Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000598 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000598
Unique NameTCONS_00000598
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2120

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000598 ID=TCONS_00000598|Name=TCONS_00000598|organism=Clytia hemisphaerica|type=transcript|length=2120bp
TttaagaagaattttttttttgcgccAAAAAGAAAAGGCTTCTCTTTAAA
TTGTTTCAGGTAATGTTGTTTGTAACatatcaaatcttttttttagctta
aaaatttataattgaaatattcttattttacaaTGGCTGCCACTGACTCA
GTAACATTAGCCTGGATAAATTATTGCTGTAGAGAAGGTTACCATCGCCA
ACTGCAAACAGTTTGTCtagattctttgaaaaaatatggtAATGATCCTG
TCCTTGTATTTTGGAAAGCATTTGGAATGCTTCAAGAAGACAATCTTTCT
GAAGCAATCCAagaatttgaaagaattaaGGATCAAAGAGATGTTGTTTT
ATGTTCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAATCCTCTG
ATAAACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAACGTACA
CAATGTGGAGAAACAGCTCTTTACTTTGGAggaatgtttttatttcataG
CGGTAGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGAAGATGT
CACCAGACTCAAGTGAAGGACTAATATTAAGAGGATGGGCTGATCTTAAA
AGTTCCAAAGAAAACTATGTCAAAAAATCAATCAAGTATTTTGATGAAGC
ATTAAATAGCAATCATTCTGTCAAAGATATTGATGCACTTTTGGGAAAGa
tGGAATACATGAAAAGGAAACAGAACTTCACTGGTGCTTTAGATTTGACA
AATCAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATTGGTTGAAAA
GATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCATGGAGACCG
CTAATAGGATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACACTTC
TTGGTTTTGACTTATCTTTGCAAAGATACTGATTATAATCAGGCTGTTGA
GAAAATTTCAGATGTCATTCAAGCTCTGGACAGACATGAGCCGAAAAATC
CACATTTGTATGCTAGGCTGTCAAAGTGCTATGCAAGACTGTGTGGAAGA
AATCAAAATGTTTTACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATC
AGTCTCCCCTAAAAATGCTGATTTATATAATGAGGCTGGCTATCAATTga
tgcttcaaaataaaatgagggaaagtttaaaaagtttcaaacaaGCAATG
AAAATTGATGAATCAAGTGTAAAAGCACTAATGGGTATCATTCATTGTCA
AATCTTGCAGAATCAATTGGATGACGCTGAACAACAGCTTGATTTCTTTA
ATGAAATACAAGCTTCTACTGGAAAAACTGCAgatgttttatatTTAATG
GCATTGTTTGGTATGAAGAAAGGGAAAAAGGCAGATGAAATTATGACACT
CTGTCAACAAACTGTTGAAAgtcattttgcaaaaatggcTggCTTGCCAC
TTGGCACTCAAtattttgagcttttgaatcCAGACTTTCTGTTACAAGTT
GTTGACCTACTCCTTGTCTATGCACCTACTGAGCCAACTGGTCTTGTGAT
GTCTACCAATGGAGCCTTAAAGAAGTGTGGTCTGATCCTTGAACCAGTCA
TTAAGACCATCCCAGGATTTGTAAAAGCTCAATATGTGTACGCCAAAGTC
AAATTCATATCTGGTGACATCGACACAGCAAAAACCTATATCCAGAAATG
TTTAGAAGTTGATCTTAATTTTGTTAATGCACACATTCTCATGGCTCAGa
tcCACCTTCATAACAACAATTACTCGGCTTGTGAAGCATCTCTTGAGAAT
GGATTGAGTTACAACTTCGAAGTGAAGGACAGCCCCATCTACCACATCAT
TTGTGCAAAGatacaaaagaaacaaaacaatttgaatGAGTCCAAAGAAA
CACTGATGGTTGCAATGAACCTACCTGGTGTCAAACGGCCAGTGTCAGCT
AACGAGAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGCGTGGTGGT
TTATTTGGAATTAGCTGACATTCAACGACAACTCAATCTTACGGTTTGTT
AAAACATTTGATTTTCCTACAATTACGGAATTTAACGTGTAGTCGGCTGT
GTTTGCATGTCGTGGGCTAT
Run BLAST on NCBI

protein sequence of TCONS_00000598-protein

>TCONS_00000598-protein ID=TCONS_00000598-protein|Name=TCONS_00000598-protein|organism=Clytia hemisphaerica|type=polypeptide|length=639bp
MAATDSVTLAWINYCCREGYHRQLQTVCLDSLKKYGNDPVLVFWKAFGML
QEDNLSEAIQEFERIKDQRDVVLCSLMALIVAHKRSKSSDKQTVQQLEAK
LKSERTQCGETALYFGGMFLFHSGRPDKAREYVDRMLKMSPDSSEGLILR
GWADLKSSKENYVKKSIKYFDEALNSNHSVKDIDALLGKMEYMKRKQNFT
GALDLTNQLVVMHPDFFPALVEKMRICLSLQDWEQTMETANRIFQVDTQN
IEALHFLVLTYLCKDTDYNQAVEKISDVIQALDRHEPKNPHLYARLSKCY
ARLCGRNQNVLQQALTLLERAKSVSPKNADLYNEAGYQLMLQNKMRESLK
SFKQAMKIDESSVKALMGIIHCQILQNQLDDAEQQLDFFNEIQASTGKTA
DVLYLMALFGMKKGKKADEIMTLCQQTVESHFAKMAGLPLGTQYFELLNP
DFLLQVVDLLLVYAPTEPTGLVMSTNGALKKCGLILEPVIKTIPGFVKAQ
YVYAKVKFISGDIDTAKTYIQKCLEVDLNFVNAHILMAQIHLHNNNYSAC
EASLENGLSYNFEVKDSPIYHIICAKIQKKQNNLNESKETLMVAMNLPGV
KRPVSANEKPPKFSATLGDRVVVYLELADIQRQLNLTVC
Run BLAST on NCBI

transcript from alignment at sc0000002:1364346..1372010-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000598 ID=TCONS_00000598|Name=TCONS_00000598|organism=Clytia hemisphaerica|type=transcript|length=7665bp|location=Sequence derived from alignment at sc0000002:1364346..1372010- (Clytia hemisphaerica)
TTTAAGAAGAATTTTTTTTTTGCGCCAAAAAGAAAAGGCTTCTCTTTAAA TTGTTTCAGGTAATGTTGTTTGTAACATATCAAATCTTTTTTTTAGCTTA AAAATTTATAATTGAAATATTCTTATTTTACAATGGCTGCCACTGACTCA GTAACATTAGTAAGTAGTAGATAATGTTTTTCTGTCTTTAACTTGTTGTC TAAGATTGCACATTCTTCATGCTAAAAATTTGAAATTTCTTGTTGAGCTT TTAGATTAAAAATACTAAAGGGAGGGGTGAGATTTAAGAATGGAAAAAGA TTAAGGGCTAGGCGCGTATTATGATGGGGTGTGATATTATGGTGGGATGG GTGGATTTTCTGACCAGTATATTTGCTAAAAGAATGTTTTAAGCTATGTG AAATTTTTAGAATCACCTTTTTGTTTCGGTTGTAAGGTATTTAAAAATGA CTACTTCCTCAGGTGGTAGGTACAATTTGCAAAAAGTGGAGGTCATAAAG AGAAGGTAGATTTATAGTGTGTGATGAGATTCTGCACACTATAAAAATTT TGGATTAATTTTTATGATTTTTTTGTAGGCCTGGATAAATTATTGCTGTA GAGAAGGTTACCATCGCCAACTGCAAACAGTTTGTCTAGATTCTTTGAAA AAATATGGTAATGATCCTGTCCTTGTATTTTGGAAAGCATTTGGAATGCT TCAAGAAGGTTTGTCTCTTAAGAATTATTTAATTTTTGTACTTTGTTCTT TAAATTAGGGACAAGTTTTTGGGTTATTCTTTTAATTAGTCAGTCATCTG CATTTATCTACATGTTATTTACATTTCTTTTTAACCATAGACAATCTTTC TGAAGCAATCCAAGAATTTGAAAGAATTAAGGATCAAAGAGATGTTGTTT TATGTTCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAATCCTCT GATAAACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAACGTAC ACAATGTGGAGAAACAGCTCTTTACTTTGGAGGAATGTTTTTATTTCATA GCGGTAGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGAAGATG TCACCAGACTCAAGTGAAGTAAATCTAATTTTATTCATGAAGTTTTCCAC AACTGTTTTAAATTTGCATTTTTAAAAATCATTCATTTACTTTTTTTAAT CTTTTTGAAAGAAACCATCCACAAAAACATAGTCTCATCTTAAAACTAGT CATTTATCTAAATTAAATATAATCTTTTTATTTTATTCTATTCTAGGGAC TAATATTAAGAGGATGGGCTGATCTTAAAAGTTCCAAAGAAAACTATGTC AAAAAATCAATCAAGTATTTTGATGAAGCATTAAATAGCAATCATTCTGT CAAAGATATTGATGCACTTTTGGGAAAGGTAAAGGAAATAGTCTTACTTG TATTTATAGGACTGTCTTAAAATTAGACATGTATTTTATCCTGTAAACCT CAATGTTCTCCTGCTCTAATGACATTATCATTCCTGGACAAAAACATTTT TTTATAATGTAATTTTCAATTTTTCTTCTTTAGATGGAATACATGAAAAG GAAACAGAACTTCACTGGTGCTTTAGATTTGACAAATCAGGTACCTCTAT TTTAGAAGAACTTTCAGAAATGTAATCAAAACATAACATCAAGACATCTT ACTTTATCAGCTTTGTCAGCTTTTTCTTCACATCTTTCATAGAAAATTTT CGTTTTATATTTTAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATT GGTTGAAAAGATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCA TGGAGACCGCTAATAGGTCAACATTTTTGCCTTTAAAACCTTGTTCTCAA ACTTCAGTTGAGCTAAAATCTGAGACAGACTGGAGACTGAATATCTGGGT TAATCCCTGTTTAATTTTTTTAATTTTTTAAAAATTTTATTTTTGAGGCC ATGGTCACCAGTTTTAGCACCGAAACTTTGGCTGGAGACTTTAAAAATGG TCCGATTTTGTTGAAGCACTCTTGATCCTTTGGTAAACCCCTTTAGTAAA AACGAGGCTAAAGACTGAAATTGTCTTATCAATTTTAAATTAGTCCTACA AGTAGCTTCAAAGATACTGAAGTTGACCCAGTGTGTTTAGCAAGTTCGAT AGTTTTCTAATTTTCAGAATTGTAATATTAACAGGATGATATTATATTTT TCTCTAATTAGGATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACA CTTCTTGGTTTTGACTTATCTTTGCAAAGATACTGATTATAATCAGGTAT GAAGAAAAAATTAAATTTAACTTTATTTGACAATGTTTTTTATCCATCAT TTCCTTGAGTCTATTTTGTATTTGTTTTACATTATTATGACATGAGAAAA CCATTTTATACTTTTGAACTGTTCCACTATCAAACCACTGGGAATAAGGA AACAATGTCAATAATCTTTCATTCAGGCTGTTGAGAAAATTTCAGATGTC ATTCAAGCTCTGGACAGACATGAGCCGAAAAATCCACATTTGTATGCTAG GCTGTCAAAGTGCTATGCAAGACTGGTAAGTTTTGTGTAATTTTTTAGGG GTTAGGGGTCAATGGCCTTATTGTTCACTAGTTTAAAAACAGCGTTGTCA TATAGGATGTTTTTGGTACTCTCTGTTATTTTTACATTCTGGGAGAACTC AAACTGAAAGTTTTTAAATTGTTTTTTTAGTATTAATTCAAATAATGGTT ATAATAATATTTTTATGACTTTCTTTTAGTGTGGAAGAAATCAAAATGTT TTACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATCAGTCTCCCCTAA AAATGCTGATTTATATAATGAGGTAAAGATACCTATTCACTTAGATGTCA ATTATATTTTTTTAAATAACCATAAACATCACAGACAGCTTTATGCCTTA CCAATTATATTGCCAACAGGGAATTTGAAAAAAATCCACTCATCTGTTTT TAGGCTGGCTATCAATTGATGCTTCAAAATAAAATGAGGGAAAGTTTAAA AAGTTTCAAACAAGCAATGAAAATTGATGAATCAAGTGTAAAAGCACTAA TGGGTTTGTTTTAATTTCCAATTCATACTTATATTGACAAAAATGTGATA GCTATATAGCTAAGCTAATACTGTTTGATTTGCCATAACCTCCCCAACCT TAAGTAAAAAAACATTGTCTTTTAACCACCCGAACAGAACCTTGAATTAC TAAAAAGACTATTCTTCTACCAACATATACACTGATCCAAAGCCCGAGTG ANACCCGAACAGAACCTCGAATTACTAAAAAGACTATTCTTCTACCAACA TATACACTGACCCAAAGCCCGAGTGGCAGCAAGTCATAATTTTTGAAGTC AGCCTTAATTGAGGATCCTAATAACTGGATTATTATTATGTTTGACTGTG TTTATTTTTTTATGAATTACTTATTACTATTACTTATTGTTATTACTTAT GGTTATTGAACTATAATTCAAATTCTGTGATCACTTTTATTATCATTTCT GTATTCAGTCTATTTTATTCACTTTTTTTCCATTCATTCGCACTTTAGGT ATCATTCATTGTCAAATCTTGCAGAATCAATTGGATGACGCTGAACAACA GCTTGATTTCTTTAATGAAATACAAGCTTCTACTGGAAAAACTGCAGTAA GTCAATATTCAACATGTACCTAGAAATATCTTTATAGTACCTCTTTCTTT CAGTATTTTTACAAAATTATCGGGCTTGTGAAATGATATGTCCCTAGCCT AAGTGGGAAACTTTTGCACTTCCTTCTTTTATAGGCTTTAATTGGAATAC CCTACTATTTTTTCAGGATGTTTTATATTTAATGGCATTGTTTGGTATGA AGAAAGGGAAAAAGGCAGATGAAATTATGACACTCTGTCAACAAACTGTT GAAAGTCATTTTGCAAAAATGGCTGTAAGTCTGTGGATTTGTTTTAAGAC CCAGTAATGAGCCTTTCATTTAGCACATCACTGTCCGTGACGGCCTGTAT GTCCATTTTTGAAAAAGCAGCGCCTTGTCAATATTAAGTTCAATTTGGAA GAAACAGCGTCTTGTAACATGCAAACAAACATTCAAATATTGCTGGGCCT TCATGCTGCTTCTGCTATTTGTTTGAATGGGACCATTGAATTGTACAATA GTAGTTATGCTTCCAACTAATAGGATTGACCAAATTAATCAAAATAATGC TATTACCAACTGATTTATTTAATTTACGAGTAAAAATCAAGGAAAGGTAC ATATGATATTATTTCCTTCTATCGTTGTTTATGTTCACAATGTATCTTTT TTATTTTAGGGCTTGCCACTTGGCACTCAATATTTTGAGCTTTTGAATCC AGACTTTCTGTTACAAGTTGTTGACCTACTCCTTGTCTATGCACCTACTG AGGTAAGGATTCTTGTTAGTCAACCTAATATCCTAACAAAGATTAAAAAG ATGATACAACTAAATTTGTAAGATATCCACATCCATGATATTCATTGAAT AAATCCTTCGTTTTCATTCGTAATATTTTTATGCTTTGCTCATTGTTTTT CTAAAGTGTTTTTCTAAAGTTTTTCCAAGTTTCATGAGCTTGGTGTCAAT ATTTAACAAATTTGTACGATAAGTTGATTTTGAGTTGATGAAACGTTTAT TTTTTCAATTTTATAACAGCCAACTGGTCTTGTGATGTCTACCAATGGAG CCTTAAAGAAGTGTGGTCTGATCCTTGAACCAGTCATTAAGACCATCCCA GGATTTGTAAAAGCTCAATATGTGTACGCCAAAGTCAAATTCATATCTGG TATGTTAATATATTCTCACAGGAAGGAATTTACATCATAAATTTACTTTA TGGCATAACTTTGATTCTTCATTTACGACAAATCATCTTATTCAAATTGA TCAATGTTAAGATTGCTAACGTTGAAAAATCCCAGAAAGATTTGTCTTAT TGATTTACAGTGATTGGAGTAACCTCAAGTATCAGACTTGGCAGACTTGG TAAACATATTTTTCAATTTCAACTCTTCTTTTTAGGTGACATCGACACAG CAAAAACCTATATCCAGAAATGTTTAGAAGTTGATCTTAATTTTGTTAAT GCACACATTCTCATGGCTCAGGTAAAAACACTATCATTTCAAATTTCATT TAATATAATTCCTAAATTTCCCTACTTTTTAAAATATAAAGCATGCTTAC TATTCACGTGGGGGGAGGTAAAATACTCATTAGAAGACCTCTTAGGAAAT TCATTTCCTTTTTAACATCAAATTAAAAACTTTAAAGCATGTTCACTGTG GAGCCCTCTTTTCAGAAATCATTGACATTCTTGAAATTTCATCAAAAATC AAGCAAAAGTTTCTGTATCAAAAGTTATAGCCCTTTGAAGTACTATACCG ATATTTTTCCCTTTACTACCAATAGTCGCTAGGGAATGTGTTACAATTCT CTCACCTTTTCACCTGTATTGGACACCTTGCAATGAATTTTGCAATGGTC TTGGAGCGACAAAGAATTTTTTTTTTTTACTTCCACAGATAGTTTGTTTG TTGGCGTCTTTTTTACGAAAGGCATAAATATGCACTGTTAAAACTTTTCC AATTCTATTCTTTCTTTTTAAAATTTTAGATCCACCTTCATAACAACAAT TACTCGGCTTGTGAAGCATCTCTTGAGAATGGATTGAGTTACAACTTCGA AGTGAAGGACAGCCCCATCTACCACATCATTTGTGCAAAGATACAAAAGA AACAAAACAATTTGAATGAGTCCAAAGAAACACTGATGGTTGCAATGAAC CTACCTGGTGTCAAACGGCCAGGTAAATTTCCAACTCAGTTTTTATATGT TTTAGCATCTATCTAACGGGTGATACAGGGGGGGGGTCAGTGTACCAGAA GGTGGCATGTATCATGGGGTGGGTGGGTGTTTGAGAAAAAAATTTGTCAT GTACTACCTGTGTACTATAATTGGGGCGTTGGGTCCAAAATCGAATTTTA TTTTTACTACCTGTGTACTATAATTGGGGTGTTGGGTCCAAAATCGATGT TAAAAGTGTGGAAACAAAAAGGTTCAGAAATTATCTGCTAAAATAGAAAT GTAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNGATCATTCTTCCAAACTTCTTGGAATGA ATTGAAATCCTACTAGATCCCACTGAAATGAAGGTTTATCGAGTCAATGT AAACATTCGAACATTTGAATTCAAAGATTCAACATTGGTGCCAACTCTCA CGCATTGGGTGTGAGACTGATGCATTTCCACATGGTCTCGCGTAATTTTT GAAAAGTTTGATTTCTCACGCATTTTGGATTTTTGAGAAAAATTTTCCTG TTTTTCCGATTTTTGGAAAAAAGTTTTCCCAATTTCCCGATTTCCTGATT TTCCGAAAAAGGGTTTTCCCGATTTCCCGAATTTTGGAAAAATGTTTACC CGATTTTCTGATTTTCGGAAAAAAAGTTTCTTTATTTTCCGGAATTTTCT AGGTAGTGCCAGGTAGTAAATGGGGGGTATGGGGTGGTTTTGGTTTTTTT CCAGGTACTACCCGGTAGTAAATAGGGGGTATGGGGTGGTTTTGGTTTTT TTCCAGGTACTACCCGGTAGTAAATAGGGGGTATGGGGTGGTTTTGGGAT TTTTCCATGTANNNNNNNNNNNNNNTTTCCATGTAGTATGGTGTACTTCA GGGGTGGGTGGGTGTCAAGTTTTGAAAAATACCTTGTAGTACACATACAT GCCGCTTTCTAGTACACTGACCCCCCCCCCTGGGTGATACAAGTATACAG TTTTTTGTGGACTTACGATTTTCTGTTGACTTTTAATTCTACAAAGGGAA GCTTAACTTTAATTTTGGTATATAAAACTTTAAAAACTGAAAACTTTGAC GAACCCAAAATGAAAAAATTCATATAAAATAGTAATGAAAATTTTGATTA TGAATCAACACTATTGTTAACGAATCAATCGAAATTCGTATAGTACGGGA TTACAGGAAACTGATATGTACAGCGGAGTCTCTTTAACTCTGACCTCTTT AACTCGAATGTCTTCGTAACTCGAACAAGTGTCATGGTCCCTTCAGTTAA CAATGCCTTGTAAACCTCACTCCGTAACTCGAACAAGTTTATGTTTTCCG TGCGTGTTAGAGTTATCGAGATTCAACTGTATAATATTTGCCAAGCAATC ACACTATGTACTTCACAAAATACTTTCATACATCCAGTGTCAGCTAACGA GAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGCGTGGTGGTTTATT TGGAATTAGCTGACATTCAACGACAACTCAATCTTACGGTTTGTTAAAAC ATTTGATTTTCCTACAATTACGGAATTTAACGTGTAGTCGGCTGTGTTTG CATGTCGTGGGCTAT

Coding sequence (CDS) from alignment at sc0000002:1364346..1372010-

>TCONS_00000598 ID=TCONS_00000598|Name=TCONS_00000598|organism=Clytia hemisphaerica|type=CDS|length=32640bp|location=Sequence derived from alignment at sc0000002:1364346..1372010- (Clytia hemisphaerica)
TGTCAGCTAACGAGAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGC
GTGGTGGTTTATTTGGAATTAGCTGACATTCAACGACAACTCAATCTTAC
GGTTTGTTAAATCCACCTTCATAACAACAATTACTCGGCTTGTGAAGCAT
CTCTTGAGAATGGATTGAGTTACAACTTCGAAGTGAAGGACAGCCCCATC
TACCACATCATTTGTGCAAAGATACAAAAGAAACAAAACAATTTGAATGA
GTCCAAAGAAACACTGATGGTTGCAATGAACCTACCTGGTGTCAAACGGC
CAGGTGACATCGACACAGCAAAAACCTATATCCAGAAATGTTTAGAAGTT
GATCTTAATTTTGTTAATGCACACATTCTCATGGCTCAGCCAACTGGTCT
TGTGATGTCTACCAATGGAGCCTTAAAGAAGTGTGGTCTGATCCTTGAAC
CAGTCATTAAGACCATCCCAGGATTTGTAAAAGCTCAATATGTGTACGCC
AAAGTCAAATTCATATCTGGGCTTGCCACTTGGCACTCAATATTTTGAGC
TTTTGAATCCAGACTTTCTGTTACAAGTTGTTGACCTACTCCTTGTCTAT
GCACCTACTGAGGATGTTTTATATTTAATGGCATTGTTTGGTATGAAGAA
AGGGAAAAAGGCAGATGAAATTATGACACTCTGTCAACAAACTGTTGAAA
GTCATTTTGCAAAAATGGCTGTATCATTCATTGTCAAATCTTGCAGAATC
AATTGGATGACGCTGAACAACAGCTTGATTTCTTTAATGAAATACAAGCT
TCTACTGGAAAAACTGCAGCTGGCTATCAATTGATGCTTCAAAATAAAAT
GAGGGAAAGTTTAAAAAGTTTCAAACAAGCAATGAAAATTGATGAATCAA
GTGTAAAAGCACTAATGGTGTGGAAGAAATCAAAATGTTTTACAACAAGC
TTTGACATTGTTAGAAAGAGCAAAATCAGTCTCCCCTAAAAATGCTGATT
TATATAATGAGGCTGTTGAGAAAATTTCAGATGTCATTCAAGCTCTGGAC
AGACATGAGCCGAAAAATCCACATTTGTATGCTAGGCTGTCAAAGTGCTA
TGCAAGACTGGATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACAC
TTCTTGGTTTTGACTTATCTTTGCAAAGATACTGATTATAATCAGCTGGT
TGTGATGCACCCAGACTTTTTCCCAGCATTGGTTGAAAAGATGCGGATTT
GTTTATCCCTTCAAGATTGGGAACAGACCATGGAGACCGCTAATAGATGG
AATACATGAAAAGGAAACAGAACTTCACTGGTGCTTTAGATTTGACAAAT
CAGGGACTAATATTAAGAGGATGGGCTGATCTTAAAAGTTCCAAAGAAAA
CTATGTCAAAAAATCAATCAAGTATTTTGATGAAGCATTAAATAGCAATC
ATTCTGTCAAAGATATTGATGCACTTTTGGGAAAGACAATCTTTCTGAAG
CAATCCAAGAATTTGAAAGAATTAAGGATCAAAGAGATGTTGTTTTATGT
TCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAATCCTCTGATAA
ACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAACGTACACAAT
GTGGAGAAACAGCTCTTTACTTTGGAGGAATGTTTTTATTTCATAGCGGT
AGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGAAGATGTCACC
AGACTCAAGTGAAGCCTGGATAAATTATTGCTGTAGAGAAGGTTACCATC
GCCAACTGCAAACAGTTTGTCTAGATTCTTTGAAAAAATATGGTAATGAT
CCTGTCCTTGTATTTTGGAAAGCATTTGGAATGCTTCAAGAAGATGGCTG
CCACTGACTCAGTAACATTATGTCAGCTAACGAGAAGCCACCAAAGTTTT
CGGCAACTCTTGGTGATCGCGTGGTGGTTTATTTGGAATTAGCTGACATT
CAACGACAACTCAATCTTACGGTTTGTTAAATCCACCTTCATAACAACAA
TTACTCGGCTTGTGAAGCATCTCTTGAGAATGGATTGAGTTACAACTTCG
AAGTGAAGGACAGCCCCATCTACCACATCATTTGTGCAAAGATACAAAAG
AAACAAAACAATTTGAATGAGTCCAAAGAAACACTGATGGTTGCAATGAA
CCTACCTGGTGTCAAACGGCCAGGTGACATCGACACAGCAAAAACCTATA
TCCAGAAATGTTTAGAAGTTGATCTTAATTTTGTTAATGCACACATTCTC
ATGGCTCAGCCAACTGGTCTTGTGATGTCTACCAATGGAGCCTTAAAGAA
GTGTGGTCTGATCCTTGAACCAGTCATTAAGACCATCCCAGGATTTGTAA
AAGCTCAATATGTGTACGCCAAAGTCAAATTCATATCTGGGCTTGCCACT
TGGCACTCAATATTTTGAGCTTTTGAATCCAGACTTTCTGTTACAAGTTG
TTGACCTACTCCTTGTCTATGCACCTACTGAGGATGTTTTATATTTAATG
GCATTGTTTGGTATGAAGAAAGGGAAAAAGGCAGATGAAATTATGACACT
CTGTCAACAAACTGTTGAAAGTCATTTTGCAAAAATGGCTGTATCATTCA
TTGTCAAATCTTGCAGAATCAATTGGATGACGCTGAACAACAGCTTGATT
TCTTTAATGAAATACAAGCTTCTACTGGAAAAACTGCAGCTGGCTATCAA
TTGATGCTTCAAAATAAAATGAGGGAAAGTTTAAAAAGTTTCAAACAAGC
AATGAAAATTGATGAATCAAGTGTAAAAGCACTAATGGTGTGGAAGAAAT
CAAAATGTTTTACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATCAGT
CTCCCCTAAAAATGCTGATTTATATAATGAGGCTGTTGAGAAAATTTCAG
ATGTCATTCAAGCTCTGGACAGACATGAGCCGAAAAATCCACATTTGTAT
GCTAGGCTGTCAAAGTGCTATGCAAGACTGGATTTTTCAAGTAGACACAC
AAAATATTGAAGCTTTACACTTCTTGGTTTTGACTTATCTTTGCAAAGAT
ACTGATTATAATCAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATT
GGTTGAAAAGATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCA
TGGAGACCGCTAATAGATGGAATACATGAAAAGGAAACAGAACTTCACTG
GTGCTTTAGATTTGACAAATCAGGGACTAATATTAAGAGGATGGGCTGAT
CTTAAAAGTTCCAAAGAAAACTATGTCAAAAAATCAATCAAGTATTTTGA
TGAAGCATTAAATAGCAATCATTCTGTCAAAGATATTGATGCACTTTTGG
GAAAGACAATCTTTCTGAAGCAATCCAAGAATTTGAAAGAATTAAGGATC
AAAGAGATGTTGTTTTATGTTCTTTGATGGCCCTGATTGTGGCTCATAAA
CGATCCAAATCCTCTGATAAACAGACTGTCCAACAATTGGAAGCCAAATT
GAAATCAGAACGTACACAATGTGGAGAAACAGCTCTTTACTTTGGAGGAA
TGTTTTTATTTCATAGCGGTAGGCCTGATAAAGCTCGAGAATATGTAGAT
AGAATGTTGAAGATGTCACCAGACTCAAGTGAAGCCTGGATAAATTATTG
CTGTAGAGAAGGTTACCATCGCCAACTGCAAACAGTTTGTCTAGATTCTT
TGAAAAAATATGGTAATGATCCTGTCCTTGTATTTTGGAAAGCATTTGGA
ATGCTTCAAGAAGATGGCTGCCACTGACTCAGTAACATTATGTCAGCTAA
CGAGAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGCGTGGTGGTTT
ATTTGGAATTAGCTGACATTCAACGACAACTCAATCTTACGGTTTGTTAA
ATCCACCTTCATAACAACAATTACTCGGCTTGTGAAGCATCTCTTGAGAA
TGGATTGAGTTACAACTTCGAAGTGAAGGACAGCCCCATCTACCACATCA
TTTGTGCAAAGATACAAAAGAAACAAAACAATTTGAATGAGTCCAAAGAA
ACACTGATGGTTGCAATGAACCTACCTGGTGTCAAACGGCCAGGTGACAT
CGACACAGCAAAAACCTATATCCAGAAATGTTTAGAAGTTGATCTTAATT
TTGTTAATGCACACATTCTCATGGCTCAGCCAACTGGTCTTGTGATGTCT
ACCAATGGAGCCTTAAAGAAGTGTGGTCTGATCCTTGAACCAGTCATTAA
GACCATCCCAGGATTTGTAAAAGCTCAATATGTGTACGCCAAAGTCAAAT
TCATATCTGGGCTTGCCACTTGGCACTCAATATTTTGAGCTTTTGAATCC
AGACTTTCTGTTACAAGTTGTTGACCTACTCCTTGTCTATGCACCTACTG
AGGATGTTTTATATTTAATGGCATTGTTTGGTATGAAGAAAGGGAAAAAG
GCAGATGAAATTATGACACTCTGTCAACAAACTGTTGAAAGTCATTTTGC
AAAAATGGCTGTATCATTCATTGTCAAATCTTGCAGAATCAATTGGATGA
CGCTGAACAACAGCTTGATTTCTTTAATGAAATACAAGCTTCTACTGGAA
AAACTGCAGCTGGCTATCAATTGATGCTTCAAAATAAAATGAGGGAAAGT
TTAAAAAGTTTCAAACAAGCAATGAAAATTGATGAATCAAGTGTAAAAGC
ACTAATGGTGTGGAAGAAATCAAAATGTTTTACAACAAGCTTTGACATTG
TTAGAAAGAGCAAAATCAGTCTCCCCTAAAAATGCTGATTTATATAATGA
GGCTGTTGAGAAAATTTCAGATGTCATTCAAGCTCTGGACAGACATGAGC
CGAAAAATCCACATTTGTATGCTAGGCTGTCAAAGTGCTATGCAAGACTG
GATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACACTTCTTGGTTT
TGACTTATCTTTGCAAAGATACTGATTATAATCAGCTGGTTGTGATGCAC
CCAGACTTTTTCCCAGCATTGGTTGAAAAGATGCGGATTTGTTTATCCCT
TCAAGATTGGGAACAGACCATGGAGACCGCTAATAGATGGAATACATGAA
AAGGAAACAGAACTTCACTGGTGCTTTAGATTTGACAAATCAGGGACTAA
TATTAAGAGGATGGGCTGATCTTAAAAGTTCCAAAGAAAACTATGTCAAA
AAATCAATCAAGTATTTTGATGAAGCATTAAATAGCAATCATTCTGTCAA
AGATATTGATGCACTTTTGGGAAAGACAATCTTTCTGAAGCAATCCAAGA
ATTTGAAAGAATTAAGGATCAAAGAGATGTTGTTTTATGTTCTTTGATGG
CCCTGATTGTGGCTCATAAACGATCCAAATCCTCTGATAAACAGACTGTC
CAACAATTGGAAGCCAAATTGAAATCAGAACGTACACAATGTGGAGAAAC
AGCTCTTTACTTTGGAGGAATGTTTTTATTTCATAGCGGTAGGCCTGATA
AAGCTCGAGAATATGTAGATAGAATGTTGAAGATGTCACCAGACTCAAGT
GAAGCCTGGATAAATTATTGCTGTAGAGAAGGTTACCATCGCCAACTGCA
AACAGTTTGTCTAGATTCTTTGAAAAAATATGGTAATGATCCTGTCCTTG
TATTTTGGAAAGCATTTGGAATGCTTCAAGAAGATGGCTGCCACTGACTC
AGTAACATTATGTCAGCTAACGAGAAGCCACCAAAGTTTTCGGCAACTCT
TGGTGATCGCGTGGTGGTTTATTTGGAATTAGCTGACATTCAACGACAAC
TCAATCTTACGGTTTGTTAAATCCACCTTCATAACAACAATTACTCGGCT
TGTGAAGCATCTCTTGAGAATGGATTGAGTTACAACTTCGAAGTGAAGGA
CAGCCCCATCTACCACATCATTTGTGCAAAGATACAAAAGAAACAAAACA
ATTTGAATGAGTCCAAAGAAACACTGATGGTTGCAATGAACCTACCTGGT
GTCAAACGGCCAGGTGACATCGACACAGCAAAAACCTATATCCAGAAATG
TTTAGAAGTTGATCTTAATTTTGTTAATGCACACATTCTCATGGCTCAGC
CAACTGGTCTTGTGATGTCTACCAATGGAGCCTTAAAGAAGTGTGGTCTG
ATCCTTGAACCAGTCATTAAGACCATCCCAGGATTTGTAAAAGCTCAATA
TGTGTACGCCAAAGTCAAATTCATATCTGGGCTTGCCACTTGGCACTCAA
TATTTTGAGCTTTTGAATCCAGACTTTCTGTTACAAGTTGTTGACCTACT
CCTTGTCTATGCACCTACTGAGGATGTTTTATATTTAATGGCATTGTTTG
GTATGAAGAAAGGGAAAAAGGCAGATGAAATTATGACACTCTGTCAACAA
ACTGTTGAAAGTCATTTTGCAAAAATGGCTGTATCATTCATTGTCAAATC
TTGCAGAATCAATTGGATGACGCTGAACAACAGCTTGATTTCTTTAATGA
AATACAAGCTTCTACTGGAAAAACTGCAGCTGGCTATCAATTGATGCTTC
AAAATAAAATGAGGGAAAGTTTAAAAAGTTTCAAACAAGCAATGAAAATT
GATGAATCAAGTGTAAAAGCACTAATGGTGTGGAAGAAATCAAAATGTTT
TACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATCAGTCTCCCCTAAA
AATGCTGATTTATATAATGAGGCTGTTGAGAAAATTTCAGATGTCATTCA
AGCTCTGGACAGACATGAGCCGAAAAATCCACATTTGTATGCTAGGCTGT
CAAAGTGCTATGCAAGACTGGATTTTTCAAGTAGACACACAAAATATTGA
AGCTTTACACTTCTTGGTTTTGACTTATCTTTGCAAAGATACTGATTATA
ATCAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATTGGTTGAAAAG
ATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCATGGAGACCGC
TAATAGATGGAATACATGAAAAGGAAACAGAACTTCACTGGTGCTTTAGA
TTTGACAAATCAGGGACTAATATTAAGAGGATGGGCTGATCTTAAAAGTT
CCAAAGAAAACTATGTCAAAAAATCAATCAAGTATTTTGATGAAGCATTA
AATAGCAATCATTCTGTCAAAGATATTGATGCACTTTTGGGAAAGACAAT
CTTTCTGAAGCAATCCAAGAATTTGAAAGAATTAAGGATCAAAGAGATGT
TGTTTTATGTTCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAAT
CCTCTGATAAACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAA
CGTACACAATGTGGAGAAACAGCTCTTTACTTTGGAGGAATGTTTTTATT
TCATAGCGGTAGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGA
AGATGTCACCAGACTCAAGTGAAGCCTGGATAAATTATTGCTGTAGAGAA
GGTTACCATCGCCAACTGCAAACAGTTTGTCTAGATTCTTTGAAAAAATA
TGGTAATGATCCTGTCCTTGTATTTTGGAAAGCATTTGGAATGCTTCAAG
AAGATGGCTGCCACTGACTCAGTAACATTATGTCAGCTAACGAGAAGCCA
CCAAAGTTTTCGGCAACTCTTGGTGATCGCGTGGTGGTTTATTTGGAATT
AGCTGACATTCAACGACAACTCAATCTTACGGTTTGTTAAATCCACCTTC
ATAACAACAATTACTCGGCTTGTGAAGCATCTCTTGAGAATGGATTGAGT
TACAACTTCGAAGTGAAGGACAGCCCCATCTACCACATCATTTGTGCAAA
GATACAAAAGAAACAAAACAATTTGAATGAGTCCAAAGAAACACTGATGG
TTGCAATGAACCTACCTGGTGTCAAACGGCCAGGTGACATCGACACAGCA
AAAACCTATATCCAGAAATGTTTAGAAGTTGATCTTAATTTTGTTAATGC
ACACATTCTCATGGCTCAGCCAACTGGTCTTGTGATGTCTACCAATGGAG
CCTTAAAGAAGTGTGGTCTGATCCTTGAACCAGTCATTAAGACCATCCCA
GGATTTGTAAAAGCTCAATATGTGTACGCCAAAGTCAAATTCATATCTGG
GCTTGCCACTTGGCACTCAATATTTTGAGCTTTTGAATCCAGACTTTCTG
TTACAAGTTGTTGACCTACTCCTTGTCTATGCACCTACTGAGGATGTTTT
ATATTTAATGGCATTGTTTGGTATGAAGAAAGGGAAAAAGGCAGATGAAA
TTATGACACTCTGTCAACAAACTGTTGAAAGTCATTTTGCAAAAATGGCT
GTATCATTCATTGTCAAATCTTGCAGAATCAATTGGATGACGCTGAACAA
CAGCTTGATTTCTTTAATGAAATACAAGCTTCTACTGGAAAAACTGCAGC
TGGCTATCAATTGATGCTTCAAAATAAAATGAGGGAAAGTTTAAAAAGTT
TCAAACAAGCAATGAAAATTGATGAATCAAGTGTAAAAGCACTAATGGTG
TGGAAGAAATCAAAATGTTTTACAACAAGCTTTGACATTGTTAGAAAGAG
CAAAATCAGTCTCCCCTAAAAATGCTGATTTATATAATGAGGCTGTTGAG
AAAATTTCAGATGTCATTCAAGCTCTGGACAGACATGAGCCGAAAAATCC
ACATTTGTATGCTAGGCTGTCAAAGTGCTATGCAAGACTGGATTTTTCAA
GTAGACACACAAAATATTGAAGCTTTACACTTCTTGGTTTTGACTTATCT
TTGCAAAGATACTGATTATAATCAGCTGGTTGTGATGCACCCAGACTTTT
TCCCAGCATTGGTTGAAAAGATGCGGATTTGTTTATCCCTTCAAGATTGG
GAACAGACCATGGAGACCGCTAATAGATGGAATACATGAAAAGGAAACAG
AACTTCACTGGTGCTTTAGATTTGACAAATCAGGGACTAATATTAAGAGG
ATGGGCTGATCTTAAAAGTTCCAAAGAAAACTATGTCAAAAAATCAATCA
AGTATTTTGATGAAGCATTAAATAGCAATCATTCTGTCAAAGATATTGAT
GCACTTTTGGGAAAGACAATCTTTCTGAAGCAATCCAAGAATTTGAAAGA
ATTAAGGATCAAAGAGATGTTGTTTTATGTTCTTTGATGGCCCTGATTGT
GGCTCATAAACGATCCAAATCCTCTGATAAACAGACTGTCCAACAATTGG
AAGCCAAATTGAAATCAGAACGTACACAATGTGGAGAAACAGCTCTTTAC
TTTGGAGGAATGTTTTTATTTCATAGCGGTAGGCCTGATAAAGCTCGAGA
ATATGTAGATAGAATGTTGAAGATGTCACCAGACTCAAGTGAAGCCTGGA
TAAATTATTGCTGTAGAGAAGGTTACCATCGCCAACTGCAAACAGTTTGT
CTAGATTCTTTGAAAAAATATGGTAATGATCCTGTCCTTGTATTTTGGAA
AGCATTTGGAATGCTTCAAGAAGATGGCTGCCACTGACTCAGTAACATTA
TGTCAGCTAACGAGAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGC
GTGGTGGTTTATTTGGAATTAGCTGACATTCAACGACAACTCAATCTTAC
GGTTTGTTAAATCCACCTTCATAACAACAATTACTCGGCTTGTGAAGCAT
CTCTTGAGAATGGATTGAGTTACAACTTCGAAGTGAAGGACAGCCCCATC
TACCACATCATTTGTGCAAAGATACAAAAGAAACAAAACAATTTGAATGA
GTCCAAAGAAACACTGATGGTTGCAATGAACCTACCTGGTGTCAAACGGC
CAGGTGACATCGACACAGCAAAAACCTATATCCAGAAATGTTTAGAAGTT
GATCTTAATTTTGTTAATGCACACATTCTCATGGCTCAGCCAACTGGTCT
TGTGATGTCTACCAATGGAGCCTTAAAGAAGTGTGGTCTGATCCTTGAAC
CAGTCATTAAGACCATCCCAGGATTTGTAAAAGCTCAATATGTGTACGCC
AAAGTCAAATTCATATCTGGGCTTGCCACTTGGCACTCAATATTTTGAGC
TTTTGAATCCAGACTTTCTGTTACAAGTTGTTGACCTACTCCTTGTCTAT
GCACCTACTGAGGATGTTTTATATTTAATGGCATTGTTTGGTATGAAGAA
AGGGAAAAAGGCAGATGAAATTATGACACTCTGTCAACAAACTGTTGAAA
GTCATTTTGCAAAAATGGCTGTATCATTCATTGTCAAATCTTGCAGAATC
AATTGGATGACGCTGAACAACAGCTTGATTTCTTTAATGAAATACAAGCT
TCTACTGGAAAAACTGCAGCTGGCTATCAATTGATGCTTCAAAATAAAAT
GAGGGAAAGTTTAAAAAGTTTCAAACAAGCAATGAAAATTGATGAATCAA
GTGTAAAAGCACTAATGGTGTGGAAGAAATCAAAATGTTTTACAACAAGC
TTTGACATTGTTAGAAAGAGCAAAATCAGTCTCCCCTAAAAATGCTGATT
TATATAATGAGGCTGTTGAGAAAATTTCAGATGTCATTCAAGCTCTGGAC
AGACATGAGCCGAAAAATCCACATTTGTATGCTAGGCTGTCAAAGTGCTA
TGCAAGACTGGATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACAC
TTCTTGGTTTTGACTTATCTTTGCAAAGATACTGATTATAATCAGCTGGT
TGTGATGCACCCAGACTTTTTCCCAGCATTGGTTGAAAAGATGCGGATTT
GTTTATCCCTTCAAGATTGGGAACAGACCATGGAGACCGCTAATAGATGG
AATACATGAAAAGGAAACAGAACTTCACTGGTGCTTTAGATTTGACAAAT
CAGGGACTAATATTAAGAGGATGGGCTGATCTTAAAAGTTCCAAAGAAAA
CTATGTCAAAAAATCAATCAAGTATTTTGATGAAGCATTAAATAGCAATC
ATTCTGTCAAAGATATTGATGCACTTTTGGGAAAGACAATCTTTCTGAAG
CAATCCAAGAATTTGAAAGAATTAAGGATCAAAGAGATGTTGTTTTATGT
TCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAATCCTCTGATAA
ACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAACGTACACAAT
GTGGAGAAACAGCTCTTTACTTTGGAGGAATGTTTTTATTTCATAGCGGT
AGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGAAGATGTCACC
AGACTCAAGTGAAGCCTGGATAAATTATTGCTGTAGAGAAGGTTACCATC
GCCAACTGCAAACAGTTTGTCTAGATTCTTTGAAAAAATATGGTAATGAT
CCTGTCCTTGTATTTTGGAAAGCATTTGGAATGCTTCAAGAAGATGGCTG
CCACTGACTCAGTAACATTATGTCAGCTAACGAGAAGCCACCAAAGTTTT
CGGCAACTCTTGGTGATCGCGTGGTGGTTTATTTGGAATTAGCTGACATT
CAACGACAACTCAATCTTACGGTTTGTTAAATCCACCTTCATAACAACAA
TTACTCGGCTTGTGAAGCATCTCTTGAGAATGGATTGAGTTACAACTTCG
AAGTGAAGGACAGCCCCATCTACCACATCATTTGTGCAAAGATACAAAAG
AAACAAAACAATTTGAATGAGTCCAAAGAAACACTGATGGTTGCAATGAA
CCTACCTGGTGTCAAACGGCCAGGTGACATCGACACAGCAAAAACCTATA
TCCAGAAATGTTTAGAAGTTGATCTTAATTTTGTTAATGCACACATTCTC
ATGGCTCAGCCAACTGGTCTTGTGATGTCTACCAATGGAGCCTTAAAGAA
GTGTGGTCTGATCCTTGAACCAGTCATTAAGACCATCCCAGGATTTGTAA
AAGCTCAATATGTGTACGCCAAAGTCAAATTCATATCTGGGCTTGCCACT
TGGCACTCAATATTTTGAGCTTTTGAATCCAGACTTTCTGTTACAAGTTG
TTGACCTACTCCTTGTCTATGCACCTACTGAGGATGTTTTATATTTAATG
GCATTGTTTGGTATGAAGAAAGGGAAAAAGGCAGATGAAATTATGACACT
CTGTCAACAAACTGTTGAAAGTCATTTTGCAAAAATGGCTGTATCATTCA
TTGTCAAATCTTGCAGAATCAATTGGATGACGCTGAACAACAGCTTGATT
TCTTTAATGAAATACAAGCTTCTACTGGAAAAACTGCAGCTGGCTATCAA
TTGATGCTTCAAAATAAAATGAGGGAAAGTTTAAAAAGTTTCAAACAAGC
AATGAAAATTGATGAATCAAGTGTAAAAGCACTAATGGTGTGGAAGAAAT
CAAAATGTTTTACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATCAGT
CTCCCCTAAAAATGCTGATTTATATAATGAGGCTGTTGAGAAAATTTCAG
ATGTCATTCAAGCTCTGGACAGACATGAGCCGAAAAATCCACATTTGTAT
GCTAGGCTGTCAAAGTGCTATGCAAGACTGGATTTTTCAAGTAGACACAC
AAAATATTGAAGCTTTACACTTCTTGGTTTTGACTTATCTTTGCAAAGAT
ACTGATTATAATCAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATT
GGTTGAAAAGATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCA
TGGAGACCGCTAATAGATGGAATACATGAAAAGGAAACAGAACTTCACTG
GTGCTTTAGATTTGACAAATCAGGGACTAATATTAAGAGGATGGGCTGAT
CTTAAAAGTTCCAAAGAAAACTATGTCAAAAAATCAATCAAGTATTTTGA
TGAAGCATTAAATAGCAATCATTCTGTCAAAGATATTGATGCACTTTTGG
GAAAGACAATCTTTCTGAAGCAATCCAAGAATTTGAAAGAATTAAGGATC
AAAGAGATGTTGTTTTATGTTCTTTGATGGCCCTGATTGTGGCTCATAAA
CGATCCAAATCCTCTGATAAACAGACTGTCCAACAATTGGAAGCCAAATT
GAAATCAGAACGTACACAATGTGGAGAAACAGCTCTTTACTTTGGAGGAA
TGTTTTTATTTCATAGCGGTAGGCCTGATAAAGCTCGAGAATATGTAGAT
AGAATGTTGAAGATGTCACCAGACTCAAGTGAAGCCTGGATAAATTATTG
CTGTAGAGAAGGTTACCATCGCCAACTGCAAACAGTTTGTCTAGATTCTT
TGAAAAAATATGGTAATGATCCTGTCCTTGTATTTTGGAAAGCATTTGGA
ATGCTTCAAGAAGATGGCTGCCACTGACTCAGTAACATTATGTCAGCTAA
CGAGAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGCGTGGTGGTTT
ATTTGGAATTAGCTGACATTCAACGACAACTCAATCTTACGGTTTGTTAA
ATCCACCTTCATAACAACAATTACTCGGCTTGTGAAGCATCTCTTGAGAA
TGGATTGAGTTACAACTTCGAAGTGAAGGACAGCCCCATCTACCACATCA
TTTGTGCAAAGATACAAAAGAAACAAAACAATTTGAATGAGTCCAAAGAA
ACACTGATGGTTGCAATGAACCTACCTGGTGTCAAACGGCCAGGTGACAT
CGACACAGCAAAAACCTATATCCAGAAATGTTTAGAAGTTGATCTTAATT
TTGTTAATGCACACATTCTCATGGCTCAGCCAACTGGTCTTGTGATGTCT
ACCAATGGAGCCTTAAAGAAGTGTGGTCTGATCCTTGAACCAGTCATTAA
GACCATCCCAGGATTTGTAAAAGCTCAATATGTGTACGCCAAAGTCAAAT
TCATATCTGGGCTTGCCACTTGGCACTCAATATTTTGAGCTTTTGAATCC
AGACTTTCTGTTACAAGTTGTTGACCTACTCCTTGTCTATGCACCTACTG
AGGATGTTTTATATTTAATGGCATTGTTTGGTATGAAGAAAGGGAAAAAG
GCAGATGAAATTATGACACTCTGTCAACAAACTGTTGAAAGTCATTTTGC
AAAAATGGCTGTATCATTCATTGTCAAATCTTGCAGAATCAATTGGATGA
CGCTGAACAACAGCTTGATTTCTTTAATGAAATACAAGCTTCTACTGGAA
AAACTGCAGCTGGCTATCAATTGATGCTTCAAAATAAAATGAGGGAAAGT
TTAAAAAGTTTCAAACAAGCAATGAAAATTGATGAATCAAGTGTAAAAGC
ACTAATGGTGTGGAAGAAATCAAAATGTTTTACAACAAGCTTTGACATTG
TTAGAAAGAGCAAAATCAGTCTCCCCTAAAAATGCTGATTTATATAATGA
GGCTGTTGAGAAAATTTCAGATGTCATTCAAGCTCTGGACAGACATGAGC
CGAAAAATCCACATTTGTATGCTAGGCTGTCAAAGTGCTATGCAAGACTG
GATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACACTTCTTGGTTT
TGACTTATCTTTGCAAAGATACTGATTATAATCAGCTGGTTGTGATGCAC
CCAGACTTTTTCCCAGCATTGGTTGAAAAGATGCGGATTTGTTTATCCCT
TCAAGATTGGGAACAGACCATGGAGACCGCTAATAGATGGAATACATGAA
AAGGAAACAGAACTTCACTGGTGCTTTAGATTTGACAAATCAGGGACTAA
TATTAAGAGGATGGGCTGATCTTAAAAGTTCCAAAGAAAACTATGTCAAA
AAATCAATCAAGTATTTTGATGAAGCATTAAATAGCAATCATTCTGTCAA
AGATATTGATGCACTTTTGGGAAAGACAATCTTTCTGAAGCAATCCAAGA
ATTTGAAAGAATTAAGGATCAAAGAGATGTTGTTTTATGTTCTTTGATGG
CCCTGATTGTGGCTCATAAACGATCCAAATCCTCTGATAAACAGACTGTC
CAACAATTGGAAGCCAAATTGAAATCAGAACGTACACAATGTGGAGAAAC
AGCTCTTTACTTTGGAGGAATGTTTTTATTTCATAGCGGTAGGCCTGATA
AAGCTCGAGAATATGTAGATAGAATGTTGAAGATGTCACCAGACTCAAGT
GAAGCCTGGATAAATTATTGCTGTAGAGAAGGTTACCATCGCCAACTGCA
AACAGTTTGTCTAGATTCTTTGAAAAAATATGGTAATGATCCTGTCCTTG
TATTTTGGAAAGCATTTGGAATGCTTCAAGAAGATGGCTGCCACTGACTC
AGTAACATTATGTCAGCTAACGAGAAGCCACCAAAGTTTTCGGCAACTCT
TGGTGATCGCGTGGTGGTTTATTTGGAATTAGCTGACATTCAACGACAAC
TCAATCTTACGGTTTGTTAAATCCACCTTCATAACAACAATTACTCGGCT
TGTGAAGCATCTCTTGAGAATGGATTGAGTTACAACTTCGAAGTGAAGGA
CAGCCCCATCTACCACATCATTTGTGCAAAGATACAAAAGAAACAAAACA
ATTTGAATGAGTCCAAAGAAACACTGATGGTTGCAATGAACCTACCTGGT
GTCAAACGGCCAGGTGACATCGACACAGCAAAAACCTATATCCAGAAATG
TTTAGAAGTTGATCTTAATTTTGTTAATGCACACATTCTCATGGCTCAGC
CAACTGGTCTTGTGATGTCTACCAATGGAGCCTTAAAGAAGTGTGGTCTG
ATCCTTGAACCAGTCATTAAGACCATCCCAGGATTTGTAAAAGCTCAATA
TGTGTACGCCAAAGTCAAATTCATATCTGGGCTTGCCACTTGGCACTCAA
TATTTTGAGCTTTTGAATCCAGACTTTCTGTTACAAGTTGTTGACCTACT
CCTTGTCTATGCACCTACTGAGGATGTTTTATATTTAATGGCATTGTTTG
GTATGAAGAAAGGGAAAAAGGCAGATGAAATTATGACACTCTGTCAACAA
ACTGTTGAAAGTCATTTTGCAAAAATGGCTGTATCATTCATTGTCAAATC
TTGCAGAATCAATTGGATGACGCTGAACAACAGCTTGATTTCTTTAATGA
AATACAAGCTTCTACTGGAAAAACTGCAGCTGGCTATCAATTGATGCTTC
AAAATAAAATGAGGGAAAGTTTAAAAAGTTTCAAACAAGCAATGAAAATT
GATGAATCAAGTGTAAAAGCACTAATGGTGTGGAAGAAATCAAAATGTTT
TACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATCAGTCTCCCCTAAA
AATGCTGATTTATATAATGAGGCTGTTGAGAAAATTTCAGATGTCATTCA
AGCTCTGGACAGACATGAGCCGAAAAATCCACATTTGTATGCTAGGCTGT
CAAAGTGCTATGCAAGACTGGATTTTTCAAGTAGACACACAAAATATTGA
AGCTTTACACTTCTTGGTTTTGACTTATCTTTGCAAAGATACTGATTATA
ATCAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATTGGTTGAAAAG
ATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCATGGAGACCGC
TAATAGATGGAATACATGAAAAGGAAACAGAACTTCACTGGTGCTTTAGA
TTTGACAAATCAGGGACTAATATTAAGAGGATGGGCTGATCTTAAAAGTT
CCAAAGAAAACTATGTCAAAAAATCAATCAAGTATTTTGATGAAGCATTA
AATAGCAATCATTCTGTCAAAGATATTGATGCACTTTTGGGAAAGACAAT
CTTTCTGAAGCAATCCAAGAATTTGAAAGAATTAAGGATCAAAGAGATGT
TGTTTTATGTTCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAAT
CCTCTGATAAACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAA
CGTACACAATGTGGAGAAACAGCTCTTTACTTTGGAGGAATGTTTTTATT
TCATAGCGGTAGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGA
AGATGTCACCAGACTCAAGTGAAGCCTGGATAAATTATTGCTGTAGAGAA
GGTTACCATCGCCAACTGCAAACAGTTTGTCTAGATTCTTTGAAAAAATA
TGGTAATGATCCTGTCCTTGTATTTTGGAAAGCATTTGGAATGCTTCAAG
AAGATGGCTGCCACTGACTCAGTAACATTATGTCAGCTAACGAGAAGCCA
CCAAAGTTTTCGGCAACTCTTGGTGATCGCGTGGTGGTTTATTTGGAATT
AGCTGACATTCAACGACAACTCAATCTTACGGTTTGTTAAATCCACCTTC
ATAACAACAATTACTCGGCTTGTGAAGCATCTCTTGAGAATGGATTGAGT
TACAACTTCGAAGTGAAGGACAGCCCCATCTACCACATCATTTGTGCAAA
GATACAAAAGAAACAAAACAATTTGAATGAGTCCAAAGAAACACTGATGG
TTGCAATGAACCTACCTGGTGTCAAACGGCCAGGTGACATCGACACAGCA
AAAACCTATATCCAGAAATGTTTAGAAGTTGATCTTAATTTTGTTAATGC
ACACATTCTCATGGCTCAGCCAACTGGTCTTGTGATGTCTACCAATGGAG
CCTTAAAGAAGTGTGGTCTGATCCTTGAACCAGTCATTAAGACCATCCCA
GGATTTGTAAAAGCTCAATATGTGTACGCCAAAGTCAAATTCATATCTGG
GCTTGCCACTTGGCACTCAATATTTTGAGCTTTTGAATCCAGACTTTCTG
TTACAAGTTGTTGACCTACTCCTTGTCTATGCACCTACTGAGGATGTTTT
ATATTTAATGGCATTGTTTGGTATGAAGAAAGGGAAAAAGGCAGATGAAA
TTATGACACTCTGTCAACAAACTGTTGAAAGTCATTTTGCAAAAATGGCT
GTATCATTCATTGTCAAATCTTGCAGAATCAATTGGATGACGCTGAACAA
CAGCTTGATTTCTTTAATGAAATACAAGCTTCTACTGGAAAAACTGCAGC
TGGCTATCAATTGATGCTTCAAAATAAAATGAGGGAAAGTTTAAAAAGTT
TCAAACAAGCAATGAAAATTGATGAATCAAGTGTAAAAGCACTAATGGTG
TGGAAGAAATCAAAATGTTTTACAACAAGCTTTGACATTGTTAGAAAGAG
CAAAATCAGTCTCCCCTAAAAATGCTGATTTATATAATGAGGCTGTTGAG
AAAATTTCAGATGTCATTCAAGCTCTGGACAGACATGAGCCGAAAAATCC
ACATTTGTATGCTAGGCTGTCAAAGTGCTATGCAAGACTGGATTTTTCAA
GTAGACACACAAAATATTGAAGCTTTACACTTCTTGGTTTTGACTTATCT
TTGCAAAGATACTGATTATAATCAGCTGGTTGTGATGCACCCAGACTTTT
TCCCAGCATTGGTTGAAAAGATGCGGATTTGTTTATCCCTTCAAGATTGG
GAACAGACCATGGAGACCGCTAATAGATGGAATACATGAAAAGGAAACAG
AACTTCACTGGTGCTTTAGATTTGACAAATCAGGGACTAATATTAAGAGG
ATGGGCTGATCTTAAAAGTTCCAAAGAAAACTATGTCAAAAAATCAATCA
AGTATTTTGATGAAGCATTAAATAGCAATCATTCTGTCAAAGATATTGAT
GCACTTTTGGGAAAGACAATCTTTCTGAAGCAATCCAAGAATTTGAAAGA
ATTAAGGATCAAAGAGATGTTGTTTTATGTTCTTTGATGGCCCTGATTGT
GGCTCATAAACGATCCAAATCCTCTGATAAACAGACTGTCCAACAATTGG
AAGCCAAATTGAAATCAGAACGTACACAATGTGGAGAAACAGCTCTTTAC
TTTGGAGGAATGTTTTTATTTCATAGCGGTAGGCCTGATAAAGCTCGAGA
ATATGTAGATAGAATGTTGAAGATGTCACCAGACTCAAGTGAAGCCTGGA
TAAATTATTGCTGTAGAGAAGGTTACCATCGCCAACTGCAAACAGTTTGT
CTAGATTCTTTGAAAAAATATGGTAATGATCCTGTCCTTGTATTTTGGAA
AGCATTTGGAATGCTTCAAGAAGATGGCTGCCACTGACTCAGTAACATTA
TGTCAGCTAACGAGAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGC
GTGGTGGTTTATTTGGAATTAGCTGACATTCAACGACAACTCAATCTTAC
GGTTTGTTAAATCCACCTTCATAACAACAATTACTCGGCTTGTGAAGCAT
CTCTTGAGAATGGATTGAGTTACAACTTCGAAGTGAAGGACAGCCCCATC
TACCACATCATTTGTGCAAAGATACAAAAGAAACAAAACAATTTGAATGA
GTCCAAAGAAACACTGATGGTTGCAATGAACCTACCTGGTGTCAAACGGC
CAGGTGACATCGACACAGCAAAAACCTATATCCAGAAATGTTTAGAAGTT
GATCTTAATTTTGTTAATGCACACATTCTCATGGCTCAGCCAACTGGTCT
TGTGATGTCTACCAATGGAGCCTTAAAGAAGTGTGGTCTGATCCTTGAAC
CAGTCATTAAGACCATCCCAGGATTTGTAAAAGCTCAATATGTGTACGCC
AAAGTCAAATTCATATCTGGGCTTGCCACTTGGCACTCAATATTTTGAGC
TTTTGAATCCAGACTTTCTGTTACAAGTTGTTGACCTACTCCTTGTCTAT
GCACCTACTGAGGATGTTTTATATTTAATGGCATTGTTTGGTATGAAGAA
AGGGAAAAAGGCAGATGAAATTATGACACTCTGTCAACAAACTGTTGAAA
GTCATTTTGCAAAAATGGCTGTATCATTCATTGTCAAATCTTGCAGAATC
AATTGGATGACGCTGAACAACAGCTTGATTTCTTTAATGAAATACAAGCT
TCTACTGGAAAAACTGCAGCTGGCTATCAATTGATGCTTCAAAATAAAAT
GAGGGAAAGTTTAAAAAGTTTCAAACAAGCAATGAAAATTGATGAATCAA
GTGTAAAAGCACTAATGGTGTGGAAGAAATCAAAATGTTTTACAACAAGC
TTTGACATTGTTAGAAAGAGCAAAATCAGTCTCCCCTAAAAATGCTGATT
TATATAATGAGGCTGTTGAGAAAATTTCAGATGTCATTCAAGCTCTGGAC
AGACATGAGCCGAAAAATCCACATTTGTATGCTAGGCTGTCAAAGTGCTA
TGCAAGACTGGATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACAC
TTCTTGGTTTTGACTTATCTTTGCAAAGATACTGATTATAATCAGCTGGT
TGTGATGCACCCAGACTTTTTCCCAGCATTGGTTGAAAAGATGCGGATTT
GTTTATCCCTTCAAGATTGGGAACAGACCATGGAGACCGCTAATAGATGG
AATACATGAAAAGGAAACAGAACTTCACTGGTGCTTTAGATTTGACAAAT
CAGGGACTAATATTAAGAGGATGGGCTGATCTTAAAAGTTCCAAAGAAAA
CTATGTCAAAAAATCAATCAAGTATTTTGATGAAGCATTAAATAGCAATC
ATTCTGTCAAAGATATTGATGCACTTTTGGGAAAGACAATCTTTCTGAAG
CAATCCAAGAATTTGAAAGAATTAAGGATCAAAGAGATGTTGTTTTATGT
TCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAATCCTCTGATAA
ACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAACGTACACAAT
GTGGAGAAACAGCTCTTTACTTTGGAGGAATGTTTTTATTTCATAGCGGT
AGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGAAGATGTCACC
AGACTCAAGTGAAGCCTGGATAAATTATTGCTGTAGAGAAGGTTACCATC
GCCAACTGCAAACAGTTTGTCTAGATTCTTTGAAAAAATATGGTAATGAT
CCTGTCCTTGTATTTTGGAAAGCATTTGGAATGCTTCAAGAAGATGGCTG
CCACTGACTCAGTAACATTATGTCAGCTAACGAGAAGCCACCAAAGTTTT
CGGCAACTCTTGGTGATCGCGTGGTGGTTTATTTGGAATTAGCTGACATT
CAACGACAACTCAATCTTACGGTTTGTTAAATCCACCTTCATAACAACAA
TTACTCGGCTTGTGAAGCATCTCTTGAGAATGGATTGAGTTACAACTTCG
AAGTGAAGGACAGCCCCATCTACCACATCATTTGTGCAAAGATACAAAAG
AAACAAAACAATTTGAATGAGTCCAAAGAAACACTGATGGTTGCAATGAA
CCTACCTGGTGTCAAACGGCCAGGTGACATCGACACAGCAAAAACCTATA
TCCAGAAATGTTTAGAAGTTGATCTTAATTTTGTTAATGCACACATTCTC
ATGGCTCAGCCAACTGGTCTTGTGATGTCTACCAATGGAGCCTTAAAGAA
GTGTGGTCTGATCCTTGAACCAGTCATTAAGACCATCCCAGGATTTGTAA
AAGCTCAATATGTGTACGCCAAAGTCAAATTCATATCTGGGCTTGCCACT
TGGCACTCAATATTTTGAGCTTTTGAATCCAGACTTTCTGTTACAAGTTG
TTGACCTACTCCTTGTCTATGCACCTACTGAGGATGTTTTATATTTAATG
GCATTGTTTGGTATGAAGAAAGGGAAAAAGGCAGATGAAATTATGACACT
CTGTCAACAAACTGTTGAAAGTCATTTTGCAAAAATGGCTGTATCATTCA
TTGTCAAATCTTGCAGAATCAATTGGATGACGCTGAACAACAGCTTGATT
TCTTTAATGAAATACAAGCTTCTACTGGAAAAACTGCAGCTGGCTATCAA
TTGATGCTTCAAAATAAAATGAGGGAAAGTTTAAAAAGTTTCAAACAAGC
AATGAAAATTGATGAATCAAGTGTAAAAGCACTAATGGTGTGGAAGAAAT
CAAAATGTTTTACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATCAGT
CTCCCCTAAAAATGCTGATTTATATAATGAGGCTGTTGAGAAAATTTCAG
ATGTCATTCAAGCTCTGGACAGACATGAGCCGAAAAATCCACATTTGTAT
GCTAGGCTGTCAAAGTGCTATGCAAGACTGGATTTTTCAAGTAGACACAC
AAAATATTGAAGCTTTACACTTCTTGGTTTTGACTTATCTTTGCAAAGAT
ACTGATTATAATCAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATT
GGTTGAAAAGATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCA
TGGAGACCGCTAATAGATGGAATACATGAAAAGGAAACAGAACTTCACTG
GTGCTTTAGATTTGACAAATCAGGGACTAATATTAAGAGGATGGGCTGAT
CTTAAAAGTTCCAAAGAAAACTATGTCAAAAAATCAATCAAGTATTTTGA
TGAAGCATTAAATAGCAATCATTCTGTCAAAGATATTGATGCACTTTTGG
GAAAGACAATCTTTCTGAAGCAATCCAAGAATTTGAAAGAATTAAGGATC
AAAGAGATGTTGTTTTATGTTCTTTGATGGCCCTGATTGTGGCTCATAAA
CGATCCAAATCCTCTGATAAACAGACTGTCCAACAATTGGAAGCCAAATT
GAAATCAGAACGTACACAATGTGGAGAAACAGCTCTTTACTTTGGAGGAA
TGTTTTTATTTCATAGCGGTAGGCCTGATAAAGCTCGAGAATATGTAGAT
AGAATGTTGAAGATGTCACCAGACTCAAGTGAAGCCTGGATAAATTATTG
CTGTAGAGAAGGTTACCATCGCCAACTGCAAACAGTTTGTCTAGATTCTT
TGAAAAAATATGGTAATGATCCTGTCCTTGTATTTTGGAAAGCATTTGGA
ATGCTTCAAGAAGATGGCTGCCACTGACTCAGTAACATTATGTCAGCTAA
CGAGAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGCGTGGTGGTTT
ATTTGGAATTAGCTGACATTCAACGACAACTCAATCTTACGGTTTGTTAA
ATCCACCTTCATAACAACAATTACTCGGCTTGTGAAGCATCTCTTGAGAA
TGGATTGAGTTACAACTTCGAAGTGAAGGACAGCCCCATCTACCACATCA
TTTGTGCAAAGATACAAAAGAAACAAAACAATTTGAATGAGTCCAAAGAA
ACACTGATGGTTGCAATGAACCTACCTGGTGTCAAACGGCCAGGTGACAT
CGACACAGCAAAAACCTATATCCAGAAATGTTTAGAAGTTGATCTTAATT
TTGTTAATGCACACATTCTCATGGCTCAGCCAACTGGTCTTGTGATGTCT
ACCAATGGAGCCTTAAAGAAGTGTGGTCTGATCCTTGAACCAGTCATTAA
GACCATCCCAGGATTTGTAAAAGCTCAATATGTGTACGCCAAAGTCAAAT
TCATATCTGGGCTTGCCACTTGGCACTCAATATTTTGAGCTTTTGAATCC
AGACTTTCTGTTACAAGTTGTTGACCTACTCCTTGTCTATGCACCTACTG
AGGATGTTTTATATTTAATGGCATTGTTTGGTATGAAGAAAGGGAAAAAG
GCAGATGAAATTATGACACTCTGTCAACAAACTGTTGAAAGTCATTTTGC
AAAAATGGCTGTATCATTCATTGTCAAATCTTGCAGAATCAATTGGATGA
CGCTGAACAACAGCTTGATTTCTTTAATGAAATACAAGCTTCTACTGGAA
AAACTGCAGCTGGCTATCAATTGATGCTTCAAAATAAAATGAGGGAAAGT
TTAAAAAGTTTCAAACAAGCAATGAAAATTGATGAATCAAGTGTAAAAGC
ACTAATGGTGTGGAAGAAATCAAAATGTTTTACAACAAGCTTTGACATTG
TTAGAAAGAGCAAAATCAGTCTCCCCTAAAAATGCTGATTTATATAATGA
GGCTGTTGAGAAAATTTCAGATGTCATTCAAGCTCTGGACAGACATGAGC
CGAAAAATCCACATTTGTATGCTAGGCTGTCAAAGTGCTATGCAAGACTG
GATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACACTTCTTGGTTT
TGACTTATCTTTGCAAAGATACTGATTATAATCAGCTGGTTGTGATGCAC
CCAGACTTTTTCCCAGCATTGGTTGAAAAGATGCGGATTTGTTTATCCCT
TCAAGATTGGGAACAGACCATGGAGACCGCTAATAGATGGAATACATGAA
AAGGAAACAGAACTTCACTGGTGCTTTAGATTTGACAAATCAGGGACTAA
TATTAAGAGGATGGGCTGATCTTAAAAGTTCCAAAGAAAACTATGTCAAA
AAATCAATCAAGTATTTTGATGAAGCATTAAATAGCAATCATTCTGTCAA
AGATATTGATGCACTTTTGGGAAAGACAATCTTTCTGAAGCAATCCAAGA
ATTTGAAAGAATTAAGGATCAAAGAGATGTTGTTTTATGTTCTTTGATGG
CCCTGATTGTGGCTCATAAACGATCCAAATCCTCTGATAAACAGACTGTC
CAACAATTGGAAGCCAAATTGAAATCAGAACGTACACAATGTGGAGAAAC
AGCTCTTTACTTTGGAGGAATGTTTTTATTTCATAGCGGTAGGCCTGATA
AAGCTCGAGAATATGTAGATAGAATGTTGAAGATGTCACCAGACTCAAGT
GAAGCCTGGATAAATTATTGCTGTAGAGAAGGTTACCATCGCCAACTGCA
AACAGTTTGTCTAGATTCTTTGAAAAAATATGGTAATGATCCTGTCCTTG
TATTTTGGAAAGCATTTGGAATGCTTCAAGAAGATGGCTGCCACTGACTC
AGTAACATTATGTCAGCTAACGAGAAGCCACCAAAGTTTTCGGCAACTCT
TGGTGATCGCGTGGTGGTTTATTTGGAATTAGCTGACATTCAACGACAAC
TCAATCTTACGGTTTGTTAAATCCACCTTCATAACAACAATTACTCGGCT
TGTGAAGCATCTCTTGAGAATGGATTGAGTTACAACTTCGAAGTGAAGGA
CAGCCCCATCTACCACATCATTTGTGCAAAGATACAAAAGAAACAAAACA
ATTTGAATGAGTCCAAAGAAACACTGATGGTTGCAATGAACCTACCTGGT
GTCAAACGGCCAGGTGACATCGACACAGCAAAAACCTATATCCAGAAATG
TTTAGAAGTTGATCTTAATTTTGTTAATGCACACATTCTCATGGCTCAGC
CAACTGGTCTTGTGATGTCTACCAATGGAGCCTTAAAGAAGTGTGGTCTG
ATCCTTGAACCAGTCATTAAGACCATCCCAGGATTTGTAAAAGCTCAATA
TGTGTACGCCAAAGTCAAATTCATATCTGGGCTTGCCACTTGGCACTCAA
TATTTTGAGCTTTTGAATCCAGACTTTCTGTTACAAGTTGTTGACCTACT
CCTTGTCTATGCACCTACTGAGGATGTTTTATATTTAATGGCATTGTTTG
GTATGAAGAAAGGGAAAAAGGCAGATGAAATTATGACACTCTGTCAACAA
ACTGTTGAAAGTCATTTTGCAAAAATGGCTGTATCATTCATTGTCAAATC
TTGCAGAATCAATTGGATGACGCTGAACAACAGCTTGATTTCTTTAATGA
AATACAAGCTTCTACTGGAAAAACTGCAGCTGGCTATCAATTGATGCTTC
AAAATAAAATGAGGGAAAGTTTAAAAAGTTTCAAACAAGCAATGAAAATT
GATGAATCAAGTGTAAAAGCACTAATGGTGTGGAAGAAATCAAAATGTTT
TACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATCAGTCTCCCCTAAA
AATGCTGATTTATATAATGAGGCTGTTGAGAAAATTTCAGATGTCATTCA
AGCTCTGGACAGACATGAGCCGAAAAATCCACATTTGTATGCTAGGCTGT
CAAAGTGCTATGCAAGACTGGATTTTTCAAGTAGACACACAAAATATTGA
AGCTTTACACTTCTTGGTTTTGACTTATCTTTGCAAAGATACTGATTATA
ATCAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATTGGTTGAAAAG
ATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCATGGAGACCGC
TAATAGATGGAATACATGAAAAGGAAACAGAACTTCACTGGTGCTTTAGA
TTTGACAAATCAGGGACTAATATTAAGAGGATGGGCTGATCTTAAAAGTT
CCAAAGAAAACTATGTCAAAAAATCAATCAAGTATTTTGATGAAGCATTA
AATAGCAATCATTCTGTCAAAGATATTGATGCACTTTTGGGAAAGACAAT
CTTTCTGAAGCAATCCAAGAATTTGAAAGAATTAAGGATCAAAGAGATGT
TGTTTTATGTTCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAAT
CCTCTGATAAACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAA
CGTACACAATGTGGAGAAACAGCTCTTTACTTTGGAGGAATGTTTTTATT
TCATAGCGGTAGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGA
AGATGTCACCAGACTCAAGTGAAGCCTGGATAAATTATTGCTGTAGAGAA
GGTTACCATCGCCAACTGCAAACAGTTTGTCTAGATTCTTTGAAAAAATA
TGGTAATGATCCTGTCCTTGTATTTTGGAAAGCATTTGGAATGCTTCAAG
AAGATGGCTGCCACTGACTCAGTAACATTATGTCAGCTAACGAGAAGCCA
CCAAAGTTTTCGGCAACTCTTGGTGATCGCGTGGTGGTTTATTTGGAATT
AGCTGACATTCAACGACAACTCAATCTTACGGTTTGTTAAATCCACCTTC
ATAACAACAATTACTCGGCTTGTGAAGCATCTCTTGAGAATGGATTGAGT
TACAACTTCGAAGTGAAGGACAGCCCCATCTACCACATCATTTGTGCAAA
GATACAAAAGAAACAAAACAATTTGAATGAGTCCAAAGAAACACTGATGG
TTGCAATGAACCTACCTGGTGTCAAACGGCCAGGTGACATCGACACAGCA
AAAACCTATATCCAGAAATGTTTAGAAGTTGATCTTAATTTTGTTAATGC
ACACATTCTCATGGCTCAGCCAACTGGTCTTGTGATGTCTACCAATGGAG
CCTTAAAGAAGTGTGGTCTGATCCTTGAACCAGTCATTAAGACCATCCCA
GGATTTGTAAAAGCTCAATATGTGTACGCCAAAGTCAAATTCATATCTGG
GCTTGCCACTTGGCACTCAATATTTTGAGCTTTTGAATCCAGACTTTCTG
TTACAAGTTGTTGACCTACTCCTTGTCTATGCACCTACTGAGGATGTTTT
ATATTTAATGGCATTGTTTGGTATGAAGAAAGGGAAAAAGGCAGATGAAA
TTATGACACTCTGTCAACAAACTGTTGAAAGTCATTTTGCAAAAATGGCT
GTATCATTCATTGTCAAATCTTGCAGAATCAATTGGATGACGCTGAACAA
CAGCTTGATTTCTTTAATGAAATACAAGCTTCTACTGGAAAAACTGCAGC
TGGCTATCAATTGATGCTTCAAAATAAAATGAGGGAAAGTTTAAAAAGTT
TCAAACAAGCAATGAAAATTGATGAATCAAGTGTAAAAGCACTAATGGTG
TGGAAGAAATCAAAATGTTTTACAACAAGCTTTGACATTGTTAGAAAGAG
CAAAATCAGTCTCCCCTAAAAATGCTGATTTATATAATGAGGCTGTTGAG
AAAATTTCAGATGTCATTCAAGCTCTGGACAGACATGAGCCGAAAAATCC
ACATTTGTATGCTAGGCTGTCAAAGTGCTATGCAAGACTGGATTTTTCAA
GTAGACACACAAAATATTGAAGCTTTACACTTCTTGGTTTTGACTTATCT
TTGCAAAGATACTGATTATAATCAGCTGGTTGTGATGCACCCAGACTTTT
TCCCAGCATTGGTTGAAAAGATGCGGATTTGTTTATCCCTTCAAGATTGG
GAACAGACCATGGAGACCGCTAATAGATGGAATACATGAAAAGGAAACAG
AACTTCACTGGTGCTTTAGATTTGACAAATCAGGGACTAATATTAAGAGG
ATGGGCTGATCTTAAAAGTTCCAAAGAAAACTATGTCAAAAAATCAATCA
AGTATTTTGATGAAGCATTAAATAGCAATCATTCTGTCAAAGATATTGAT
GCACTTTTGGGAAAGACAATCTTTCTGAAGCAATCCAAGAATTTGAAAGA
ATTAAGGATCAAAGAGATGTTGTTTTATGTTCTTTGATGGCCCTGATTGT
GGCTCATAAACGATCCAAATCCTCTGATAAACAGACTGTCCAACAATTGG
AAGCCAAATTGAAATCAGAACGTACACAATGTGGAGAAACAGCTCTTTAC
TTTGGAGGAATGTTTTTATTTCATAGCGGTAGGCCTGATAAAGCTCGAGA
ATATGTAGATAGAATGTTGAAGATGTCACCAGACTCAAGTGAAGCCTGGA
TAAATTATTGCTGTAGAGAAGGTTACCATCGCCAACTGCAAACAGTTTGT
CTAGATTCTTTGAAAAAATATGGTAATGATCCTGTCCTTGTATTTTGGAA
AGCATTTGGAATGCTTCAAGAAGATGGCTGCCACTGACTCAGTAACATTA
TGTCAGCTAACGAGAAGCCACCAAAGTTTTCGGCAACTCTTGGTGATCGC
GTGGTGGTTTATTTGGAATTAGCTGACATTCAACGACAACTCAATCTTAC
GGTTTGTTAAATCCACCTTCATAACAACAATTACTCGGCTTGTGAAGCAT
CTCTTGAGAATGGATTGAGTTACAACTTCGAAGTGAAGGACAGCCCCATC
TACCACATCATTTGTGCAAAGATACAAAAGAAACAAAACAATTTGAATGA
GTCCAAAGAAACACTGATGGTTGCAATGAACCTACCTGGTGTCAAACGGC
CAGGTGACATCGACACAGCAAAAACCTATATCCAGAAATGTTTAGAAGTT
GATCTTAATTTTGTTAATGCACACATTCTCATGGCTCAGCCAACTGGTCT
TGTGATGTCTACCAATGGAGCCTTAAAGAAGTGTGGTCTGATCCTTGAAC
CAGTCATTAAGACCATCCCAGGATTTGTAAAAGCTCAATATGTGTACGCC
AAAGTCAAATTCATATCTGGGCTTGCCACTTGGCACTCAATATTTTGAGC
TTTTGAATCCAGACTTTCTGTTACAAGTTGTTGACCTACTCCTTGTCTAT
GCACCTACTGAGGATGTTTTATATTTAATGGCATTGTTTGGTATGAAGAA
AGGGAAAAAGGCAGATGAAATTATGACACTCTGTCAACAAACTGTTGAAA
GTCATTTTGCAAAAATGGCTGTATCATTCATTGTCAAATCTTGCAGAATC
AATTGGATGACGCTGAACAACAGCTTGATTTCTTTAATGAAATACAAGCT
TCTACTGGAAAAACTGCAGCTGGCTATCAATTGATGCTTCAAAATAAAAT
GAGGGAAAGTTTAAAAAGTTTCAAACAAGCAATGAAAATTGATGAATCAA
GTGTAAAAGCACTAATGGTGTGGAAGAAATCAAAATGTTTTACAACAAGC
TTTGACATTGTTAGAAAGAGCAAAATCAGTCTCCCCTAAAAATGCTGATT
TATATAATGAGGCTGTTGAGAAAATTTCAGATGTCATTCAAGCTCTGGAC
AGACATGAGCCGAAAAATCCACATTTGTATGCTAGGCTGTCAAAGTGCTA
TGCAAGACTGGATTTTTCAAGTAGACACACAAAATATTGAAGCTTTACAC
TTCTTGGTTTTGACTTATCTTTGCAAAGATACTGATTATAATCAGCTGGT
TGTGATGCACCCAGACTTTTTCCCAGCATTGGTTGAAAAGATGCGGATTT
GTTTATCCCTTCAAGATTGGGAACAGACCATGGAGACCGCTAATAGATGG
AATACATGAAAAGGAAACAGAACTTCACTGGTGCTTTAGATTTGACAAAT
CAGGGACTAATATTAAGAGGATGGGCTGATCTTAAAAGTTCCAAAGAAAA
CTATGTCAAAAAATCAATCAAGTATTTTGATGAAGCATTAAATAGCAATC
ATTCTGTCAAAGATATTGATGCACTTTTGGGAAAGACAATCTTTCTGAAG
CAATCCAAGAATTTGAAAGAATTAAGGATCAAAGAGATGTTGTTTTATGT
TCTTTGATGGCCCTGATTGTGGCTCATAAACGATCCAAATCCTCTGATAA
ACAGACTGTCCAACAATTGGAAGCCAAATTGAAATCAGAACGTACACAAT
GTGGAGAAACAGCTCTTTACTTTGGAGGAATGTTTTTATTTCATAGCGGT
AGGCCTGATAAAGCTCGAGAATATGTAGATAGAATGTTGAAGATGTCACC
AGACTCAAGTGAAGCCTGGATAAATTATTGCTGTAGAGAAGGTTACCATC
GCCAACTGCAAACAGTTTGTCTAGATTCTTTGAAAAAATATGGTAATGAT
CCTGTCCTTGTATTTTGGAAAGCATTTGGAATGCTTCAAGAAGATGGCTG
CCACTGACTCAGTAACATTATGTCAGCTAACGAGAAGCCACCAAAGTTTT
CGGCAACTCTTGGTGATCGCGTGGTGGTTTATTTGGAATTAGCTGACATT
CAACGACAACTCAATCTTACGGTTTGTTAAATCCACCTTCATAACAACAA
TTACTCGGCTTGTGAAGCATCTCTTGAGAATGGATTGAGTTACAACTTCG
AAGTGAAGGACAGCCCCATCTACCACATCATTTGTGCAAAGATACAAAAG
AAACAAAACAATTTGAATGAGTCCAAAGAAACACTGATGGTTGCAATGAA
CCTACCTGGTGTCAAACGGCCAGGTGACATCGACACAGCAAAAACCTATA
TCCAGAAATGTTTAGAAGTTGATCTTAATTTTGTTAATGCACACATTCTC
ATGGCTCAGCCAACTGGTCTTGTGATGTCTACCAATGGAGCCTTAAAGAA
GTGTGGTCTGATCCTTGAACCAGTCATTAAGACCATCCCAGGATTTGTAA
AAGCTCAATATGTGTACGCCAAAGTCAAATTCATATCTGGGCTTGCCACT
TGGCACTCAATATTTTGAGCTTTTGAATCCAGACTTTCTGTTACAAGTTG
TTGACCTACTCCTTGTCTATGCACCTACTGAGGATGTTTTATATTTAATG
GCATTGTTTGGTATGAAGAAAGGGAAAAAGGCAGATGAAATTATGACACT
CTGTCAACAAACTGTTGAAAGTCATTTTGCAAAAATGGCTGTATCATTCA
TTGTCAAATCTTGCAGAATCAATTGGATGACGCTGAACAACAGCTTGATT
TCTTTAATGAAATACAAGCTTCTACTGGAAAAACTGCAGCTGGCTATCAA
TTGATGCTTCAAAATAAAATGAGGGAAAGTTTAAAAAGTTTCAAACAAGC
AATGAAAATTGATGAATCAAGTGTAAAAGCACTAATGGTGTGGAAGAAAT
CAAAATGTTTTACAACAAGCTTTGACATTGTTAGAAAGAGCAAAATCAGT
CTCCCCTAAAAATGCTGATTTATATAATGAGGCTGTTGAGAAAATTTCAG
ATGTCATTCAAGCTCTGGACAGACATGAGCCGAAAAATCCACATTTGTAT
GCTAGGCTGTCAAAGTGCTATGCAAGACTGGATTTTTCAAGTAGACACAC
AAAATATTGAAGCTTTACACTTCTTGGTTTTGACTTATCTTTGCAAAGAT
ACTGATTATAATCAGCTGGTTGTGATGCACCCAGACTTTTTCCCAGCATT
GGTTGAAAAGATGCGGATTTGTTTATCCCTTCAAGATTGGGAACAGACCA
TGGAGACCGCTAATAGATGGAATACATGAAAAGGAAACAGAACTTCACTG
GTGCTTTAGATTTGACAAATCAGGGACTAATATTAAGAGGATGGGCTGAT
CTTAAAAGTTCCAAAGAAAACTATGTCAAAAAATCAATCAAGTATTTTGA
TGAAGCATTAAATAGCAATCATTCTGTCAAAGATATTGATGCACTTTTGG
GAAAGACAATCTTTCTGAAGCAATCCAAGAATTTGAAAGAATTAAGGATC
AAAGAGATGTTGTTTTATGTTCTTTGATGGCCCTGATTGTGGCTCATAAA
CGATCCAAATCCTCTGATAAACAGACTGTCCAACAATTGGAAGCCAAATT
GAAATCAGAACGTACACAATGTGGAGAAACAGCTCTTTACTTTGGAGGAA
TGTTTTTATTTCATAGCGGTAGGCCTGATAAAGCTCGAGAATATGTAGAT
AGAATGTTGAAGATGTCACCAGACTCAAGTGAAGCCTGGATAAATTATTG
CTGTAGAGAAGGTTACCATCGCCAACTGCAAACAGTTTGTCTAGATTCTT
TGAAAAAATATGGTAATGATCCTGTCCTTGTATTTTGGAAAGCATTTGGA
ATGCTTCAAGAAGATGGCTGCCACTGACTCAGTAACATTA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000352XLOC_000352Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000598-exon-sc0000002-1575043694:1371852..1372010TCONS_00000598-exon-sc0000002-1575043694:1371852..1372010Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1371303..1371432TCONS_00000598-exon-sc0000002-1575043694:1371303..1371432Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1370893..1371170TCONS_00000598-exon-sc0000002-1575043694:1370893..1371170Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1370583..1370714TCONS_00000598-exon-sc0000002-1575043694:1370583..1370714Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1370371..1370427TCONS_00000598-exon-sc0000002-1575043694:1370371..1370427Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1370145..1370245TCONS_00000598-exon-sc0000002-1575043694:1370145..1370245Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1369665..1369749TCONS_00000598-exon-sc0000002-1575043694:1369665..1369749Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1369386..1369484TCONS_00000598-exon-sc0000002-1575043694:1369386..1369484Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1369089..1369181TCONS_00000598-exon-sc0000002-1575043694:1369089..1369181Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1368858..1368957TCONS_00000598-exon-sc0000002-1575043694:1368858..1368957Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1368265..1368362TCONS_00000598-exon-sc0000002-1575043694:1368265..1368362Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1367987..1368094TCONS_00000598-exon-sc0000002-1575043694:1367987..1368094Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1367509..1367601TCONS_00000598-exon-sc0000002-1575043694:1367509..1367601Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1367112..1367241TCONS_00000598-exon-sc0000002-1575043694:1367112..1367241Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1366790..1366875TCONS_00000598-exon-sc0000002-1575043694:1366790..1366875Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1366089..1366281TCONS_00000598-exon-sc0000002-1575043694:1366089..1366281Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1575043694:1364346..1364523TCONS_00000598-exon-sc0000002-1575043694:1364346..1364523Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1371852..1372010TCONS_00000598-exon-sc0000002-1510915933:1371852..1372010Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1371303..1371432TCONS_00000598-exon-sc0000002-1510915933:1371303..1371432Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1370893..1371170TCONS_00000598-exon-sc0000002-1510915933:1370893..1371170Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1370583..1370714TCONS_00000598-exon-sc0000002-1510915933:1370583..1370714Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1370371..1370427TCONS_00000598-exon-sc0000002-1510915933:1370371..1370427Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1370145..1370245TCONS_00000598-exon-sc0000002-1510915933:1370145..1370245Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1369665..1369749TCONS_00000598-exon-sc0000002-1510915933:1369665..1369749Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1369386..1369484TCONS_00000598-exon-sc0000002-1510915933:1369386..1369484Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1369089..1369181TCONS_00000598-exon-sc0000002-1510915933:1369089..1369181Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1368858..1368957TCONS_00000598-exon-sc0000002-1510915933:1368858..1368957Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1368265..1368362TCONS_00000598-exon-sc0000002-1510915933:1368265..1368362Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1367987..1368094TCONS_00000598-exon-sc0000002-1510915933:1367987..1368094Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1367509..1367601TCONS_00000598-exon-sc0000002-1510915933:1367509..1367601Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1367112..1367241TCONS_00000598-exon-sc0000002-1510915933:1367112..1367241Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1366790..1366875TCONS_00000598-exon-sc0000002-1510915933:1366790..1366875Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1366089..1366281TCONS_00000598-exon-sc0000002-1510915933:1366089..1366281Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1510915933:1364346..1364523TCONS_00000598-exon-sc0000002-1510915933:1364346..1364523Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1371852..1372010TCONS_00000598-exon-sc0000002-1491911889:1371852..1372010Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1371303..1371432TCONS_00000598-exon-sc0000002-1491911889:1371303..1371432Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1370893..1371170TCONS_00000598-exon-sc0000002-1491911889:1370893..1371170Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1370583..1370714TCONS_00000598-exon-sc0000002-1491911889:1370583..1370714Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1370371..1370427TCONS_00000598-exon-sc0000002-1491911889:1370371..1370427Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1370145..1370245TCONS_00000598-exon-sc0000002-1491911889:1370145..1370245Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1369665..1369749TCONS_00000598-exon-sc0000002-1491911889:1369665..1369749Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1369386..1369484TCONS_00000598-exon-sc0000002-1491911889:1369386..1369484Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1369089..1369181TCONS_00000598-exon-sc0000002-1491911889:1369089..1369181Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1368858..1368957TCONS_00000598-exon-sc0000002-1491911889:1368858..1368957Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1368265..1368362TCONS_00000598-exon-sc0000002-1491911889:1368265..1368362Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1367987..1368094TCONS_00000598-exon-sc0000002-1491911889:1367987..1368094Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1367509..1367601TCONS_00000598-exon-sc0000002-1491911889:1367509..1367601Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1367112..1367241TCONS_00000598-exon-sc0000002-1491911889:1367112..1367241Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1366790..1366875TCONS_00000598-exon-sc0000002-1491911889:1366790..1366875Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1366089..1366281TCONS_00000598-exon-sc0000002-1491911889:1366089..1366281Clytia hemisphaericaexon
TCONS_00000598-exon-sc0000002-1491911889:1364346..1364523TCONS_00000598-exon-sc0000002-1491911889:1364346..1364523Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000598-proteinTCONS_00000598-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1364346..1372010 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
9.3382 8.5269 46.1185 44.256 31.7957 24.7693 22.3407 21.5407 19.3365 19.3975 16.1756 19.4612 9.18617 9.19372 7.53741 7.99829 7.67911 9.32788 8.84129 10.5528 10.2672 11.8196 5.49186 7.46999 17.2216 21.8452 8.93517 6.13989 3.39994 3.19108
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom
IPR013026TPR-contain_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000598 vs. Swiss-Prot (Human)
Match: TT21B (Tetratricopeptide repeat protein 21B OS=Homo sapiens GN=TTC21B PE=1 SV=2)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 276/622 (44.37%), Postives = 424/622 (68.17%), Query Frame = 1
Query:  166 INYCCREGYHRQLQTVCLDSLKKYGNDPVLVFWKAFGMLQEDNLSEAIQEFERIKDQRDVVLCSLMALIVAHKRSKSSDKQTVQQLEAKLKSERTQCGETALYFGGMFLFHSGRPDKAREYVDRMLKMSPDSSEGLILRGWADLKSSKENYVKKSIKYFDEALNSNHSVKDIDALLGKMEYMKRKQNFTGALDLTNQLVVMHPDFFPALVEKMRICLSLQDWEQTMETANRIFQVDTQNIEALHFLVLTYLCKDTDYNQAVEKISDVIQALDRHEPKNPHLYARLSKCYARLCGRNQNVLQQALTLLERAKSVSPKNADLYNEAGYQLMLQNKMRESLKSFKQAMKIDESSVKALMGIIHCQILQNQLDDAEQQLDFFNEIQASTGKTADVLYLMALFGMKKGKKADEIMTLCQQTVESHFAKMAGLPLGTQYFELLNPDFXXXXXXXXXXYAPTEPTGLVMSTNGALKKCGLILEPVIKTIPGFVKAQYVYAKVKFISGDIDTAKTYIQKCLEVDLNFVNAHILMAQIHLHNNNYSACEASLENGLSYNFEVKDSPIYHIICAKIQKKQNNLNESKETLMVAMNLPGVKR-PVSANEKPPKFSATLGDRVVVYLELADIQR 2028
            INY C+E Y   +  V  + +K+YG+DPV  F+ A+G L E    EA++EFE IK+++DV LCSL+ALI AHK S + D++ + + +A++K +R   GE ALY  G+FL+H GR DKAREY+DRM+K+S  S +G +L+ W D+   KE Y KK++KYF+E L   +   D  ALLGK + ++ +QN++GAL+  NQ++V  P F PA V+KM++ L+LQDW+QT+ETA R+   D+QN+EAL    L Y+C++ D  +A  K+ ++   LD  EP+N  L+  ++  ++R CGR+Q +LQ+  TLLERA S++P+ ++   E GYQ++LQ +++E+LK +K AM +DE+SV AL+G I CQ+++ QL DA+QQL+F NEIQ S GK+A+++YL A+  MKK K+ +E++ L    +++HF+++ GLPLG QYFE LNPDFLL++V   L + P +P          L++C  +LE V++T+PG ++  ++ AKVK++SGDI+ A   +Q CLE + ++ +AH+L+AQ++L       C  SLE  LSY+F+V+D P+YH+I A+ QKK   + ++ +TL +AM+LPG+KR   S   K  K       R+ ++LEL D+ R
Sbjct:   10 INYYCQERYFHHVLLVASEGIKRYGSDPVFRFYHAYGTLMEGKTQEALREFEAIKNKQDVSLCSLLALIYAHKMSPNPDREAILESDARVKEQRKGAGEKALYHAGLFLWHIGRHDKAREYIDRMIKISDGSKQGHVLKAWLDITRGKEPYTKKALKYFEEGLQDGN---DTFALLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQPASPGQPLCPLLRRCISVLETVVRTVPGLLQTVFLIAKVKYLSGDIEAAFNNLQHCLEHNPSYADAHLLLAQVYLSQEKVKLCSQSLELCLSYDFKVRDYPLYHLIKAQSQKKMGEIADAIKTLHMAMSLPGMKRIGASTKSKDRKTEVDTSHRLSIFLELIDVHR 628          
The following BLAST results are available for this feature:
BLAST of TCONS_00000598 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TT21B0.000e+044.37Tetratricopeptide repeat protein 21B OS=Homo sapie... [more]
back to top