCGTCGAATTACGCCCTAAC CTGACTGTAAGGCGTGGTTTCCGATATCATTCCAACTTTACAAAACCTAC TGGAGAAGATCTTCTCGTAGGTATTATGACGATCTCAAATGAATTGTCAA GAGAGAGAAATGAGAGAATGGGTGCTATGCTATGATGAATAGTTGGTATC TTTTTCTGAAAGATTTTCTAAAAGATTATTTTATTTTTTGAATATTTAAC AAATGAAATAAAAATTTTATACCATAACTTGGACCTATCTTTATTCATGG CGTTTCGAAATTATTAGAGTATCGATATTTCATTGGGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000358XLOC_000358Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000610-exon-sc0000002-1575043694:1551523..1551937TCONS_00000610-exon-sc0000002-1575043694:1551523..1551937Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1575043694:1549992..1550076TCONS_00000610-exon-sc0000002-1575043694:1549992..1550076Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1575043694:1548969..1549175TCONS_00000610-exon-sc0000002-1575043694:1548969..1549175Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1575043694:1548253..1548354TCONS_00000610-exon-sc0000002-1575043694:1548253..1548354Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1575043694:1547874..1547978TCONS_00000610-exon-sc0000002-1575043694:1547874..1547978Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1575043694:1547588..1547707TCONS_00000610-exon-sc0000002-1575043694:1547588..1547707Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1575043694:1547101..1547194TCONS_00000610-exon-sc0000002-1575043694:1547101..1547194Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1575043694:1546161..1546507TCONS_00000610-exon-sc0000002-1575043694:1546161..1546507Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1575043694:1545150..1545520TCONS_00000610-exon-sc0000002-1575043694:1545150..1545520Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1551523..1551937TCONS_00000610-exon-sc0000002-1510915933:1551523..1551937Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1549992..1550076TCONS_00000610-exon-sc0000002-1510915933:1549992..1550076Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1548969..1549175TCONS_00000610-exon-sc0000002-1510915933:1548969..1549175Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1548253..1548354TCONS_00000610-exon-sc0000002-1510915933:1548253..1548354Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1547874..1547978TCONS_00000610-exon-sc0000002-1510915933:1547874..1547978Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1547588..1547707TCONS_00000610-exon-sc0000002-1510915933:1547588..1547707Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1547101..1547194TCONS_00000610-exon-sc0000002-1510915933:1547101..1547194Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1546161..1546507TCONS_00000610-exon-sc0000002-1510915933:1546161..1546507Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1510915933:1545150..1545520TCONS_00000610-exon-sc0000002-1510915933:1545150..1545520Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1551523..1551937TCONS_00000610-exon-sc0000002-1491911889:1551523..1551937Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1549992..1550076TCONS_00000610-exon-sc0000002-1491911889:1549992..1550076Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1548969..1549175TCONS_00000610-exon-sc0000002-1491911889:1548969..1549175Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1548253..1548354TCONS_00000610-exon-sc0000002-1491911889:1548253..1548354Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1547874..1547978TCONS_00000610-exon-sc0000002-1491911889:1547874..1547978Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1547588..1547707TCONS_00000610-exon-sc0000002-1491911889:1547588..1547707Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1547101..1547194TCONS_00000610-exon-sc0000002-1491911889:1547101..1547194Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1546161..1546507TCONS_00000610-exon-sc0000002-1491911889:1546161..1546507Clytia hemisphaericaexon
TCONS_00000610-exon-sc0000002-1491911889:1545150..1545520TCONS_00000610-exon-sc0000002-1491911889:1545150..1545520Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1545150..1551937 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.138941 0.122693 0 2.27957 1.61724 5.82015 10.2611 6.73393 7.09625 8.15972 9.30115 15.6363 16.9717 3.58168 3.78775 6.37367 8.97885 26.7547 29.8922 7.62258 7.93694 7.4655 9.94336 5.75886 6.86153 1.24736 4.65946 93.1422 99.7552
Blast
BLAST of TCONS_00000610 vs. Swiss-Prot (Human)
Match: CBPA4 (Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 1.822e-39
Identity = 78/267 (29.21%), Postives = 130/267 (48.69%), Query Frame = 3
Query:  423 LLRVTPTNEQQLDFLTSLKTYKGDLKIQLWRHPDEVDRHVDVWISPKSIDKFKKLSGALNMTYEVLTKNI---FDEWDKEYSMNNIED-----FDM-VYQKYDEIVGELKRLASVYSDIMELQSIGKSYEKNDIYSVHISLNRSDSREIIYLNCGSHAREFLSVSSCKYVIRKILFDSKYDDKIKDLLHNFDIVMTPLLNPDGYIFAHXXXXXXXXXXXXXXXPTSDRTCYGVDLNRNFDHRWGGYGGSGDPCDNIYSGPRPFSEQE 1196
            +LR+   N  ++  L+ L     +LK+  W+ P   +R VDV +   S+  FK    +  + Y V  +++    D  D E   N  ++     F+   Y   + I  E+  +A+ + D+     IG S+E   +Y +  S  +   R  ++LN G H+RE++S ++  +  RKI+ D + D  I  +L   DI + P+ NPDGY++             +SR+P S  +C G D NRN++  + G G S +PC  +Y GP   SE E
Sbjct:   26 VLRINVRNGDEISKLSQLVN-SNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQ--TQNRLWRKTRSRNPGS--SCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVE 287          

HSP 2 Score: 58.151 bits (139), Expect = 1.822e-39
Identity = 36/111 (32.43%), Postives = 53/111 (47.75%), Query Frame = 2
Query: 1310 MDVHVFGQLWMSPWGYSSTTPKHAAIHEAMLKQIKANLFKEQNIVYEVGQSAVVLYQTSGDSIDWVYGRLGVVHSYGVELRPNLTVRRGFRYHSNFTKPTGEDLLVGIMTI 1642
            +D+H + QL M P+GYS      A   + + +     L       Y+VG +   +Y  SG SIDW Y   G+  ++  ELR   T   GF   +N   PT E+  +G+ TI
Sbjct:  305 IDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDN-GIKFAFTFELRDTGTY--GFLLPANQIIPTAEETWLGLKTI 412          
The following BLAST results are available for this feature:
BLAST of TCONS_00000610 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CBPA41.822e-3929.21Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 S... [more]
back to top