Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000590 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000590
Unique NameTCONS_00000590
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1942

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000590 ID=TCONS_00000590|Name=TCONS_00000590|organism=Clytia hemisphaerica|type=transcript|length=1942bp
GTTTTAGATAAAACATATAGAGCatacaaaaagttataaaaaagttACAG
CATGGATAAATTCGTGATTAGAACACCACGTGATCAGGTCAATgacaaac
aaaatggtagacctCAGAAGCCAAGGAAGAAACAGACCACTATTGAGTCA
TTATCGAGGGTTGTTATCGTGGAACAGGTGCATCGTCAGaaagaaatcct
gaaaaacgCAGAAACCACACCACAATTTCTCATCTCAACACTAAAAGACC
TGCACAAAGCTATCCCTTCAAAAAGTGTTCTACTAGAGACGAAAGTTGGT
CACGTGGTCAATAAATTACGTCATCATTCCGATCCAGAGGTCAAAGAACA
GGCGCGTTTACTACTTAAGAAATGGAAGAAGTTTTATAGAGAGATCAATG
CACGCCAACCAATAGATGTACGGTCTGACTTGAAGACGGAAAAGTTCCGA
ACAAAAGCAAAACAGCTTTTAAGGAAAGCAATCGGCATTAAAGATGACCA
CGCTATAGCTTTGTCGATCGAGAAAACGATATACCGCGCTGAGAAATCGG
TCAACACGCCAAAATATCGGAGGCTGATACGAACTATATGCATCAAAGTA
ACTAATGACTCGCAGACCAAGGAACAACTCAAAAACGGCAAACTTTCTAC
TGTTTCGTTGATTAAAATGATTGAAAGTTCAGTGACTTGAGGTTTGACGA
ATGAAAACGGTTTTCAGTTTGAGAGatataaaatacaaaaatgtcaGCGC
TTTTATCCTTGATATTTTACACGTGGCTAGGATATTGGTCATACCGTGTC
ATTAAATTCGTCTTGTTTATGATCACGTGTCATGTTCTACCTTCTTTTGG
TATTTATAATGACCTCAAGAAGTATGGTCAATGGGCTATCATTACTGGCG
CTACTGATGGTATTGGTAAGGCTTATGCTGTGGAGCTCGCCAAGCAGAAA
TTCAACATCGTCTTGATCAGCCGAACGGAAGAGAAATTACAACGAGTGGC
TGAGGAGATTAAAAATGCTCATGGTGTCGACACCAAATatattgtttttg
atttttctacacCTGAGGGTTATGAAGAACGTATTGGGAATGTGATCTCA
GATCTGGATGTTGGAGTTTTGGTCAATAACGTTGGTATGTCCAGTAAGTG
GGATCGCTTGTATGATGAGTTGGAGATGGCTGAACATATCCGTGTCATGC
ATACCAACACCTTTGGTGAAATGCATATGACGTATATGCTGACGAAGAAA
ATGATTCAACAAAAACGTGGTATTATGATTCACATTTCCAGCTTCTTTGG
TTATTATCCGATCGGTTTAATAAGTGTTTATTCACCTACTAAAGCCTTCG
TCAACTCTTTCGTCCAGAATCTCCAAGCTGAAACTAAACACTGCAAAGAC
GTCCATCATCAATTAGTGACGCCCTTCTTTGTTGCCACAAATATGACCAA
AGGGAGTGTTAAAGTCACCAGAGTTACCCCAGATGCTGCCACCTTTGCTG
GCGCAGCTTTACGCACCGTTGGCTTAACGCCGCACACTTTTGGGTACTGG
ACTCATGATATTCTTGGGTCAATCTTAATGACCTTTCCACCTTTTGTTTT
TGGTAGATTACCGTTtgtcaaaagctttcaaaagtATTGTAAAAACAGAC
GCTTAAAGACCCTCGAGAAAAGCGAGTGAGAAAAACATTAGGTTGGTTTC
ATAATTTTGATTATTGCTTTGTTTTTGCTACCCATTTATATCGTAACTTT
TACAGTGCGTAGAGACCCCTAGATATCCAACTTCTCAGATAATCTTCCtg
tcatttttgtaaataataTTAACCTCTGGGTATCGTATTTTGAAccaggg
gggggcacgcagttactacaagacagtatgacacttactaccgtggtggt
actgtattcagaagttatgaaaacagttactacacagtgtag
Run BLAST on NCBI

protein sequence of TCONS_00000590-protein

>TCONS_00000590-protein ID=TCONS_00000590-protein|Name=TCONS_00000590-protein|organism=Clytia hemisphaerica|type=polypeptide|length=312bp
MSALLSLIFYTWLGYWSYRVIKFVLFMITCHVLPSFGIYNDLKKYGQWAI
ITGATDGIGKAYAVELAKQKFNIVLISRTEEKLQRVAEEIKNAHGVDTKY
IVFDFSTPEGYEERIGNVISDLDVGVLVNNVGMSSKWDRLYDELEMAEHI
RVMHTNTFGEMHMTYMLTKKMIQQKRGIMIHISSFFGYYPIGLISVYSPT
KAFVNSFVQNLQAETKHCKDVHHQLVTPFFVATNMTKGSVKVTRVTPDAA
TFAGAALRTVGLTPHTFGYWTHDILGSILMTFPPFVFGRLPFVKSFQKYC
KNRRLKTLEKSE
Run BLAST on NCBI

transcript from alignment at sc0000002:1197968..1202743-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000590 ID=TCONS_00000590|Name=TCONS_00000590|organism=Clytia hemisphaerica|type=transcript|length=4776bp|location=Sequence derived from alignment at sc0000002:1197968..1202743- (Clytia hemisphaerica)
GTTTTAGATAAAACATATAGAGCATACAAAAAGTTATAAAAAAGTTACAG CATGGATAAATTCGTGATTAGAACACCACGTGATCAGGTCAATGACAAAC AAAATGGTAGACCTCAGAAGCCAAGGAAGAAACAGACCACTATTGAGTCA TTATCGGTGAGCAATTGAATTTAATGCACTGCACAATGGTAAAGTACACA GGATTTTTCATTGAAACTTCACACCCCCTTCTCACTTTTCACAGACCCGG TAAGTTTTTTTCAGCCAGTGGGAGTAGAAATATCCGACAGGGTCAACTTT TGGTCATTCCAAGAAACCATTTTTTAGGGTTTGTTTTAAAAAGTAATTGA AACTTTGAATCTGATAGCATCCACAATCCAGGTAGTCAATAGATGGTTTT TTATGTTTTGTTTTTAAGTTACGTAACTTCTGCAATTATGAAAGCAAACG TTCGATTTGCGAATGTATCCTCTACATGTTCGAATGTTTGCTTCCATAAT GGCTGAAATTACGTAAGATAGCCAAACATGAAAAACCTCTATACTGTATT TACAATCGAAATCAAATCTTTTTAGAGGGTTGTTATCGTGGAACAGGTGC ATCGTCAGAAAGAAATCCTGAAAAACGCAGAAACCACACCACAATTTCTC ATCTCAACACTAAAAGACCTGCACAAAGCTATCCCTTCAAAAAGTGTTCT ACTAGAGACGAAAGTTGGTCACGTGGTCAATAAATTACGTCATCATTCCG ATCCAGAGGTCAAAGAACAGGCGCGTTTACTACTTAAGAAATGGAAGAAG TTTTATAGAGAGATCAATGCACGCCAACCAATAGATGTACGGTCTGACTT GAAGACGGAAAAGTTCCGAACAAAAGCAAAACAGCTTTTAAGGAAAGCAA TCGGCATTAAAGTAAGTCGTATTTGATTTCTTTATTATCCTTTTTGCTGG ACAAGTTTTTAAAAATCCTTCATGTGCAGATTGAACAGATTTCCCTTCTT TTATAGGAAGTTGTCGTTTTTGTTTAGGTTTCAGTTTTCGTTATTTTTCT TTGTTCAGAATGGCCCTTCATGGAATTAATTCTTCAGATGCTTAAAAGCT TTTGAATTTCGGAGAATGCCACTTTAAAACAAATGTTATTGATTATTACC CGCATCTGCATTCTTTGTCCTTAGCAGTAATAAATAGCCCCTGTTTTTTT AGATCATTGGATTATGGAGTCTCCATTTCTAACGCAAACGTGTCTTCAAC TCGAACAAGTTGATAGACCCTTCAAATTAGCAAACTCTATAAACCAGTCT CAAAAACTGGGACAAATTTGTGTTCCCCGTGCGTGTTCTAATTCTAGAAA TTCCACTGTATCTATGCTTGTTCTTATACTTTTAAATAACTTTAGTTTGG GCAAAAATGAAAAAATGTAGTGTTTCTGGAAACCGGCCGGGTGAAAAAAA ATAATTTTCTGACCCGGCCGCAGACTACATTAGTAGTTGATACATATTCA AGGCGTACATAAAAGTTATCTTTAAAGTTCAATGATCTTAAGTTATCAAA AATAGCAACAAAAAAAATTTTTCGGCCGGCCCCATGAAAGCTTTTTTCCT TAACCCGCATTCCGGAAACACTACATTTTTTTATTTTCACCTTCCCTGTA ATTTTAAAATCACAAAATGCAGACCCTAAAAAGGACATATTATTGACCTA GGCCTTTTTCCTTCGAAGTATTTCATTATTTGATTGAAATAATAATTTTA GAAACTTGCAAACAATCTCATTTCCAAAAGGGTTTTTTGAAATAATTTTT GTGAACATGGATTCTAATTAACATCATTCAAAAATTAAGTAACTTTACGT CTCTTTCATTAGCAAGGGAATGTTACAAAATTTCTTAGCAATTAAAATCA AATGTATATAACGATTGAAAATAGAAAAATTCCATTGTTCTCTAAAAATG TTAAAAATGTGAAAACCGCCTATACAAAAACGGCGAAAATATAAAGCTGC AACCATCTTTTTTTTGCGTTTGGAAATGAATTTTGATTTTCTTGAACAAA ATCTTCCGAAAATGGATTAATATTACAGGAAGATCTTGTAATATAATCTG ATTGCAAACTTGCTGGATATATACCACACCTCGGGTGAAAGTTTATAAAA AATTGAGCTCATAAAAACTTCAAGTCAGCTTATAGACTACGAATGCGTAG GAGTAATAAGTAAATGAAGAAGTTTTTGGAAAAGTTGTTACATGATTCTT TCGAAATACAGATAGAATAGCAAGATTTTTTTAGAACAGAGTTTATGTTT TCTGAATGAAGTTTTTAAAAGCCATCAAACTTTCGATGATAAGCATATAA TTAGGACAATTAAATGGGATTTTATCTTTTTTGACTACACATGTTATCAG CAGTAATAGATTAGCCGACGAATTTTCATGTTTTAACTTTTAGTTTTTTT CATATATATTTGTTCGTTAGGATGACCACGCTATAGCTTTGTCGATCGAG AAAACGATATACCGCGCTGAGAAATCGGTCAACACGCCAAAATATCGGAG GCTGATACGAACTATATGCATCAAAGTAACTAATGACTCGCAGACCAAGG AACAACTCAAAAACGGCAAACTTTCTACTGTTTCGTTGATTAAAATGATT GAAAGTTCAGTGACTTGAGGTTTGACGAATGAAAACGGTTTTCAGTTTGA GAGGTTTGTATTGCATGAAAATTTCATTATTTTGGAAGACCTTTGGTAAA GCTGTACCTTTAGCCTTTAACCATTGAACTTAAAGAGGATTCTCAATCGC GGCTCGTTTTTTAACAATATTAAAAATTGGTTTGCTTGTATATTATCTGT GTACATAGTTGTTTTTATTCAAACCCCAAGGAAAATGAAATTTTTACAGA AACATTAATTAAATTGATTAATCCTCCTGAATATTTTCAACTTGAAGTTC AAGCACAGAAGTGTTCTCATTTTAGTTGAATAAAATTTATAAACATATAT TTAGACGTTTCGGTGTCTTCCGATCACCATATCATCAGTAAAAATTAGGA AACACTAAACCAATTTTCAATATATCATCTAATTTACAAATACAGCCTTT CCAAACATGATACATATAAATACTTCTAATGCATGGACAGATTTCGCAAA ATGAAAGTAACCTGAAACTATTTGTTTCCATGAGCAAGTATTGACACGAT ATTTCAATAATCTCTTGTCAATGAATTTATTTTATCAAAATAGATAATCT TTGCAGCTCTTATTTCAGTTTGTTTCAGCTTGTTTGATTGAGCTCTCTGC AAATTGATACATGTGTGTATGTAGAAAGAAACGTTGCTAGAAAACACACC TCTTTTATGTAGGAAAGGAGTTTTCAGAAATTTGGGATCGTTTAAAGAAT AATGGACAATTCATGTAACTGAGAGATGCAATTTTTGTGCTTTAGTGAAC AAATTTTGGCCGAAATATGACAGACAGACAGACAGACAGACGGACAAAGT TATGGTGAAATTTTTGCTTTATTCAAATTATTTTATTATTTTCCATTTTA TTTAGAAAGATATAAAATACAAAAATGTCAGCGCTTTTATCCTTGATATT TTACACGTGGCTAGGATATTGGTCATACCGTGTCATTAAATTCGTCTTGT TTATGATCACGTGTCATGTTCTACCTTCTTTTGGTATTTATAATGACCTC AAGAAGTATGGTCAATGGGCTATCATTACTGGCGCTACTGATGGTATTGG TAAGGCTTATGCTGTGGAGCTCGCCAAGCAGAAATTCAACATCGTCTTGA TCAGCCGAACGGAAGAGAAATTACAACGAGTGGCTGAGGAGATTAAAAAT GCTCATGGTGTCGACACCAAATATATTGTTTTTGATTTTTCTACACCTGA GGGTTATGAAGAACGTATTGGGAATGTGATCTCAGATCTGGATGTTGGAG TTTTGGTCAATAACGTTGGTATGTCCAGTAAGTGGGATCGCTTGTATGAT GAGTTGGAGATGGCTGAACATATCCGTGTCATGCATACCAACACCTTTGG TGAAATGCATATGACGTATATGCTGACGAAGAAAATGATTCAACAAAAAC GTGGTATTATGATTCACATTTCCAGCTTCTTTGGTTATTATCCGATCGGT TTAATAAGTGTTTATTCACCTACTAAAGCCTTCGTCAACTCTTTCGTCCA GAATCTCCAAGCTGAAACTAAACACTGCAAAGACGTCCATCATCAATTAG TGACGCCCTTCTTTGTTGCCACAAATATGACCAAAGGGAGTGTTAAAGTC ACCAGAGTTACCCCAGATGCTGCCACCTTTGCTGGCGCAGCTTTACGCAC CGTTGGCTTAACGCCGCACACTTTTGGGTACTGGACTCATGATATTCTTG GGTCAATCTTAATGACCTTTCCACCTTTTGTTTTTGGTAGATTACCGTTT GTCAAAAGCTTTCAAAAGTATTGTAAAAACAGACGCTTAAAGACCCTCGA GAAAAGCGAGTGAGAAAAACATTAGGTTGGTTTCATAATTTTGATTATTG CTTTGTTTTTGCTACCCATTTATATCGTAACTTTTACAGTGCGTAGAGAC CCCTAGATATCCAACTTCTCAGATAATCTTCCTGTCATTTTTGTAAATAA TATTAACCTCTGGGTATCGTATTTTGAACCAGGGGGGGGCACGCAGTTAC TACAAGACAGTATGACACTTACTACCGTGGTGGTACTGTATTCAGAAGTT ATGAAAACAGTTACTACACAGTGTAG

Coding sequence (CDS) from alignment at sc0000002:1197968..1202743-

>TCONS_00000590 ID=TCONS_00000590|Name=TCONS_00000590|organism=Clytia hemisphaerica|type=CDS|length=939bp|location=Sequence derived from alignment at sc0000002:1197968..1202743- (Clytia hemisphaerica)
ATGTCAGCGCTTTTATCCTTGATATTTTACACGTGGCTAGGATATTGGTC
ATACCGTGTCATTAAATTCGTCTTGTTTATGATCACGTGTCATGTTCTAC
CTTCTTTTGGTATTTATAATGACCTCAAGAAGTATGGTCAATGGGCTATC
ATTACTGGCGCTACTGATGGTATTGGTAAGGCTTATGCTGTGGAGCTCGC
CAAGCAGAAATTCAACATCGTCTTGATCAGCCGAACGGAAGAGAAATTAC
AACGAGTGGCTGAGGAGATTAAAAATGCTCATGGTGTCGACACCAAATAT
ATTGTTTTTGATTTTTCTACACCTGAGGGTTATGAAGAACGTATTGGGAA
TGTGATCTCAGATCTGGATGTTGGAGTTTTGGTCAATAACGTTGGTATGT
CCAGTAAGTGGGATCGCTTGTATGATGAGTTGGAGATGGCTGAACATATC
CGTGTCATGCATACCAACACCTTTGGTGAAATGCATATGACGTATATGCT
GACGAAGAAAATGATTCAACAAAAACGTGGTATTATGATTCACATTTCCA
GCTTCTTTGGTTATTATCCGATCGGTTTAATAAGTGTTTATTCACCTACT
AAAGCCTTCGTCAACTCTTTCGTCCAGAATCTCCAAGCTGAAACTAAACA
CTGCAAAGACGTCCATCATCAATTAGTGACGCCCTTCTTTGTTGCCACAA
ATATGACCAAAGGGAGTGTTAAAGTCACCAGAGTTACCCCAGATGCTGCC
ACCTTTGCTGGCGCAGCTTTACGCACCGTTGGCTTAACGCCGCACACTTT
TGGGTACTGGACTCATGATATTCTTGGGTCAATCTTAATGACCTTTCCAC
CTTTTGTTTTTGGTAGATTACCGTTTGTCAAAAGCTTTCAAAAGTATTGT
AAAAACAGACGCTTAAAGACCCTCGAGAAAAGCGAGTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000348XLOC_000348Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000590-exon-sc0000002-1575043694:1202588..1202743TCONS_00000590-exon-sc0000002-1575043694:1202588..1202743Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1575043694:1201833..1202168TCONS_00000590-exon-sc0000002-1575043694:1201833..1202168Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1575043694:1200041..1200273TCONS_00000590-exon-sc0000002-1575043694:1200041..1200273Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1575043694:1197968..1199184TCONS_00000590-exon-sc0000002-1575043694:1197968..1199184Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1510915933:1202588..1202743TCONS_00000590-exon-sc0000002-1510915933:1202588..1202743Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1510915933:1201833..1202168TCONS_00000590-exon-sc0000002-1510915933:1201833..1202168Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1510915933:1200041..1200273TCONS_00000590-exon-sc0000002-1510915933:1200041..1200273Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1510915933:1197968..1199184TCONS_00000590-exon-sc0000002-1510915933:1197968..1199184Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1491911889:1202588..1202743TCONS_00000590-exon-sc0000002-1491911889:1202588..1202743Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1491911889:1201833..1202168TCONS_00000590-exon-sc0000002-1491911889:1201833..1202168Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1491911889:1200041..1200273TCONS_00000590-exon-sc0000002-1491911889:1200041..1200273Clytia hemisphaericaexon
TCONS_00000590-exon-sc0000002-1491911889:1197968..1199184TCONS_00000590-exon-sc0000002-1491911889:1197968..1199184Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000590-proteinTCONS_00000590-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1197968..1202743 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 4.89079e-10 0 2.38351 3.66468 5.65818 2.03412e-08 0.783098 3.60655e-07 6.76095e-10 0 1.49397e-06 1.816e-08 0 0.000132551 4.34338e-07 0 2.24553e-09 0 0 2.12905e-09 0 4.56641 7.03388 0 0 3.50685e-09 0.000213239
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
Blast
BLAST of TCONS_00000590 vs. Swiss-Prot (Human)
Match: DHB12 (Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 8.629e-51
Identity = 114/320 (35.62%), Postives = 186/320 (58.13%), Query Frame = 3
Query:  744 SALLSLIFYTWLG-----YWSYRVIKFVLFMITCHVLPSFGIYNDL---KKYGQWAIITGATDGIGKAYAVELAKQKFNIVLISRTEEKLQRVAEEIKNAHGVDTKYIVFDFSTPEGYEERIGNVISDLDVGVLVNNVGMSSKWDRLYDELEMAEHI--RVMHTNTFGEMHMTYMLTKKMIQQKRGIMIHISSFFGYYPIGLISVYSPTKAFVNSFVQNLQAETKHCKDVHHQLVTPFFVATNMTKGSVKVTRVTPDAATFAGAALRTVGLTPHTFGYWTHDILGSILMTFPPFVFGRLPFVKSFQKYCKNRRLKTLEKS 1673
            SAL +  F  W+G     Y + R I + LF      L  +G+ N+       G+WA++TG+TDGIGK+YA ELAK    +VLISR+++KL +V+ EIK    V+T+ I  DF++ + Y ++I   ++ L++G+LVNNVGMS ++   + ++   +++  ++++ N      MT ++   M+++ +G +++ISS  G  P+ L+++YS TK FV+ F Q L  E +  K V  Q V P+FVAT + K   K T   P   TF  +A++TVGL   T GY  H ++GSI+   P +++  L  V +  K  +   LK  +K+
Sbjct:    3 SALPAAGFLYWVGAGTVAYLALR-ISYSLFT----ALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIY-DKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYR-SKGVFVQSVLPYFVATKLAKIR-KPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIY--LKIVMNMNKSTRAHYLKKTKKN 312          
The following BLAST results are available for this feature:
BLAST of TCONS_00000590 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DHB128.629e-5135.63Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sa... [more]
back to top