Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000595 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000595
Unique NameTCONS_00000595
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3221

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000595 ID=TCONS_00000595|Name=TCONS_00000595|organism=Clytia hemisphaerica|type=transcript|length=3221bp
TTCGAATCTCTGGGGAGATGAAATGGTTGTGGCAAAATTGCAGGCGTCCG
CATTCAGTACGATTCTGTCATCCAAAGGACAGCCACATTTAATCAAATAT
TAATaagcaaaatatttgagacacaGGAATTAACTcttaattaaaagaaa
atttacataCCATGATTGCAGTTTTGGAGTGAAGCAAATTCCTTCTAAAA
ATTTagtatttgcaaaaagtttttgcGATTTACTGCTTGCTCACGCTCCG
CTACTTTATCCGCCGTGTTTGTTATTGACTAGATCATATACGATTGAGTT
CTTCTTGAAAATTACGGAACAGAGAGTAATATAAGAAATACTAATGAAAT
AAAGCGTTCTGCAAAATACATGTTCTGCTTCTTCACTATACCGTAACAGG
CAGATAAGCCGATATTTGGCGAGGTTGGAAAGTTGAAAATCTTCAAGTGA
AAACCAGatgcatttttttctttaggAGGTGCTGTATTTCTGTTGAAATT
ATCGATAATTAGTAATACTACACAATAAGAAGATGGAGGCTATTAAAGAT
ACATttacaaaatccaaaaagaaaaaggtgAAAGCCGTTCACCAAAAGGT
TAAAGTTTTTAGAGTCCATGATCCAAAGATGGCTGTTTTAATGTGGGGTG
TGACACATTCGGTGTCGCAATTGTCTCATGTCCCACAACAAGTTATGTTG
CTCAAAGACGACTTCAAAGCATACAGCAAAATCAAGATAGATAACCATTT
TTATAACAAAGAACACATGCCTGGTcacttcaaattcaaagaatATATGC
CGTTAGTTTTCCGGAACCTAAGGGAACGATTTGCAATCGATGAAAAGTTA
TATGCAGCTTCATTTTTAATCCAACCGCAACTCAGTAAAGCACAAGGGAA
TAGCGGTGCAAAATTTCTACTGACCACCGACAAGAGATTCTATATCAAAA
CATTGCAGAGCGTTGAAGTGGAAATGATGCATCATATAATGCCTAGTTAC
CACAGatataTCGTCGAATCACACTCGGACACACTGTTACCACAATACCT
TGGTATGTATCGGACGACGTTGGACAACAAAGAATATTACTACCTCGTTG
TACGAAGTGTTTTCAGCTGCAAGAAGAAAGTACAAAAGAAATACGATTTG
AAGGGCTCGCGAATCGATCGAGAAGCCAAAGACTCTGAGAAGGATAAGGA
AAGTGTCACTTTCAAAGATAATGACTTCACCAAAGAAAATGCCAGGATAT
TCATTGGTgctgaacaaaaagaaaaattcaaagataGGCTAACTAAAGAC
GTCAACttTCTGTCTGGTCTGAACATAATGGATTACAGTTTATTGGTTGG
TATTCACGACACCGAACACGTCGACTCTTCCGAACCGGAAGACGAACAAG
ACGGTGAAGGACCTGACGGTGGCACTACCGGTGACGAATCTGGCGACGGC
CTCGAAGAGCCGGCATCTCCTACTACTGACGGAGAAACATCTGCCGCTAC
CCCTGAGACGCTTGCAGCACGTCGCCAACGTTACTCGCGAACGGAAAGTG
TATCCAGTAGCGATGGTTACGAATCGGAGTACTTTGCGCTCCCGTCCTCT
GACGaatCACTTCATTCCGTATATTACATGGGTATCATCGACGTCTTAAC
GTATTACGGCGCCACCAAAAAAGCGGCACACGCGGCAAAGACAGTGAAAC
ACGGGGCAGGTGCAGAAATATCCACAGTCAAACCACATCTTTACGCCACG
AGGTTTTTAGAGTTCATGGATTCGGTCAtggaatgaaaataattttcgtc
TGTTTGATTTTCAATACTTACAAATCTTGCTCTTTTAAATTACGTTGATA
AAATGTAACGAAagaacattggtgatttggtgATACGGAAATCTGACCGA
ACCCCCAACAACCTGGCTGTGTTGGGTGATCGATTCGAGTTTTGACGCCT
GGTGACTATGCTGCTGAATCTCGGATTATCAGAGCTCGCTTCAACCGTCT
TGCTCACCAAACAGAAAGAAACTGTACGCATTTAAACCAGTACGAGGGTC
acaatttgttaaaattgtaTAAATTGTACATCTTGCACACGTTAGAGGAT
CTCGAGAAAATGGATTTGGACCCGTTTCACAATGCTGTTAAGTTTATGTt
caatttgagattattttaCAAGTCTCGATATTTGGTTGTTTAATGATACA
AAGAGTTAAGTCTCGTCCAATCTGAATTTTAACtcatatataataaaaaa
acactaaCCCCTGGTAAAATTCTTGACTTAGGCTATACCCGCCATCTTTA
GTCAGAGTTATACTTTTGAAAtgggtacccgtaaagaagacattgcatta
cAACTTTCTCTGATAAAAAACGATGCTACATCACAATTGTCTAACGACAA
GTATATCTAGCGCTCTCAACGCATTCACATCACTGTCGAGTAGTGACATT
ATTAGGGTACTACTCCGATCAAAGGTTTTGGATTGAGAAACTTCCCAGGG
TTTATATAAAGTTCAGTGGAAGAAAAACATGTCTTGAAGTCATGATATTG
TAAAGATATTTCCCACTATACTTTCATTCCTCCACTTTCGGGATTAAAGA
TAGCTTAGTACTTTTCCCTCTATGTATCAAGTAATTAAAGAATTTATTTT
GCATTATTTTAAAAAACCCGATTTACCAGAGAATTTGTAATTGTAtgtct
taaaatctttttaatgaGGTTTTTGACAGTATTGTTATTTTTAGGTTAGC
TTTATCTTTCTTATTAGAGCGCGAAATTTCCCTCCTTAAAATTTAATTAG
AATTTAGATGATCTATAATCTCAACTAGATGGTATTCTTCAAATTCAATT
CTTAGCTTAGAAGCCTTTACCCAagcattttcaatttaattttagcTCAT
AAAAAAACCGCTAAAGGGCGTGCTAGAAAGTGCTTTTCAATGGTAACACA
TGTTGGGCTGCACCTTGAAAACTTTATAATTATGTATATTTTGAAGCAAA
GAATAGCATGTTTTTTGTACATTATTTCGATAAATTTTGACCTTATTTTA
TTCATGCGGGCCTATACAGAGAGTGGACAAATCTTTATGTAAAGTAAAAT
CCTTACCTAAAATCAAACCTTAAACTGGGCTTAGAATAATTGGAATAAAT
TAcaattctttttgtaataaatagatattcaatccccaagatgattgaat
aggttCTTGAGATGAAAATAT
Run BLAST on NCBI

protein sequence of TCONS_00000595-protein

>TCONS_00000595-protein ID=TCONS_00000595-protein|Name=TCONS_00000595-protein|organism=Clytia hemisphaerica|type=polypeptide|length=417bp
MEAIKDTFTKSKKKKVKAVHQKVKVFRVHDPKMAVLMWGVTHSVSQLSHV
PQQVMLLKDDFKAYSKIKIDNHFYNKEHMPGHFKFKEYMPLVFRNLRERF
AIDEKLYAASFLIQPQLSKAQGNSGAKFLLTTDKRFYIKTLQSVEVEMMH
HIMPSYHRYIVESHSDTLLPQYLGMYRTTLDNKEYYYLVVRSVFSCKKKV
QKKYDLKGSRIDREAKDSEKDKESVTFKDNDFTKENARIFIGAEQKEKFK
DRLTKDVNFLSGLNIMDYSLLVGIHDTEHVDSSEPEDEQDGEGPDGGTTG
DESGDGLEEPASPTTDGETSAATPETLAARRQRYSRTESVSSSDGYESEY
FALPSSDESLHSVYYMGIIDVLTYYGATKKAAHAAKTVKHGAGAEISTVK
PHLYATRFLEFMDSVME
Run BLAST on NCBI

transcript from alignment at sc0000002:1319057..1336323-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000595 ID=TCONS_00000595|Name=TCONS_00000595|organism=Clytia hemisphaerica|type=transcript|length=17267bp|location=Sequence derived from alignment at sc0000002:1319057..1336323- (Clytia hemisphaerica)
TTCGAATCTCTGGGGAGATGAAATGGTTGTGGCAAAATTGCAGGCGTCCG CATTCAGTACGATTCTGTCATCCAAAGGACAGCCACATTTAATCAAATAT TAATAAGCAAAATATTTGAGACACAGGAATTAACTCTTAATTAAAAGAAA ATTTACATACCATGATTGCAGTTTTGGAGTGAAGCAAATTCCTTCTAAAA ATTTAGTATTTGCAAAAAGTTTTTGCGATTTACTGCTTGCTCACGCTCCG CTACTTTATCCGCCGTGTTTGTTATTGACTAGATCATATACGATTGAGTT CTTCTTGAAAATTACGGAACAGAGAGTAATATAAGAAATACTAATGAAAT AAAGCGTTCTGCAAAATACATGTTCTGCTTCTTCACTATACCGTAACAGG CAGATAAGCCGATATTTGGCGAGGTTGGAAAGTTGAAAATCTTCAAGTGA AAACCAGATGCATTTTTTTCTTTAGGAGGTGCTGTATTTCTGTTGAAATT ATCGATAATTAGTAATACTACACAATAAGAAGATGGAGGCTATTAAAGAT ACATTTACAAAATCCAAAAAGAAAAAGGTGAAAGCCGTTCACCAAAAGGT TAAAGTTTTTAGAGTCCATGATCCAAAGATGGCTGTTTTAATGTGGGGTG TGACACATTCGGTGAGATTTTCTTTTATTACCAGAAACTTTAGAGGAGAA CTACAAATACAAATATAAAACCGTCACAACTGAACTTGNTTTTATTACCG GAAACTTTAGAGGAGAACTACAAATACAAATATAAAACCGTCACAACTGA ACTTGAGACATTTAAAGAATTTAGCTAGCCAAAGCTAGCTGCCAAGCTCA GTTTTTCAAATCCTATTGGTTCAGGACCCGCCCTGCCGACGCACCGGACT GTCTCGGTATTTGTCCGGTGGTAAAAAGTATCCTTTCGCTACACCGGAGG CAATAAGTCCGGTGTCAGTCCGGTGTTGCATACAGGTAATTTTGGACGCC GGACATTTATGAAACAAAAAATTAAGAAACACCGGACGCACAGGACTGGT GTTTTGATTGTCCGGTGGAAACAAATATCCTTCTCCGACACCTGACATCC GACTTCTTTAAGTCCGGTGTAGAGATTGTCCGGTGGTAAAAAAATTTCTC ATTTTACACCGGACTTTCGCGTGTCCGGTGTTCCTTAGGTCCGGTGCATC GGCAGGGTCCTATTGGTCCTTGTCTTTTTATTTCAACTCACAAAAATTTT AGGGACCTGTCAAATACTGTAAGTTCATAGTCATAGTGGACATCCCAGCC TCATCTTATTCTGACACCCTTCTTTACTTTTATAAGAGTTGGAAATAAAA GGAGGTCAGATCATATAGATTGATTTGGTGTTTGCTTTAATAGCGTGGTT AGAGAGGAAAAAATTCAGTCAGTCACACTAGCGTCCCGCCAAAATGCGTA GCAAAGATTAATGATGATGCGAAAGTGCTATAATCTTTAACTTGACTTGC AAGCAAAATAATGTGCCGTAAAACTTCTAAAGGGATTCATGAAAAAATAA CCTGGCGCTTTTTAATGAAATTAACATTTACAAAAACAATGAGAAATTGC CAATTGCCATTTGAGCCATAGATGAAAAAATTTGAGCCAAGCCAACCTTA AAAACTAGTTTGAAGATCAACTTCCCAAGAAAAAGATCTATGGGGGAGAG AAAACCCACCTAGATCCGCGCACCGCAGAATAAGCTATTTCCTGGAAATT TTGCCAGACCTCAAACAATGGCCCATTTACATGTGCAGAATTATTTTTGC TTTAACGATAATCAAGGCCTAACAAATTGAAGCGCTGTCTCAGGAATTGA ATTACAAAATTTGGTTGGCTGATTGGCTGCTGCACGTTTAGTAATCGGTC ATTTTGTTCATAGTGTCCTCCCCCCCCCCTTTATAAAGGGGGGGGAAACC AATTTTCCAATTTTGAATGGGTGAGGGGGGAAAATGAAAATTTGAATAGT AAAGGGGGGGAAAAAAAGAGGGGGGAAAACATCGATAGTTGGCAAATTTG GTGGGGGGAAGTATGAAATCACTTCAACTTTATCTCAGCAACCAAGGTAA GTCCACATGATATCATGTGATTAGATCATGATTGAAAAATTAACCAAATT TTGTTCTATTTTGTCCAGTTTTGTCTAGTATTCCTTTTGCAGCAAAATTT TACGTTTGTGTCAGGTTGATATTTGAGAAATTTATACGGGTATATGGGGG CAACTGATATTTTCAGAATTTTCTGGGGGGAAAGCAAAAAAGAGGGGGGA AACTAAAAAACCAAAAAGTCATAGGGGGAAAAAAAAGAGGGGGGAGATTT AAAAAATTCAAGAATTTGGTGGGGGAACAAACCCTGGAGGACACTATGAT TTGTTTCATTTGAACAAGTCTTAATTAATTGTCTTGGGATCTTGAACTTG ATTCAGGTAACTCTCATCATTGTTGTTGCAAATACATCCTGTAAATGACT GATGTGGTTTTTTCTAAAAGCTTGAAAAAATTTGGGGTATTTACGGGACA CTTTTACAATAATTTTTAGGAACATCTACTAAATTTCATGGAAAAGTAAT AAATGTTGTATAAAGGTCATACTTTGACAAATAAAATATCAAAATATCAG ATCTCTAGGATCAATACTTTCAGAGTAATGCTCAAACAAGTCAAAATTGT TCCGTAATTACCCCAGATGACTATATTCCTATCCCTTTGATAAAAGATTT TTCTAGTCACATACAGTCACCTTTAAAATAACACTATCACACACTGTCGT AATCTTAGTATACTAAGACATAAAAGCATCATTATAACATATTTTAACAT TCAATAATTCATGTATATAACCTTGCAGGGTAACAATGAGAAATGCCCCT AAATTTGTATAGGGATTGCAGCGTAAAGAACGAGTCTACCAGAACAAGCT ACTATCTGCTCTTGATCTACCTGTTGATTGAAATATTTCTATCCCAAATA TCTTAGACTGCAGTAAAATCAGGACCTGTACAATTGATTGGAGGTAATAT ACTAAGACAGGTTAAAAAAATTTCCTCCAACAGAGTCTTCTTCGCTGATC AAATCATCATGCTCTTTNAAGGTTATAAAAATTTACTCCAACAGAGTCTT CTTCGCTGATCAAATCATCATGCTCTTTTAGCATTCTAAGACATCAATCT CTTTTCAGCATACTATGACATCTTATCTTAGTATACTGCAACCTAATACA AGTCAAATATTTCTTAGTATATTAAGAGGTTGCAGTACACTCTGTGGTCT TAGTATGCTACAGTTAAACTTGACTGCATACTATGTTGAATAAAACTCCA GCATCAAAAAAATGATAAATAAAAAATTAATATACACACTTATAATTACT ATACATTAATGTGTTATTGTTTTAATGCTAGAGTTTTTGATTATTCAACA CAACATTCTGACTAGCAAAAGGTCTAATAAACCAGCCGAGGCTGGAAGGT CAGCCAATAGAGCTTAGCTAGATAGCTTTAATAAGTGGGTTAACAGATGT AAGAGATGTACTGAAACAGAGTAGACNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTAGGGA TGTGGACATTAGACCAACTTATGGTACAAATCATGACATAATATTCTCTG AATGTTCAAAGTTCAGTACAAGGTGTTGCAGAGAACTGAGGACTGAGAAC TGTTTCAAAGGTTTCAGCTTTTTCATGTGCATGCACATGCGCATGCATGG GCAAACAGGGGAAGTTTTTTAGGGTATAATATCACTTACTTTCTATGATA AATTTTAAGTAAGATCCTAGGATTTAAAAATTCTTAAAAGCGATATGAAA CAAACATGGTATTTTTTTAAAAATGATAGACTACAGTAGTAAAGGTTGCA ATTTCATGTGTACTTTCCATTCAGATCAATCTTGATAAACGGGTGATTAA ACATACCTTTAAAAAATTCTACGATTTTGAAAGCCTTTATTACGTTTTAA AAAACTCAGAAATCCAGTTTTCACTAAGAGGATTTTTCAGACTGACATCT ATCACTGTCTTGAAGCTGATATAATATCTAGCTTTGAGCTACTCTTATCA CCTTTCCAATATCGTGTATATAATTACATTCACTCTTGATAAATGGGATA TATTGCATGAAATTGTTACTGCACTTTTATATCACATAAGTTAAGCTTGT ATTATGAAGATTTCCCAGACTGGCAACAATCTTAAGCTTGACATCCATAT GAAAATGAAGATTTCTATCTACTCCACCTAAAATTTATATTTTCGGAAAC TTTGAACCTGGCTGATTTCAAATCATTGCATGAAACTAAGAGAGATATTG TCAATTTTTTTTGGAAATACAGTCTATTCAGAATTTTGTCAATTTTCAAT GTTCAAAGCCAAATTTTGGTCTAAAAATAATGGAACCAAAAATTTGAAGA AAGAAAGCCATATGTGAAAATATTTTTTGAAGTTATGCTGAACTTTGCCT TGATCAGGTAACAATATTACTTTCATGTAACATCATGTTGCCTTTTTTCC AACTTGATTTTGTAGGTACAAATTCTTTTTTCCTTTATTAAAAATGAAAG AAATTAAAACTGATTAAAAATAAAAATGCCATTTTTTTAGCGGCTGGTCA TTTAGGAGCAGAGGGAGGGGGTTCATACTAAATCTCAGTCGTCATGTTGT TTAGTCTGGGGAGGCACTCAAGGTAAGTGACCTACCGTTGTGCAACCAGT GCGTTTTCAGGCCTCCAAGTGCACTGTAAGGGTCGAAATGAGTAAAGATG AGAGATGCGCTTTATAAAGGGTTAATAAATAGCCTTGGCAAAGTTTTTTG GGCAAAATTTCAGATATGATCTAACATTTTTTGCCTAAAAAAAATGGACA AAAATTTTCCAGAAAATGCACTGTAGTAAGGGTCGTTTTTTGCCTAGATT TACTCAAATTTGGCTAAATTTTCTGTGCTGTAAGGGTCCGATTTACGGCC AAATCTTGGGTTGCACACAGTTCACTTTTTGATGTCTATTTAAAGATGTA CAAAAAATCAAGATTATATCCTATGTTCTCAGAAAATGTACATATTTTTT CAGGTGTCGCAATTGTCTCATGTCCCACAACAAGTTATGTTGCTCAAAGA CGACTTCAAAGCATACAGCAAAATCAAGATAGATAACCATTTTTATAACA AGTAAGTTCGAATTTGTAAGTTTTTATATTCATACGAATACCTGCCCTTT TAATTATTGTAGACTTTCTGAAACTTAAAGGTTTTATTTTTAAATAAGAG TGATATCGTTTGCTTACTCTTCAATTTTAATTTACAAGCTTTTTGATATT GAATTGACACGGATTTTGAGCAAGATTGGTCAGAAAGAGGAAAAGAAAAA CATTTTTTTGCTCATATCAGAATAATAGGCAGACTCTGACCTGGTATGAA ACATGTGCCTGATATGAAACGGGAATGCTTATGTAAAAATAAAACCTTTG AATCAAATCGCAATTTAGGAATTTGCTATAATAGCCTGTACCAGAACATT TTCAAATTTGTGACAGAATAGCTTGGCACTGTTTTAGATCAGCGTGTGGT GCTTTTTATCCAACCTTCTAGCGAATGGTCCGTGGTTTGACTCGCGTTCT TTTCTTTTGTGTTGAAATAAAAGCTCAATCGATTTAGTCGTCACAAGACC TGAATTTCCAGATCTTAAGTCATAATTGCTTTCTCGGCGTTATTATTGTT AATGATTATGAATTTTTCTTATTCTAATTTCTTTCAAATAATTGATGTGG TTATAACTAGCTCATTAAAAAAGTGATATAGTCATTTTAAACTTATGATT CATTGAGAATGATCAAGCCTAGTTTTATGGAAACTCAGTCACAGATTCAT TTTGTTAATCTAAAACTATTTTCTTCATGAATGTGTCACAAGGCTGGCCG TTCAGAGTATGCCTTCTCTTGTTTCTGACTCAATGTTTTGATAATTGAGG TTCATACTTTTGACGAAAAATGTAAAAGTATTTCCCTAACCTTTCTGCTT TCCCTTGGTCGCTTTTTTACTAACGGAACACGTTTTTGTGTTTTCATAAC GTTAACACTATCTTTTATCTCGACTGAAATGTTTGCTTTCTAAATTCTTA GAAATGAGGTTGTTTTTTGAAAAAATATGTTTGTCAGAAAGGGATTTTCC AGTTGTACAGTTTTGTTTTTTTCCACGAGGAAAATGATAAAAAAACCTAT CGAAATTGTGACAGGATTAGAAATTGAATTTGAAAGATATGAAAAATGAG TGAAAAGTAACGAATATCAATAATGAATTGGATATGACATATTATTTCCC ACCAATAGAATCGGCCCAAAATTTGAATAGCAAGTCAATGAGATTTGCTT ATTTCGAGAAGAAGTATTTAAATTATTTATCAACATTAAGGCAAATTCTC TATATACATTTTATTTTAAGGTTCAATATCGATTTCTGTTATGATAAAGG TTTAAAGCATTTGAAGAAAAACATCAGAATTGAAAACCCCAAAACGCTTA AGTCGACGAAACGAACTTCACATCAATATTATTGTGATAAAGATTAAGAA TCATTATTAGCAAAAGCCTTGTACAATCTTTTATAAGAAAAAATCGATTC TTTGTGATTTGGCTGTCAAAATTAAGGTACTCTCATCCAAATCTTACTAC TTGACCCAAAAATGCTTGAATTTCAGCAATTGCAGTATCAGCATTCTTCT TAAAAAATTATTTTTTAGTCTTAGTTATTCTTTTGAAGATTTTGAGCCTC ACTCTTTCTTAAAAATATGAAATTGTTCTGATAAAAAAATGTTAATTATT TTAATAAGTTTTCACAAGTAAAAATTCCAGACAGGTTATAAAAATTGACC TGTCAAATAATGTCTATTACAATGTCGTGTATGAAAACATAATCCTATTA TTCGAAATAACATGTCTGTCATCTTATACGCCTTGCATCTGAACTCTCCC TTGTATTACTGTCTGAAAACAAGAACTATCATAAAATATTTTTTAAACAT CCCTTTTCTTAGCTCCAAGCAACTCTTTTCAAGTTTTTCCGTTTTTCGTG AAAGAAAATTGTTTCTTTGGTCCATCACCGCCATCACCAAAGAAGCTAGG ACAAATAAGATAATCTCAGTCTCAGCTTTCAGAATTTACCAAGAAAATGC TTTTTTTAGCCCCTTTGAGGCTAATAAGTACATTTTCTGATCATTTAATT TTTTAGATTGCGGGGCTTAGCCAAAGCTTTGCTCCTATTGTCTTTTAGGA CTTGCGATGGACTGTAATTTTTTGCCATGAATTAGCGTGGAGCAAAATAT TGTATTGTCCATTATCGGAAATCTCTACTCTTACCCCACATTCGTAAACC TTTTTGAAATCTCAAAGAAGAATATACTCTTATAAAACAATTAGAGTATT AATGATTAAAATTATACTTGTTTCAATTTCCCTCTACTGTTTTTAATGTG TTTTCTTTGTAGAGAACACATGCCTGGTCACTTCAAATTCAAAGAATATA TGCCGTTAGTTTTCCGGAACCTAAGGGAACGATTTGCAATCGATGAAAAG TTATATGCAGTAAGTACAACATAATATACTCCTCATGACATCGTGATTTT AGGGCTGCTCGGTTTTCTGCTATAGAAAATCCCAATCCTGATTTAAATAT TCTTTGGAAAGGAGGTTTTTTTTTTGTTTTCAAGCACCTTTCTTACTTGC TTTCCCAAACTGAATAAAAGCCTCTTCACTTTTAAAAACTATTTTCTTGT TTAGTTAATATTGATGTTTATGAAATTTCAATATTTTCTTCCTTTTTAAT AGGCTTCATTTTTAATCCAACCGCAACTCAGTAAAGCACAAGGGAATAGC GGTGCAAAATTTCTACTGACCACCGACAAGAGATTCTATATCAAAACATT GCAGAGCGTTGAAGTGGAAATGATGCATCATATAATGCCTAGTTACCACA GAGTAAGTTTGTTTGTTTGCAAAGATTTTGTTTGAAAATCCTCCTTCGTC GTCACAGCAGCATTTGCTTTTCCTTTCGTCAAGTGTCCCATCGTATCTCT ACTAAGCCTAGATTACACTTTGATTTGCTAAAGCTTACTTCACACTAACT GTGCAGCAAATATAGTTTTAAAAACCCTCCGAGTACCTTCTTTTGGGCCC CACCCCATTCAGACCATCTGTATCTTGTATTATTGAATTGATCGTTTTTA ATCTCTGGGAGCTAACAAACAACTCCCATTGGTTAAGTTGATTTTTGTAA AACAAGGCGGCATTTTTATTTTAATCTCCACAACAATTAGTGTTCGAAAG TATTTCCACCTACCTAGACTATTCCAGACCCTCTTCTATTATGTACGCTA AATATAAACCTTCCACCGTTCACAAACCAATGGTGAGTTTATGTATGAGT GTTTTTCTGGATTTGTTAGATCCTGACTGACTGAGGACGACGGTAAATAG GCACTTTTACAAATCGTTTCAGTCGCTCCGCCGTCCTCAAAATTGCAAAT ACATCAACTCGCTAATAACTGGGGAGGGGGCGATAGGAATAAGAATGGCT GGACAAGATGTTGGGTGAAGTGTTTATTAGACTAAAGTGTCTCCAGATAT AATTGGCAGTGGAAACAAGAATGCCTGTAACTTTTGATAGTTTTTATTAA AAATAGCGCTTTTGATTCTCTAAAACAAGCAAAAGAATTTCCGCAATTAT GTTTGACTATCAAAAGTATTCTTGTTTCCACCGCCAATTATCTGGATAGA CTTTAGAGACCGTTCTTCAAGGCGTTTTAATTATTGTTTTTCATTTTTAG TATATCGTCGAATCACACTCGGACACACTGTTACCACAATACCTTGGTAT GTATCGGACGACGTTGGACAACAAAGAATATTACTACCTCGTTGTACGAA GTGTTTTCAGCTGCAAGAAGAAAGTACAAAAGAAATACGATTTGAAGGTA CGAAGATACAGCTGAGTCACTGTTTTTCCTTATTATAGAGAAATTTTTGT TCTTTGCCCTTCTTTATTTAAAGATATTAAGATTAGCCCGCTGATGGGAG AAGAATCTCTCGAAACGTATCCGAACGTAAAATCTCTTTCGTGGGGCAAA CCACGGTGGACTTTCAATCTGATTTTTTAATTACTTATCTTTTCTTCATC ACAGGGCTCGCGAATCGATCGAGAAGCCAAAGACTCTGAGAAGGTTTGTA GTTAGAATATAGCTTGCTTCTTGAACTCGCCTTAATATTTTTGTGTTGGC TGGTTTGGGCTACTTGAAACATTGGGTTCACTCGGAAAACTTTTTTGCAA ACCTTTTTTAACTTGGCTGAATTCTGCCTCGCAACACTTTCGTACGGTCT TGAGTTCATTTCACAGGTTTTCAATGCTTATACGGACCAATTTTCACCCT CCGGAGTAAAGGCAAGCTTAAACAGAAAAAGTAATTTAATCAACTTGAAT TAGATTATTTTCTGAAGCTGTCTGAGGTAACAATATATTTTTAGGATAAG GAAAGTGTCACTTTCAAAGATAATGACTTCACCAAAGAAAATGCCAGGAT ATTCATTGGTGCTGAACAAAAAGAAAAATTCAAAGATAGGCTAACTAAAG ACGTCAACGTAAGTGTATTTACTATGAAAGTGTATGGGCCGAGGCTGTGA GGTGTACATAATGTAAAATGACATTTGCATAGCATTACGACCAGACTCGC TGCTATTCAATCAGCCATCCTCAGTTGATAACCCAGTAATGTAGGACTTT TAGACGATTGAGAGTATTTGTTTTCATGGGGTCCATGACCATGAACATGA ACATGAACATGAACATGAACATGAACATGAACATGAACATGCGAAGAAGT GGGGTTCAGGGATTAAGGGGGTTGTGGCATTGAGACGTCTAGATCATTCC ATCACCGCTCCTAAAAAACGAATTTTATTTTGCTTCAGTTTCTGTCTGGT CTGAACATAATGGATTACAGTTTATTGGTTGGTATTCACGACACCGAACA CGTCGACTCTTCCGAACCGGAAGACGAACAAGACGGTGAAGGACCTGACG GTGGCACTACCGGTGACGAATCTGGCGACGGCCTCGAAGAGCCGGCATCT CCTACTACTGACGGAGAAACATCTGCCGCTACCCCTGAGACGCTTGCAGC ACGTCGCCAACGTTACTCGCGAACGGAAAGTGTATCCAGTAGCGATGGTT ACGAATCGGAGTACTTTGCGCTCCCGTCCTCTGACGGTTTGTATTTTCTT CAACCTAAGAAGTGTATAGGCTCAGAAAACATCACTCACTCTTTATGGTA TCCTTTACTACAGTACCTGAAAATGTTAATTTCAAATTTTTTCTTTTAAA GAATCACTTCATTCCGTATATTACATGGGTATCATCGACGTCTTAACGTA TTACGGCGCCACCAAAAAAGCGGCACACGCGGCAAAGACAGTGAAACACG GGGTATGTTTTTTTACGTGCTGTTATTTTAATTAGTGATTTTTTTTTTGG TTTGAGGGATTTTATGCACTTGAAAATCTCTGTAAAACCTTTATGTTTGT ATTGCAGACGTTGGGCTTACATTATTAAAGCTATAATTTTTAGTTTGTTA AAATTTGATTGTTTGATGCTTGGTTGTGGAAGCTCAAGTTGATTTCTTCG AAGCTGATCAAACTCGTTTTTTAGATGTCCGAAAAGGAAAATTTCTAACA AAAATAATGACAAATTCGCCTAGGGTGAGTCATTAGGATTAGAAGTTAAG GATCGGCTTATTTCAAAGTAAAAGTCGTTACCTTTCCAACTGTTTCGCTT TACTGTTGGAAACCGCTAACGTTTTGTATAGATTTGAAAATCGATATTTG AGGTTTTAAAGTAACAAGATGTTTGAATAATTCATTATGCGAGATGAGAG AATTTCAAAAGATTCTTTTCATGCATTCTTGTTGTGGGTGTTACTAAGGA AAATATTATGCAAGGTTCACTTTCAAAACGTATTCAATTTCAAAAGAGGG TGGTAACGAATTATTTTCTCAAAGAATTTTCGTTAGGTCATCATTAAAGT AAAATGGTAAAATAATTGTGAAAGTGGGCTGGTTTCTATTTGTTAATTTT ATTCGTTTATCTGTTGGGTAAATGAACATTCAACTTGTTGTACATCAATT TTCGATATTGCATAGTTTCTAGAGGGGTCAAGACCCCCCCCCTTATGTAA GAGGACCCCCCTTAAGTGCAAACCCCCCCCCCCCTATTAAGAGGATCCCC CCTTAAGTGCTACCCCCCCCCCCCTTAGGAAATCCATTTAAAATTAGAAA CATGTAAATGATTTTTAAAGTTACGTTTAAATTTTTAGTATGAAATAATT TTCCTGTTAAATCGAGAAATATAAAAGAGTTGATACTAATATTAGACGAA TATGCTAAATTTTATACACTTTAAAATAAAATATAATCGACGTAATTTTG TTCAATCATTCCAGCTTAATTATAAACGCTCGGGCTAAACCAATCTTATT TAAATTTTCTCACGAATAAATGAATTAAATATTTTTTTAATCTCACTAAT CATTTTGATTAATAGGTGTTAAACATAAAACGGCGTTCGACAAGCGAACC CAATATGCCCAACATGAAACTCAGCATGGAGTTTAATAAGGTAATGTAAT AATGTAACACTCTTAATTGATCCTTAAATAATGCTTTAAAAATTAACTAT AATGTAAAATTTTAAATTGTAATTTGTTAAAATGGATAGCTGAGAATTTC TAACCACGGTACCAAAAATTCCAAATTTCAAATTTAAGTCTTTTTGGGAA ACTGGAAATTGTTTTCAGCTGAATGGGCTTTGATTTTTGGATTTACATAT AAGTTATATATGATTAAGACAAATCTCAAAATCAAAGATCGGGGAACAAA AATTAGCTCTTTCGTCTTTTCTTCTCAGCGAAGTCTAGAAATTTACCGAA ATTCAATAGATTGAAATAGATAGTCTAAGATAACTTTTTTTATAGAGTTA TTTTTTGTCTAGAACAAAAGTCTTGTCTGCTAATTATAACCTGATAACAG ATTGTGTATTTTCTGGCCCAGTACGCTGAAGCTCTAAAGACGTGGGCGAA AATATACAATCTGAAGAATATGGTCGCGCGCCTNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGTAGAGATAGGGC CATTTTCCTCAGATGTTAGTTTTCAGCGATCTTTAGAGCTTTAGCGTGTC GCGTAGAAAACTCCACAGCTGCTATCAGGTTAGCTAATTATAGACGTTTT GTCACTATGGTTATTGTAAAAGAAGTTAAAACGATCGACTTATCGAGTTT TCCGCTAGCAACGCTAAATGATTGACCGTACTTTTATAATGTATTTTACA GGCAGGTGCAGAAATATCCACAGTCAAACCACATCTTTACGCCACGAGGT TTTTAGAGTTCATGGATTCGGTCATGGAATGAAAATAATTTTCGTCTGTT TGATTTTCAATACTTACAAATCTTGCTCTTTTAAATTACGTTGATAAAAT GTAACGAAAGAACATTGGTGATTTGGTGATACGGAAATCTGACCGAACCC CCAACAACCTGGCTGTGTTGGGTGATCGATTCGAGTTTTGACGCCTGGTG ACTATGCTGCTGAATCTCGGATTATCAGAGCTCGCTTCAACCGTCTTGCT CACCAAACAGAAAGAAACTGTACGCATTTAAACCAGTACGAGGGTCACAA TTTGTTAAAATTGTATAAATTGTACATCTTGCACACGTTAGAGGATCTCG AGAAAATGGATTTGGACCCGTTTCACAATGCTGTTAAGTTTATGTTCAAT TTGAGATTATTTTACAAGTCTCGATATTTGGTTGTTTAATGATACAAAGA GTTAAGTCTCGTCCAATCTGAATTTTAACTCATATATAATAAAAAAACAC TAACCCCTGGTAAAATTCTTGACTTAGGCTATACCCGCCATCTTTAGTCA GAGTTATACTTTTGAAATGGGTACCCGTAAAGAAGACATTGCATTACAAC TTTCTCTGATAAAAAACGATGCTACATCACAATTGTCTAACGACAAGTAT ATCTAGCGCTCTCAACGCATTCACATCACTGTCGAGTAGTGACATTATTA GGGTACTACTCCGATCAAAGGTTTTGGATTGAGAAACTTCCCAGGGTTTA TATAAAGTTCAGTGGAAGAAAAACATGTCTTGAAGTCATGATATTGTAAA GATATTTCCCACTATACTTTCATTCCTCCACTTTCGGGATTAAAGATAGC TTAGTACTTTTCCCTCTATGTATCAAGTAATTAAAGAATTTATTTTGCAT TATTTTAAAAAACCCGATTTACCAGAGAATTTGTAATTGTATGTCTTAAA ATCTTTTTAATGAGGTTTTTGACAGTATTGTTATTTTTAGGTTAGCTTTA TCTTTCTTATTAGAGCGCGAAATTTCCCTCCTTAAAATTTAATTAGAATT TAGATGATCTATAATCTCAACTAGATGGTATTCTTCAAATTCAATTCTTA GCTTAGAAGCCTTTACCCAAGCATTTTCAATTTAATTTTAGCTCATAAAA AAACCGCTAAAGGGCGTGCTAGAAAGTGCTTTTCAATGGTAACACATGTT GGGCTGCACCTTGAAAACTTTATAATTATGTATATTTTGAAGCAAAGAAT AGCATGTTTTTTGTACATTATTTCGATAAATTTTGACCTTATTTTATTCA TGCGGGCCTATACAGAGAGTGGACAAATCTTTATGTAAAGTAAAATCCTT ACCTAAAATCAAACCTTAAACTGGGCTTAGAATAATTGGAATAAATTACA ATTCTTTTTGTAATAAATAGATATTCAATCCCCAAGATGATTGAATAGGT TCTTGAGATGAAAATAT

Coding sequence (CDS) from alignment at sc0000002:1319057..1336323-

>TCONS_00000595 ID=TCONS_00000595|Name=TCONS_00000595|organism=Clytia hemisphaerica|type=CDS|length=12540bp|location=Sequence derived from alignment at sc0000002:1319057..1336323- (Clytia hemisphaerica)
GCAGGTGCAGAAATATCCACAGTCAAACCACATCTTTACGCCACGAGGTT
TTTAGAGTTCATGGATTCGGTCATGGAATGAAATCACTTCATTCCGTATA
TTACATGGGTATCATCGACGTCTTAACGTATTACGGCGCCACCAAAAAAG
CGGCACACGCGGCAAAGACAGTGAAACACGGGTTTCTGTCTGGTCTGAAC
ATAATGGATTACAGTTTATTGGTTGGTATTCACGACACCGAACACGTCGA
CTCTTCCGAACCGGAAGACGAACAAGACGGTGAAGGACCTGACGGTGGCA
CTACCGGTGACGAATCTGGCGACGGCCTCGAAGAGCCGGCATCTCCTACT
ACTGACGGAGAAACATCTGCCGCTACCCCTGAGACGCTTGCAGCACGTCG
CCAACGTTACTCGCGAACGGAAAGTGTATCCAGTAGCGATGGTTACGAAT
CGGAGTACTTTGCGCTCCCGTCCTCTGACGGATAAGGAAAGTGTCACTTT
CAAAGATAATGACTTCACCAAAGAAAATGCCAGGATATTCATTGGTGCTG
AACAAAAAGAAAAATTCAAAGATAGGCTAACTAAAGACGTCAACGGCTCG
CGAATCGATCGAGAAGCCAAAGACTCTGAGAAGTATATCGTCGAATCACA
CTCGGACACACTGTTACCACAATACCTTGGTATGTATCGGACGACGTTGG
ACAACAAAGAATATTACTACCTCGTTGTACGAAGTGTTTTCAGCTGCAAG
AAGAAAGTACAAAAGAAATACGATTTGAAGGCTTCATTTTTAATCCAACC
GCAACTCAGTAAAGCACAAGGGAATAGCGGTGCAAAATTTCTACTGACCA
CCGACAAGAGATTCTATATCAAAACATTGCAGAGCGTTGAAGTGGAAATG
ATGCATCATATAATGCCTAGTTACCACAGAAGAACACATGCCTGGTCACT
TCAAATTCAAAGAATATATGCCGTTAGTTTTCCGGAACCTAAGGGAACGA
TTTGCAATCGATGAAAAGTTATATGCAGTGTCGCAATTGTCTCATGTCCC
ACAACAAGTTATGTTGCTCAAAGACGACTTCAAAGCATACAGCAAAATCA
AGATAGATAACCATTTTTATAACAAATGGAGGCTATTAAAGATACATTTA
CAAAATCCAAAAAGAAAAAGGTGAAAGCCGTTCACCAAAAGGTTAAAGTT
TTTAGAGTCCATGATCCAAAGATGGCTGTTTTAATGTGGGGTGTGACACA
TTCGGCAGGTGCAGAAATATCCACAGTCAAACCACATCTTTACGCCACGA
GGTTTTTAGAGTTCATGGATTCGGTCATGGAATGAAATCACTTCATTCCG
TATATTACATGGGTATCATCGACGTCTTAACGTATTACGGCGCCACCAAA
AAAGCGGCACACGCGGCAAAGACAGTGAAACACGGGTTTCTGTCTGGTCT
GAACATAATGGATTACAGTTTATTGGTTGGTATTCACGACACCGAACACG
TCGACTCTTCCGAACCGGAAGACGAACAAGACGGTGAAGGACCTGACGGT
GGCACTACCGGTGACGAATCTGGCGACGGCCTCGAAGAGCCGGCATCTCC
TACTACTGACGGAGAAACATCTGCCGCTACCCCTGAGACGCTTGCAGCAC
GTCGCCAACGTTACTCGCGAACGGAAAGTGTATCCAGTAGCGATGGTTAC
GAATCGGAGTACTTTGCGCTCCCGTCCTCTGACGGATAAGGAAAGTGTCA
CTTTCAAAGATAATGACTTCACCAAAGAAAATGCCAGGATATTCATTGGT
GCTGAACAAAAAGAAAAATTCAAAGATAGGCTAACTAAAGACGTCAACGG
CTCGCGAATCGATCGAGAAGCCAAAGACTCTGAGAAGTATATCGTCGAAT
CACACTCGGACACACTGTTACCACAATACCTTGGTATGTATCGGACGACG
TTGGACAACAAAGAATATTACTACCTCGTTGTACGAAGTGTTTTCAGCTG
CAAGAAGAAAGTACAAAAGAAATACGATTTGAAGGCTTCATTTTTAATCC
AACCGCAACTCAGTAAAGCACAAGGGAATAGCGGTGCAAAATTTCTACTG
ACCACCGACAAGAGATTCTATATCAAAACATTGCAGAGCGTTGAAGTGGA
AATGATGCATCATATAATGCCTAGTTACCACAGAAGAACACATGCCTGGT
CACTTCAAATTCAAAGAATATATGCCGTTAGTTTTCCGGAACCTAAGGGA
ACGATTTGCAATCGATGAAAAGTTATATGCAGTGTCGCAATTGTCTCATG
TCCCACAACAAGTTATGTTGCTCAAAGACGACTTCAAAGCATACAGCAAA
ATCAAGATAGATAACCATTTTTATAACAAATGGAGGCTATTAAAGATACA
TTTACAAAATCCAAAAAGAAAAAGGTGAAAGCCGTTCACCAAAAGGTTAA
AGTTTTTAGAGTCCATGATCCAAAGATGGCTGTTTTAATGTGGGGTGTGA
CACATTCGGCAGGTGCAGAAATATCCACAGTCAAACCACATCTTTACGCC
ACGAGGTTTTTAGAGTTCATGGATTCGGTCATGGAATGAAATCACTTCAT
TCCGTATATTACATGGGTATCATCGACGTCTTAACGTATTACGGCGCCAC
CAAAAAAGCGGCACACGCGGCAAAGACAGTGAAACACGGGTTTCTGTCTG
GTCTGAACATAATGGATTACAGTTTATTGGTTGGTATTCACGACACCGAA
CACGTCGACTCTTCCGAACCGGAAGACGAACAAGACGGTGAAGGACCTGA
CGGTGGCACTACCGGTGACGAATCTGGCGACGGCCTCGAAGAGCCGGCAT
CTCCTACTACTGACGGAGAAACATCTGCCGCTACCCCTGAGACGCTTGCA
GCACGTCGCCAACGTTACTCGCGAACGGAAAGTGTATCCAGTAGCGATGG
TTACGAATCGGAGTACTTTGCGCTCCCGTCCTCTGACGGATAAGGAAAGT
GTCACTTTCAAAGATAATGACTTCACCAAAGAAAATGCCAGGATATTCAT
TGGTGCTGAACAAAAAGAAAAATTCAAAGATAGGCTAACTAAAGACGTCA
ACGGCTCGCGAATCGATCGAGAAGCCAAAGACTCTGAGAAGTATATCGTC
GAATCACACTCGGACACACTGTTACCACAATACCTTGGTATGTATCGGAC
GACGTTGGACAACAAAGAATATTACTACCTCGTTGTACGAAGTGTTTTCA
GCTGCAAGAAGAAAGTACAAAAGAAATACGATTTGAAGGCTTCATTTTTA
ATCCAACCGCAACTCAGTAAAGCACAAGGGAATAGCGGTGCAAAATTTCT
ACTGACCACCGACAAGAGATTCTATATCAAAACATTGCAGAGCGTTGAAG
TGGAAATGATGCATCATATAATGCCTAGTTACCACAGAAGAACACATGCC
TGGTCACTTCAAATTCAAAGAATATATGCCGTTAGTTTTCCGGAACCTAA
GGGAACGATTTGCAATCGATGAAAAGTTATATGCAGTGTCGCAATTGTCT
CATGTCCCACAACAAGTTATGTTGCTCAAAGACGACTTCAAAGCATACAG
CAAAATCAAGATAGATAACCATTTTTATAACAAATGGAGGCTATTAAAGA
TACATTTACAAAATCCAAAAAGAAAAAGGTGAAAGCCGTTCACCAAAAGG
TTAAAGTTTTTAGAGTCCATGATCCAAAGATGGCTGTTTTAATGTGGGGT
GTGACACATTCGGCAGGTGCAGAAATATCCACAGTCAAACCACATCTTTA
CGCCACGAGGTTTTTAGAGTTCATGGATTCGGTCATGGAATGAAATCACT
TCATTCCGTATATTACATGGGTATCATCGACGTCTTAACGTATTACGGCG
CCACCAAAAAAGCGGCACACGCGGCAAAGACAGTGAAACACGGGTTTCTG
TCTGGTCTGAACATAATGGATTACAGTTTATTGGTTGGTATTCACGACAC
CGAACACGTCGACTCTTCCGAACCGGAAGACGAACAAGACGGTGAAGGAC
CTGACGGTGGCACTACCGGTGACGAATCTGGCGACGGCCTCGAAGAGCCG
GCATCTCCTACTACTGACGGAGAAACATCTGCCGCTACCCCTGAGACGCT
TGCAGCACGTCGCCAACGTTACTCGCGAACGGAAAGTGTATCCAGTAGCG
ATGGTTACGAATCGGAGTACTTTGCGCTCCCGTCCTCTGACGGATAAGGA
AAGTGTCACTTTCAAAGATAATGACTTCACCAAAGAAAATGCCAGGATAT
TCATTGGTGCTGAACAAAAAGAAAAATTCAAAGATAGGCTAACTAAAGAC
GTCAACGGCTCGCGAATCGATCGAGAAGCCAAAGACTCTGAGAAGTATAT
CGTCGAATCACACTCGGACACACTGTTACCACAATACCTTGGTATGTATC
GGACGACGTTGGACAACAAAGAATATTACTACCTCGTTGTACGAAGTGTT
TTCAGCTGCAAGAAGAAAGTACAAAAGAAATACGATTTGAAGGCTTCATT
TTTAATCCAACCGCAACTCAGTAAAGCACAAGGGAATAGCGGTGCAAAAT
TTCTACTGACCACCGACAAGAGATTCTATATCAAAACATTGCAGAGCGTT
GAAGTGGAAATGATGCATCATATAATGCCTAGTTACCACAGAAGAACACA
TGCCTGGTCACTTCAAATTCAAAGAATATATGCCGTTAGTTTTCCGGAAC
CTAAGGGAACGATTTGCAATCGATGAAAAGTTATATGCAGTGTCGCAATT
GTCTCATGTCCCACAACAAGTTATGTTGCTCAAAGACGACTTCAAAGCAT
ACAGCAAAATCAAGATAGATAACCATTTTTATAACAAATGGAGGCTATTA
AAGATACATTTACAAAATCCAAAAAGAAAAAGGTGAAAGCCGTTCACCAA
AAGGTTAAAGTTTTTAGAGTCCATGATCCAAAGATGGCTGTTTTAATGTG
GGGTGTGACACATTCGGCAGGTGCAGAAATATCCACAGTCAAACCACATC
TTTACGCCACGAGGTTTTTAGAGTTCATGGATTCGGTCATGGAATGAAAT
CACTTCATTCCGTATATTACATGGGTATCATCGACGTCTTAACGTATTAC
GGCGCCACCAAAAAAGCGGCACACGCGGCAAAGACAGTGAAACACGGGTT
TCTGTCTGGTCTGAACATAATGGATTACAGTTTATTGGTTGGTATTCACG
ACACCGAACACGTCGACTCTTCCGAACCGGAAGACGAACAAGACGGTGAA
GGACCTGACGGTGGCACTACCGGTGACGAATCTGGCGACGGCCTCGAAGA
GCCGGCATCTCCTACTACTGACGGAGAAACATCTGCCGCTACCCCTGAGA
CGCTTGCAGCACGTCGCCAACGTTACTCGCGAACGGAAAGTGTATCCAGT
AGCGATGGTTACGAATCGGAGTACTTTGCGCTCCCGTCCTCTGACGGATA
AGGAAAGTGTCACTTTCAAAGATAATGACTTCACCAAAGAAAATGCCAGG
ATATTCATTGGTGCTGAACAAAAAGAAAAATTCAAAGATAGGCTAACTAA
AGACGTCAACGGCTCGCGAATCGATCGAGAAGCCAAAGACTCTGAGAAGT
ATATCGTCGAATCACACTCGGACACACTGTTACCACAATACCTTGGTATG
TATCGGACGACGTTGGACAACAAAGAATATTACTACCTCGTTGTACGAAG
TGTTTTCAGCTGCAAGAAGAAAGTACAAAAGAAATACGATTTGAAGGCTT
CATTTTTAATCCAACCGCAACTCAGTAAAGCACAAGGGAATAGCGGTGCA
AAATTTCTACTGACCACCGACAAGAGATTCTATATCAAAACATTGCAGAG
CGTTGAAGTGGAAATGATGCATCATATAATGCCTAGTTACCACAGAAGAA
CACATGCCTGGTCACTTCAAATTCAAAGAATATATGCCGTTAGTTTTCCG
GAACCTAAGGGAACGATTTGCAATCGATGAAAAGTTATATGCAGTGTCGC
AATTGTCTCATGTCCCACAACAAGTTATGTTGCTCAAAGACGACTTCAAA
GCATACAGCAAAATCAAGATAGATAACCATTTTTATAACAAATGGAGGCT
ATTAAAGATACATTTACAAAATCCAAAAAGAAAAAGGTGAAAGCCGTTCA
CCAAAAGGTTAAAGTTTTTAGAGTCCATGATCCAAAGATGGCTGTTTTAA
TGTGGGGTGTGACACATTCGGCAGGTGCAGAAATATCCACAGTCAAACCA
CATCTTTACGCCACGAGGTTTTTAGAGTTCATGGATTCGGTCATGGAATG
AAATCACTTCATTCCGTATATTACATGGGTATCATCGACGTCTTAACGTA
TTACGGCGCCACCAAAAAAGCGGCACACGCGGCAAAGACAGTGAAACACG
GGTTTCTGTCTGGTCTGAACATAATGGATTACAGTTTATTGGTTGGTATT
CACGACACCGAACACGTCGACTCTTCCGAACCGGAAGACGAACAAGACGG
TGAAGGACCTGACGGTGGCACTACCGGTGACGAATCTGGCGACGGCCTCG
AAGAGCCGGCATCTCCTACTACTGACGGAGAAACATCTGCCGCTACCCCT
GAGACGCTTGCAGCACGTCGCCAACGTTACTCGCGAACGGAAAGTGTATC
CAGTAGCGATGGTTACGAATCGGAGTACTTTGCGCTCCCGTCCTCTGACG
GATAAGGAAAGTGTCACTTTCAAAGATAATGACTTCACCAAAGAAAATGC
CAGGATATTCATTGGTGCTGAACAAAAAGAAAAATTCAAAGATAGGCTAA
CTAAAGACGTCAACGGCTCGCGAATCGATCGAGAAGCCAAAGACTCTGAG
AAGTATATCGTCGAATCACACTCGGACACACTGTTACCACAATACCTTGG
TATGTATCGGACGACGTTGGACAACAAAGAATATTACTACCTCGTTGTAC
GAAGTGTTTTCAGCTGCAAGAAGAAAGTACAAAAGAAATACGATTTGAAG
GCTTCATTTTTAATCCAACCGCAACTCAGTAAAGCACAAGGGAATAGCGG
TGCAAAATTTCTACTGACCACCGACAAGAGATTCTATATCAAAACATTGC
AGAGCGTTGAAGTGGAAATGATGCATCATATAATGCCTAGTTACCACAGA
AGAACACATGCCTGGTCACTTCAAATTCAAAGAATATATGCCGTTAGTTT
TCCGGAACCTAAGGGAACGATTTGCAATCGATGAAAAGTTATATGCAGTG
TCGCAATTGTCTCATGTCCCACAACAAGTTATGTTGCTCAAAGACGACTT
CAAAGCATACAGCAAAATCAAGATAGATAACCATTTTTATAACAAATGGA
GGCTATTAAAGATACATTTACAAAATCCAAAAAGAAAAAGGTGAAAGCCG
TTCACCAAAAGGTTAAAGTTTTTAGAGTCCATGATCCAAAGATGGCTGTT
TTAATGTGGGGTGTGACACATTCGGCAGGTGCAGAAATATCCACAGTCAA
ACCACATCTTTACGCCACGAGGTTTTTAGAGTTCATGGATTCGGTCATGG
AATGAAATCACTTCATTCCGTATATTACATGGGTATCATCGACGTCTTAA
CGTATTACGGCGCCACCAAAAAAGCGGCACACGCGGCAAAGACAGTGAAA
CACGGGTTTCTGTCTGGTCTGAACATAATGGATTACAGTTTATTGGTTGG
TATTCACGACACCGAACACGTCGACTCTTCCGAACCGGAAGACGAACAAG
ACGGTGAAGGACCTGACGGTGGCACTACCGGTGACGAATCTGGCGACGGC
CTCGAAGAGCCGGCATCTCCTACTACTGACGGAGAAACATCTGCCGCTAC
CCCTGAGACGCTTGCAGCACGTCGCCAACGTTACTCGCGAACGGAAAGTG
TATCCAGTAGCGATGGTTACGAATCGGAGTACTTTGCGCTCCCGTCCTCT
GACGGATAAGGAAAGTGTCACTTTCAAAGATAATGACTTCACCAAAGAAA
ATGCCAGGATATTCATTGGTGCTGAACAAAAAGAAAAATTCAAAGATAGG
CTAACTAAAGACGTCAACGGCTCGCGAATCGATCGAGAAGCCAAAGACTC
TGAGAAGTATATCGTCGAATCACACTCGGACACACTGTTACCACAATACC
TTGGTATGTATCGGACGACGTTGGACAACAAAGAATATTACTACCTCGTT
GTACGAAGTGTTTTCAGCTGCAAGAAGAAAGTACAAAAGAAATACGATTT
GAAGGCTTCATTTTTAATCCAACCGCAACTCAGTAAAGCACAAGGGAATA
GCGGTGCAAAATTTCTACTGACCACCGACAAGAGATTCTATATCAAAACA
TTGCAGAGCGTTGAAGTGGAAATGATGCATCATATAATGCCTAGTTACCA
CAGAAGAACACATGCCTGGTCACTTCAAATTCAAAGAATATATGCCGTTA
GTTTTCCGGAACCTAAGGGAACGATTTGCAATCGATGAAAAGTTATATGC
AGTGTCGCAATTGTCTCATGTCCCACAACAAGTTATGTTGCTCAAAGACG
ACTTCAAAGCATACAGCAAAATCAAGATAGATAACCATTTTTATAACAAA
TGGAGGCTATTAAAGATACATTTACAAAATCCAAAAAGAAAAAGGTGAAA
GCCGTTCACCAAAAGGTTAAAGTTTTTAGAGTCCATGATCCAAAGATGGC
TGTTTTAATGTGGGGTGTGACACATTCGGCAGGTGCAGAAATATCCACAG
TCAAACCACATCTTTACGCCACGAGGTTTTTAGAGTTCATGGATTCGGTC
ATGGAATGAAATCACTTCATTCCGTATATTACATGGGTATCATCGACGTC
TTAACGTATTACGGCGCCACCAAAAAAGCGGCACACGCGGCAAAGACAGT
GAAACACGGGTTTCTGTCTGGTCTGAACATAATGGATTACAGTTTATTGG
TTGGTATTCACGACACCGAACACGTCGACTCTTCCGAACCGGAAGACGAA
CAAGACGGTGAAGGACCTGACGGTGGCACTACCGGTGACGAATCTGGCGA
CGGCCTCGAAGAGCCGGCATCTCCTACTACTGACGGAGAAACATCTGCCG
CTACCCCTGAGACGCTTGCAGCACGTCGCCAACGTTACTCGCGAACGGAA
AGTGTATCCAGTAGCGATGGTTACGAATCGGAGTACTTTGCGCTCCCGTC
CTCTGACGGATAAGGAAAGTGTCACTTTCAAAGATAATGACTTCACCAAA
GAAAATGCCAGGATATTCATTGGTGCTGAACAAAAAGAAAAATTCAAAGA
TAGGCTAACTAAAGACGTCAACGGCTCGCGAATCGATCGAGAAGCCAAAG
ACTCTGAGAAGTATATCGTCGAATCACACTCGGACACACTGTTACCACAA
TACCTTGGTATGTATCGGACGACGTTGGACAACAAAGAATATTACTACCT
CGTTGTACGAAGTGTTTTCAGCTGCAAGAAGAAAGTACAAAAGAAATACG
ATTTGAAGGCTTCATTTTTAATCCAACCGCAACTCAGTAAAGCACAAGGG
AATAGCGGTGCAAAATTTCTACTGACCACCGACAAGAGATTCTATATCAA
AACATTGCAGAGCGTTGAAGTGGAAATGATGCATCATATAATGCCTAGTT
ACCACAGAAGAACACATGCCTGGTCACTTCAAATTCAAAGAATATATGCC
GTTAGTTTTCCGGAACCTAAGGGAACGATTTGCAATCGATGAAAAGTTAT
ATGCAGTGTCGCAATTGTCTCATGTCCCACAACAAGTTATGTTGCTCAAA
GACGACTTCAAAGCATACAGCAAAATCAAGATAGATAACCATTTTTATAA
CAAATGGAGGCTATTAAAGATACATTTACAAAATCCAAAAAGAAAAAGGT
GAAAGCCGTTCACCAAAAGGTTAAAGTTTTTAGAGTCCATGATCCAAAGA
TGGCTGTTTTAATGTGGGGTGTGACACATTCGGCAGGTGCAGAAATATCC
ACAGTCAAACCACATCTTTACGCCACGAGGTTTTTAGAGTTCATGGATTC
GGTCATGGAATGAAATCACTTCATTCCGTATATTACATGGGTATCATCGA
CGTCTTAACGTATTACGGCGCCACCAAAAAAGCGGCACACGCGGCAAAGA
CAGTGAAACACGGGTTTCTGTCTGGTCTGAACATAATGGATTACAGTTTA
TTGGTTGGTATTCACGACACCGAACACGTCGACTCTTCCGAACCGGAAGA
CGAACAAGACGGTGAAGGACCTGACGGTGGCACTACCGGTGACGAATCTG
GCGACGGCCTCGAAGAGCCGGCATCTCCTACTACTGACGGAGAAACATCT
GCCGCTACCCCTGAGACGCTTGCAGCACGTCGCCAACGTTACTCGCGAAC
GGAAAGTGTATCCAGTAGCGATGGTTACGAATCGGAGTACTTTGCGCTCC
CGTCCTCTGACGGATAAGGAAAGTGTCACTTTCAAAGATAATGACTTCAC
CAAAGAAAATGCCAGGATATTCATTGGTGCTGAACAAAAAGAAAAATTCA
AAGATAGGCTAACTAAAGACGTCAACGGCTCGCGAATCGATCGAGAAGCC
AAAGACTCTGAGAAGTATATCGTCGAATCACACTCGGACACACTGTTACC
ACAATACCTTGGTATGTATCGGACGACGTTGGACAACAAAGAATATTACT
ACCTCGTTGTACGAAGTGTTTTCAGCTGCAAGAAGAAAGTACAAAAGAAA
TACGATTTGAAGGCTTCATTTTTAATCCAACCGCAACTCAGTAAAGCACA
AGGGAATAGCGGTGCAAAATTTCTACTGACCACCGACAAGAGATTCTATA
TCAAAACATTGCAGAGCGTTGAAGTGGAAATGATGCATCATATAATGCCT
AGTTACCACAGAAGAACACATGCCTGGTCACTTCAAATTCAAAGAATATA
TGCCGTTAGTTTTCCGGAACCTAAGGGAACGATTTGCAATCGATGAAAAG
TTATATGCAGTGTCGCAATTGTCTCATGTCCCACAACAAGTTATGTTGCT
CAAAGACGACTTCAAAGCATACAGCAAAATCAAGATAGATAACCATTTTT
ATAACAAATGGAGGCTATTAAAGATACATTTACAAAATCCAAAAAGAAAA
AGGTGAAAGCCGTTCACCAAAAGGTTAAAGTTTTTAGAGTCCATGATCCA
AAGATGGCTGTTTTAATGTGGGGTGTGACACATTCGGCAGGTGCAGAAAT
ATCCACAGTCAAACCACATCTTTACGCCACGAGGTTTTTAGAGTTCATGG
ATTCGGTCATGGAATGAAATCACTTCATTCCGTATATTACATGGGTATCA
TCGACGTCTTAACGTATTACGGCGCCACCAAAAAAGCGGCACACGCGGCA
AAGACAGTGAAACACGGGTTTCTGTCTGGTCTGAACATAATGGATTACAG
TTTATTGGTTGGTATTCACGACACCGAACACGTCGACTCTTCCGAACCGG
AAGACGAACAAGACGGTGAAGGACCTGACGGTGGCACTACCGGTGACGAA
TCTGGCGACGGCCTCGAAGAGCCGGCATCTCCTACTACTGACGGAGAAAC
ATCTGCCGCTACCCCTGAGACGCTTGCAGCACGTCGCCAACGTTACTCGC
GAACGGAAAGTGTATCCAGTAGCGATGGTTACGAATCGGAGTACTTTGCG
CTCCCGTCCTCTGACGGATAAGGAAAGTGTCACTTTCAAAGATAATGACT
TCACCAAAGAAAATGCCAGGATATTCATTGGTGCTGAACAAAAAGAAAAA
TTCAAAGATAGGCTAACTAAAGACGTCAACGGCTCGCGAATCGATCGAGA
AGCCAAAGACTCTGAGAAGTATATCGTCGAATCACACTCGGACACACTGT
TACCACAATACCTTGGTATGTATCGGACGACGTTGGACAACAAAGAATAT
TACTACCTCGTTGTACGAAGTGTTTTCAGCTGCAAGAAGAAAGTACAAAA
GAAATACGATTTGAAGGCTTCATTTTTAATCCAACCGCAACTCAGTAAAG
CACAAGGGAATAGCGGTGCAAAATTTCTACTGACCACCGACAAGAGATTC
TATATCAAAACATTGCAGAGCGTTGAAGTGGAAATGATGCATCATATAAT
GCCTAGTTACCACAGAAGAACACATGCCTGGTCACTTCAAATTCAAAGAA
TATATGCCGTTAGTTTTCCGGAACCTAAGGGAACGATTTGCAATCGATGA
AAAGTTATATGCAGTGTCGCAATTGTCTCATGTCCCACAACAAGTTATGT
TGCTCAAAGACGACTTCAAAGCATACAGCAAAATCAAGATAGATAACCAT
TTTTATAACAAATGGAGGCTATTAAAGATACATTTACAAAATCCAAAAAG
AAAAAGGTGAAAGCCGTTCACCAAAAGGTTAAAGTTTTTAGAGTCCATGA
TCCAAAGATGGCTGTTTTAATGTGGGGTGTGACACATTCG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000350XLOC_000350Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000595-proteinTCONS_00000595-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000595-exon-sc0000002-1575043694:1335663..1336323TCONS_00000595-exon-sc0000002-1575043694:1335663..1336323Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1328923..1329020TCONS_00000595-exon-sc0000002-1575043694:1328923..1329020Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1326515..1326611TCONS_00000595-exon-sc0000002-1575043694:1326515..1326611Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1326122..1326271TCONS_00000595-exon-sc0000002-1575043694:1326122..1326271Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1325127..1325273TCONS_00000595-exon-sc0000002-1575043694:1325127..1325273Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1324881..1324919TCONS_00000595-exon-sc0000002-1575043694:1324881..1324919Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1324466..1324579TCONS_00000595-exon-sc0000002-1575043694:1324466..1324579Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1323838..1324135TCONS_00000595-exon-sc0000002-1575043694:1323838..1324135Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1323622..1323722TCONS_00000595-exon-sc0000002-1575043694:1323622..1323722Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1575043694:1319057..1320572TCONS_00000595-exon-sc0000002-1575043694:1319057..1320572Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1335663..1336323TCONS_00000595-exon-sc0000002-1510915933:1335663..1336323Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1328923..1329020TCONS_00000595-exon-sc0000002-1510915933:1328923..1329020Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1326515..1326611TCONS_00000595-exon-sc0000002-1510915933:1326515..1326611Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1326122..1326271TCONS_00000595-exon-sc0000002-1510915933:1326122..1326271Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1325127..1325273TCONS_00000595-exon-sc0000002-1510915933:1325127..1325273Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1324881..1324919TCONS_00000595-exon-sc0000002-1510915933:1324881..1324919Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1324466..1324579TCONS_00000595-exon-sc0000002-1510915933:1324466..1324579Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1323838..1324135TCONS_00000595-exon-sc0000002-1510915933:1323838..1324135Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1323622..1323722TCONS_00000595-exon-sc0000002-1510915933:1323622..1323722Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1510915933:1319057..1320572TCONS_00000595-exon-sc0000002-1510915933:1319057..1320572Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1335663..1336323TCONS_00000595-exon-sc0000002-1491911889:1335663..1336323Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1328923..1329020TCONS_00000595-exon-sc0000002-1491911889:1328923..1329020Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1326515..1326611TCONS_00000595-exon-sc0000002-1491911889:1326515..1326611Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1326122..1326271TCONS_00000595-exon-sc0000002-1491911889:1326122..1326271Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1325127..1325273TCONS_00000595-exon-sc0000002-1491911889:1325127..1325273Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1324881..1324919TCONS_00000595-exon-sc0000002-1491911889:1324881..1324919Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1324466..1324579TCONS_00000595-exon-sc0000002-1491911889:1324466..1324579Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1323838..1324135TCONS_00000595-exon-sc0000002-1491911889:1323838..1324135Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1323622..1323722TCONS_00000595-exon-sc0000002-1491911889:1323622..1323722Clytia hemisphaericaexon
TCONS_00000595-exon-sc0000002-1491911889:1319057..1320572TCONS_00000595-exon-sc0000002-1491911889:1319057..1320572Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1319057..1336323 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.52791 3.66761 2.60273 2.88714 27.1602 20.1392 28.0515 30.3467 16.4268 18.4085 16.4961 12.1926 13.8328 13.948 11.7756 10.6658 11.4019 9.81768 9.07282 11.8533 9.49536 9.41243 11.1828 12.2198 12.7921 16.1093 12.4324 10.0221 16.3212 16.89
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002498PInositol-4-P-5-kinase_core
IPR027483PInositol-4-P-5-kinase_C
IPR027484PInositol-4-P-5-kinase_N
Vocabulary: Molecular Function
TermDefinition
GO:0016307phosphatidylinositol phosphate kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0046488phosphatidylinositol metabolic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0046488 phosphatidylinositol metabolic process
molecular_function GO:0016307 phosphatidylinositol phosphate kinase activity
Blast
BLAST of TCONS_00000595 vs. Swiss-Prot (Human)
Match: PI42B (Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens GN=PIP4K2B PE=1 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 6.122e-98
Identity = 195/393 (49.62%), Postives = 253/393 (64.38%), Query Frame = 2
Query:  608 FRVHDPKMAVLMWGVTHSVSQLSHVPQQVMLLKDDFKAYSKIKIDNHFYNKEHMPGHFKFKEYMPLVFRNLRERFAIDEKLYAASFL-IQPQLSKAQGNSGAKFLLTTDKRFYIKTLQSVEVEMMHHIMPSYHRYIVESHSDTLLPQYLGMYRTTLDNKEYYYLVVRSVFSCKKKVQKKYDLKGSRIDREAKDSEKDKESVTFKDNDFTKENARIFIGAEQKEKFKDRLTKDVNFLSGLNIMDYSLLVGIHDTEHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASPTTDGETSAATPETLAARRQRYSRTESVSSSDGYESEYFALPSSDESL-HSVYYMGIIDVLTYYXXXXXXXXXXXXXXXXXXXEISTVKPHLYATRFLEFMDSVM 1780
            FR  +P ++VLMWGV H++++LS+VP  VML+ DDFKAYSKIK+DNH +NKE++P  FKFKEY P+VFRNLRERF ID++ Y  S     P  S +QG  G +FL T D+RF IKT+ S +V  MH+I+  YH++IVE H +TLLPQ+LGMYR T+D  E Y +V R+VFS +  V +KYDLKGS + REA D EK K+  TFKDNDF  E  ++ +G E K+ F ++L +DV FL+ L IMDYSLLVGIHD +  +  E E E+  E  +    G            P         +P  L +  + +   E   S D Y     A+ S + S    VY+M IID+LT Y   KKAAHAAKTVKHGAGAEISTV P  Y+ RF EFM +++
Sbjct:   36 FRASEPILSVLMWGVNHTINELSNVPVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKDNDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEERAEDEECENDGVGGNLLCSYGTPPD--------SPGNLLSFPRFFGPGEFDPSVDVY-----AMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNIL 415          
The following BLAST results are available for this feature:
BLAST of TCONS_00000595 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PI42B6.122e-9849.62Phosphatidylinositol 5-phosphate 4-kinase type-2 b... [more]
back to top