Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000598-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000598-protein
Unique NameTCONS_00000598-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length639

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000598-protein ID=TCONS_00000598-protein|Name=TCONS_00000598-protein|organism=Clytia hemisphaerica|type=polypeptide|length=639bp
MAATDSVTLAWINYCCREGYHRQLQTVCLDSLKKYGNDPVLVFWKAFGML
QEDNLSEAIQEFERIKDQRDVVLCSLMALIVAHKRSKSSDKQTVQQLEAK
LKSERTQCGETALYFGGMFLFHSGRPDKAREYVDRMLKMSPDSSEGLILR
GWADLKSSKENYVKKSIKYFDEALNSNHSVKDIDALLGKMEYMKRKQNFT
GALDLTNQLVVMHPDFFPALVEKMRICLSLQDWEQTMETANRIFQVDTQN
IEALHFLVLTYLCKDTDYNQAVEKISDVIQALDRHEPKNPHLYARLSKCY
ARLCGRNQNVLQQALTLLERAKSVSPKNADLYNEAGYQLMLQNKMRESLK
SFKQAMKIDESSVKALMGIIHCQILQNQLDDAEQQLDFFNEIQASTGKTA
DVLYLMALFGMKKGKKADEIMTLCQQTVESHFAKMAGLPLGTQYFELLNP
DFLLQVVDLLLVYAPTEPTGLVMSTNGALKKCGLILEPVIKTIPGFVKAQ
YVYAKVKFISGDIDTAKTYIQKCLEVDLNFVNAHILMAQIHLHNNNYSAC
EASLENGLSYNFEVKDSPIYHIICAKIQKKQNNLNESKETLMVAMNLPGV
KRPVSANEKPPKFSATLGDRVVVYLELADIQRQLNLTVC
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000352XLOC_000352Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000598TCONS_00000598Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom
IPR013026TPR-contain_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 372..392
NoneNo IPR availableCOILSCoilCoilcoord: 87..107
NoneNo IPR availableCOILSCoilCoilcoord: 577..597
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 329..362
e-value: 0.11
score: 21.6
coord: 531..564
e-value: 99.0
score: 6.2
coord: 497..530
e-value: 39.0
score: 9.8
coord: 110..143
e-value: 95.0
score: 6.4
IPR019734Tetratricopeptide repeatPFAMPF13181TPR_8coord: 498..528
e-value: 0.048
score: 13.8
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 329..362
score: 9.057
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 110..143
score: 8.054
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 497..530
score: 5.428
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 165..271
e-value: 6.1E-10
score: 38.8
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 95..164
e-value: 8.0E-6
score: 25.1
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 325..427
e-value: 5.4E-11
score: 42.0
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 272..324
e-value: 1.1E-5
score: 24.9
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 474..637
e-value: 8.0E-10
score: 38.1
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 7..94
e-value: 0.066
score: 12.6
IPR011990Tetratricopeptide-like helical domainSUPERFAMILY48452TPR-likecoord: 475..597
IPR011990Tetratricopeptide-like helical domainSUPERFAMILY48452TPR-likecoord: 117..365
IPR011990Tetratricopeptide-like helical domainSUPERFAMILY48452TPR-likecoord: 38..161
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 110..362
score: 20.208
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 497..564
score: 7.071

Blast
BLAST of TCONS_00000598-protein vs. Swiss-Prot (Human)
Match: TT21B (Tetratricopeptide repeat protein 21B OS=Homo sapiens GN=TTC21B PE=1 SV=2)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 276/622 (44.37%), Postives = 424/622 (68.17%), Query Frame = 0
Query:   12 INYCCREGYHRQLQTVCLDSLKKYGNDPVLVFWKAFGMLQEDNLSEAIQEFERIKDQRDVVLCSLMALIVAHKRSKSSDKQTVQQLEAKLKSERTQCGETALYFGGMFLFHSGRPDKAREYVDRMLKMSPDSSEGLILRGWADLKSSKENYVKKSIKYFDEALNSNHSVKDIDALLGKMEYMKRKQNFTGALDLTNQLVVMHPDFFPALVEKMRICLSLQDWEQTMETANRIFQVDTQNIEALHFLVLTYLCKDTDYNQAVEKISDVIQALDRHEPKNPHLYARLSKCYARLCGRNQNVLQQALTLLERAKSVSPKNADLYNEAGYQLMLQNKMRESLKSFKQAMKIDESSVKALMGIIHCQILQNQLDDAEQQLDFFNEIQASTGKTADVLYLMALFGMKKGKKADEIMTLCQQTVESHFAKMAGLPLGTQYFELLNPDFLLQVVDLLLVYAPTEPTGLVMSTNGALKKCGLILEPVIKTIPGFVKAQYVYAKVKFISGDIDTAKTYIQKCLEVDLNFVNAHILMAQIHLHNNNYSACEASLENGLSYNFEVKDSPIYHIICAKIQKKQNNLNESKETLMVAMNLPGVKR-PVSANEKPPKFSATLGDRVVVYLELADIQR 632
            INY C+E Y   +  V  + +K+YG+DPV  F+ A+G L E    EA++EFE IK+++DV LCSL+ALI AHK S + D++ + + +A++K +R   GE ALY  G+FL+H GR DKAREY+DRM+K+S  S +G +L+ W D+   KE Y KK++KYF+E L   +   D  ALLGK + ++ +QN++GAL+  NQ++V  P F PA V+KM++ L+LQDW+QT+ETA R+   D+QN+EAL    L Y+C++ D  +A  K+ ++   LD  EP+N  L+  ++  ++R CGR+Q +LQ+  TLLERA S++P+ ++   E GYQ++LQ +++E+LK +K AM +DE+SV AL+G I CQ+++ QL DA+QQL+F NEIQ S GK+A+++YL A+  MKK K+ +E++ L    +++HF+++ GLPLG QYFE LNPDFLL++V   L + P +P          L++C  +LE V++T+PG ++  ++ AKVK++SGDI+ A   +Q CLE + ++ +AH+L+AQ++L       C  SLE  LSY+F+V+D P+YH+I A+ QKK   + ++ +TL +AM+LPG+KR   S   K  K       R+ ++LEL D+ R
Sbjct:   10 INYYCQERYFHHVLLVASEGIKRYGSDPVFRFYHAYGTLMEGKTQEALREFEAIKNKQDVSLCSLLALIYAHKMSPNPDREAILESDARVKEQRKGAGEKALYHAGLFLWHIGRHDKAREYIDRMIKISDGSKQGHVLKAWLDITRGKEPYTKKALKYFEEGLQDGN---DTFALLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQPASPGQPLCPLLRRCISVLETVVRTVPGLLQTVFLIAKVKYLSGDIEAAFNNLQHCLEHNPSYADAHLLLAQVYLSQEKVKLCSQSLELCLSYDFKVRDYPLYHLIKAQSQKKMGEIADAIKTLHMAMSLPGMKRIGASTKSKDRKTEVDTSHRLSIFLELIDVHR 628          
The following BLAST results are available for this feature:
BLAST of TCONS_00000598-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TT21B0.000e+044.37Tetratricopeptide repeat protein 21B OS=Homo sapie... [more]
back to top