Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000589 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000589
Unique NameTCONS_00000589
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2056

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000589 ID=TCONS_00000589|Name=TCONS_00000589|organism=Clytia hemisphaerica|type=transcript|length=2056bp
GTTTTAGATAAAACATATAGAGCatacaaaaagttataaaaaagttACAG
CATGGATAAATTCGTGATTAGAACACCACGTGATCAGGTCAATgacaaac
aaaatggtagacctCAGAAGCCAAGGAAGAAACAGACCACTATTGAGTCA
TTATCGAGGGTTGTTATCGTGGAACAGGTGCATCGTCAGaaagaaatcct
gaaaaacgCAGAAACCACACCACAATTTCTCATCTCAACACTAAAAGACC
TGCACAAAGCTATCCCTTCAAAAAGTGTTCTACTAGAGACGAAAGTTGGT
CACGTGGTCAATAAATTACGTCATCATTCCGATCCAGAGGTCAAAGAACA
GGCGCGTTTACTACTTAAGAAATGGAAGAAGTTTTATAGAGAGATCAATG
CACGCCAACCAATAGATGTACGGTCTGACTTGAAGACGGAAAAGTTCCGA
ACAAAAGCAAAACAGCTTTTAAGGAAAGCAATCGGCATTAAAGATGACCA
CGCTATAGCTTTGTCGATCGAGAAAACGATATACCGCGCTGAGAAATCGG
TCAACACGCCAAAATATCGGAGGCTGATACGAACTATATGCATCAAAGTA
ACTAATGACTCGCAGACCAAGGAACAACTCAAAAACGGCAAACTTTCTAC
TGTTTCGTTGATTAAAATGATTGAAAGTTCAGTGACTTGAGGTTTGACGA
ATGAAAACGGTTTTCAGTTTGAGAGTGAACAAATTTTGGCCGAAAtatga
cagacagacagacagacagacggacaaagttatggtgaaatttttgcttt
attcaaattattttattattttccattttatttagaaagatataaaatac
aaaaatgtcaGCGCTTTTATCCTTGATATTTTACACGTGGCTAGGATATT
GGTCATACCGTGTCATTAAATTCGTCTTGTTTATGATCACGTGTCATGTT
CTACCTTCTTTTGGTATTTATAATGACCTCAAGAAGTATGGTCAATGGGC
TATCATTACTGGCGCTACTGATGGTATTGGTAAGGCTTATGCTGTGGAGC
TCGCCAAGCAGAAATTCAACATCGTCTTGATCAGCCGAACGGAAGAGAAA
TTACAACGAGTGGCTGAGGAGATTAAAAATGCTCATGGTGTCGACACCAA
ATatattgtttttgatttttctacacCTGAGGGTTATGAAGAACGTATTG
GGAATGTGATCTCAGATCTGGATGTTGGAGTTTTGGTCAATAACGTTGGT
ATGTCCAGTAAGTGGGATCGCTTGTATGATGAGTTGGAGATGGCTGAACA
TATCCGTGTCATGCATACCAACACCTTTGGTGAAATGCATATGACGTATA
TGCTGACGAAGAAAATGATTCAACAAAAACGTGGTATTATGATTCACATT
TCCAGCTTCTTTGGTTATTATCCGATCGGTTTAATAAGTGTTTATTCACC
TACTAAAGCCTTCGTCAACTCTTTCGTCCAGAATCTCCAAGCTGAAACTA
AACACTGCAAAGACGTCCATCATCAATTAGTGACGCCCTTCTTTGTTGCC
ACAAATATGACCAAAGGGAGTGTTAAAGTCACCAGAGTTACCCCAGATGC
TGCCACCTTTGCTGGCGCAGCTTTACGCACCGTTGGCTTAACGCCGCACA
CTTTTGGGTACTGGACTCATGATATTCTTGGGTCAATCTTAATGACCTTT
CCACCTTTTGTTTTTGGTAGATTACCGTTtgtcaaaagctttcaaaagtA
TTGTAAAAACAGACGCTTAAAGACCCTCGAGAAAAGCGAGTGAGAAAAAC
ATTAGGTTGGTTTCATAATTTTGATTATTGCTTTGTTTTTGCTACCCATT
TATATCGTAACTTTTACAGTGCGTAGAGACCCCTAGATATCCAACTTCTC
AGATAATCTTCCtgtcatttttgtaaataataTTAACCTCTGGGTATCGT
ATTTTGAAccaggggggggcacgcagttactacaagacagtatgacactt
actaccgtggtggtactgtattcagaagttatgaaaacagttactacaca
gtgtag
Run BLAST on NCBI

transcript from alignment at sc0000002:1197968..1202743-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000589 ID=TCONS_00000589|Name=TCONS_00000589|organism=Clytia hemisphaerica|type=transcript|length=4776bp|location=Sequence derived from alignment at sc0000002:1197968..1202743- (Clytia hemisphaerica)
GTTTTAGATAAAACATATAGAGCATACAAAAAGTTATAAAAAAGTTACAG CATGGATAAATTCGTGATTAGAACACCACGTGATCAGGTCAATGACAAAC AAAATGGTAGACCTCAGAAGCCAAGGAAGAAACAGACCACTATTGAGTCA TTATCGGTGAGCAATTGAATTTAATGCACTGCACAATGGTAAAGTACACA GGATTTTTCATTGAAACTTCACACCCCCTTCTCACTTTTCACAGACCCGG TAAGTTTTTTTCAGCCAGTGGGAGTAGAAATATCCGACAGGGTCAACTTT TGGTCATTCCAAGAAACCATTTTTTAGGGTTTGTTTTAAAAAGTAATTGA AACTTTGAATCTGATAGCATCCACAATCCAGGTAGTCAATAGATGGTTTT TTATGTTTTGTTTTTAAGTTACGTAACTTCTGCAATTATGAAAGCAAACG TTCGATTTGCGAATGTATCCTCTACATGTTCGAATGTTTGCTTCCATAAT GGCTGAAATTACGTAAGATAGCCAAACATGAAAAACCTCTATACTGTATT TACAATCGAAATCAAATCTTTTTAGAGGGTTGTTATCGTGGAACAGGTGC ATCGTCAGAAAGAAATCCTGAAAAACGCAGAAACCACACCACAATTTCTC ATCTCAACACTAAAAGACCTGCACAAAGCTATCCCTTCAAAAAGTGTTCT ACTAGAGACGAAAGTTGGTCACGTGGTCAATAAATTACGTCATCATTCCG ATCCAGAGGTCAAAGAACAGGCGCGTTTACTACTTAAGAAATGGAAGAAG TTTTATAGAGAGATCAATGCACGCCAACCAATAGATGTACGGTCTGACTT GAAGACGGAAAAGTTCCGAACAAAAGCAAAACAGCTTTTAAGGAAAGCAA TCGGCATTAAAGTAAGTCGTATTTGATTTCTTTATTATCCTTTTTGCTGG ACAAGTTTTTAAAAATCCTTCATGTGCAGATTGAACAGATTTCCCTTCTT TTATAGGAAGTTGTCGTTTTTGTTTAGGTTTCAGTTTTCGTTATTTTTCT TTGTTCAGAATGGCCCTTCATGGAATTAATTCTTCAGATGCTTAAAAGCT TTTGAATTTCGGAGAATGCCACTTTAAAACAAATGTTATTGATTATTACC CGCATCTGCATTCTTTGTCCTTAGCAGTAATAAATAGCCCCTGTTTTTTT AGATCATTGGATTATGGAGTCTCCATTTCTAACGCAAACGTGTCTTCAAC TCGAACAAGTTGATAGACCCTTCAAATTAGCAAACTCTATAAACCAGTCT CAAAAACTGGGACAAATTTGTGTTCCCCGTGCGTGTTCTAATTCTAGAAA TTCCACTGTATCTATGCTTGTTCTTATACTTTTAAATAACTTTAGTTTGG GCAAAAATGAAAAAATGTAGTGTTTCTGGAAACCGGCCGGGTGAAAAAAA ATAATTTTCTGACCCGGCCGCAGACTACATTAGTAGTTGATACATATTCA AGGCGTACATAAAAGTTATCTTTAAAGTTCAATGATCTTAAGTTATCAAA AATAGCAACAAAAAAAATTTTTCGGCCGGCCCCATGAAAGCTTTTTTCCT TAACCCGCATTCCGGAAACACTACATTTTTTTATTTTCACCTTCCCTGTA ATTTTAAAATCACAAAATGCAGACCCTAAAAAGGACATATTATTGACCTA GGCCTTTTTCCTTCGAAGTATTTCATTATTTGATTGAAATAATAATTTTA GAAACTTGCAAACAATCTCATTTCCAAAAGGGTTTTTTGAAATAATTTTT GTGAACATGGATTCTAATTAACATCATTCAAAAATTAAGTAACTTTACGT CTCTTTCATTAGCAAGGGAATGTTACAAAATTTCTTAGCAATTAAAATCA AATGTATATAACGATTGAAAATAGAAAAATTCCATTGTTCTCTAAAAATG TTAAAAATGTGAAAACCGCCTATACAAAAACGGCGAAAATATAAAGCTGC AACCATCTTTTTTTTGCGTTTGGAAATGAATTTTGATTTTCTTGAACAAA ATCTTCCGAAAATGGATTAATATTACAGGAAGATCTTGTAATATAATCTG ATTGCAAACTTGCTGGATATATACCACACCTCGGGTGAAAGTTTATAAAA AATTGAGCTCATAAAAACTTCAAGTCAGCTTATAGACTACGAATGCGTAG GAGTAATAAGTAAATGAAGAAGTTTTTGGAAAAGTTGTTACATGATTCTT TCGAAATACAGATAGAATAGCAAGATTTTTTTAGAACAGAGTTTATGTTT TCTGAATGAAGTTTTTAAAAGCCATCAAACTTTCGATGATAAGCATATAA TTAGGACAATTAAATGGGATTTTATCTTTTTTGACTACACATGTTATCAG CAGTAATAGATTAGCCGACGAATTTTCATGTTTTAACTTTTAGTTTTTTT CATATATATTTGTTCGTTAGGATGACCACGCTATAGCTTTGTCGATCGAG AAAACGATATACCGCGCTGAGAAATCGGTCAACACGCCAAAATATCGGAG GCTGATACGAACTATATGCATCAAAGTAACTAATGACTCGCAGACCAAGG AACAACTCAAAAACGGCAAACTTTCTACTGTTTCGTTGATTAAAATGATT GAAAGTTCAGTGACTTGAGGTTTGACGAATGAAAACGGTTTTCAGTTTGA GAGGTTTGTATTGCATGAAAATTTCATTATTTTGGAAGACCTTTGGTAAA GCTGTACCTTTAGCCTTTAACCATTGAACTTAAAGAGGATTCTCAATCGC GGCTCGTTTTTTAACAATATTAAAAATTGGTTTGCTTGTATATTATCTGT GTACATAGTTGTTTTTATTCAAACCCCAAGGAAAATGAAATTTTTACAGA AACATTAATTAAATTGATTAATCCTCCTGAATATTTTCAACTTGAAGTTC AAGCACAGAAGTGTTCTCATTTTAGTTGAATAAAATTTATAAACATATAT TTAGACGTTTCGGTGTCTTCCGATCACCATATCATCAGTAAAAATTAGGA AACACTAAACCAATTTTCAATATATCATCTAATTTACAAATACAGCCTTT CCAAACATGATACATATAAATACTTCTAATGCATGGACAGATTTCGCAAA ATGAAAGTAACCTGAAACTATTTGTTTCCATGAGCAAGTATTGACACGAT ATTTCAATAATCTCTTGTCAATGAATTTATTTTATCAAAATAGATAATCT TTGCAGCTCTTATTTCAGTTTGTTTCAGCTTGTTTGATTGAGCTCTCTGC AAATTGATACATGTGTGTATGTAGAAAGAAACGTTGCTAGAAAACACACC TCTTTTATGTAGGAAAGGAGTTTTCAGAAATTTGGGATCGTTTAAAGAAT AATGGACAATTCATGTAACTGAGAGATGCAATTTTTGTGCTTTAGTGAAC AAATTTTGGCCGAAATATGACAGACAGACAGACAGACAGACGGACAAAGT TATGGTGAAATTTTTGCTTTATTCAAATTATTTTATTATTTTCCATTTTA TTTAGAAAGATATAAAATACAAAAATGTCAGCGCTTTTATCCTTGATATT TTACACGTGGCTAGGATATTGGTCATACCGTGTCATTAAATTCGTCTTGT TTATGATCACGTGTCATGTTCTACCTTCTTTTGGTATTTATAATGACCTC AAGAAGTATGGTCAATGGGCTATCATTACTGGCGCTACTGATGGTATTGG TAAGGCTTATGCTGTGGAGCTCGCCAAGCAGAAATTCAACATCGTCTTGA TCAGCCGAACGGAAGAGAAATTACAACGAGTGGCTGAGGAGATTAAAAAT GCTCATGGTGTCGACACCAAATATATTGTTTTTGATTTTTCTACACCTGA GGGTTATGAAGAACGTATTGGGAATGTGATCTCAGATCTGGATGTTGGAG TTTTGGTCAATAACGTTGGTATGTCCAGTAAGTGGGATCGCTTGTATGAT GAGTTGGAGATGGCTGAACATATCCGTGTCATGCATACCAACACCTTTGG TGAAATGCATATGACGTATATGCTGACGAAGAAAATGATTCAACAAAAAC GTGGTATTATGATTCACATTTCCAGCTTCTTTGGTTATTATCCGATCGGT TTAATAAGTGTTTATTCACCTACTAAAGCCTTCGTCAACTCTTTCGTCCA GAATCTCCAAGCTGAAACTAAACACTGCAAAGACGTCCATCATCAATTAG TGACGCCCTTCTTTGTTGCCACAAATATGACCAAAGGGAGTGTTAAAGTC ACCAGAGTTACCCCAGATGCTGCCACCTTTGCTGGCGCAGCTTTACGCAC CGTTGGCTTAACGCCGCACACTTTTGGGTACTGGACTCATGATATTCTTG GGTCAATCTTAATGACCTTTCCACCTTTTGTTTTTGGTAGATTACCGTTT GTCAAAAGCTTTCAAAAGTATTGTAAAAACAGACGCTTAAAGACCCTCGA GAAAAGCGAGTGAGAAAAACATTAGGTTGGTTTCATAATTTTGATTATTG CTTTGTTTTTGCTACCCATTTATATCGTAACTTTTACAGTGCGTAGAGAC CCCTAGATATCCAACTTCTCAGATAATCTTCCTGTCATTTTTGTAAATAA TATTAACCTCTGGGTATCGTATTTTGAACCAGGGGGGGGCACGCAGTTAC TACAAGACAGTATGACACTTACTACCGTGGTGGTACTGTATTCAGAAGTT ATGAAAACAGTTACTACACAGTGTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000348XLOC_000348Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000589-exon-sc0000002-1575043694:1202588..1202743TCONS_00000589-exon-sc0000002-1575043694:1202588..1202743Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1575043694:1201833..1202168TCONS_00000589-exon-sc0000002-1575043694:1201833..1202168Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1575043694:1200041..1200273TCONS_00000589-exon-sc0000002-1575043694:1200041..1200273Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1575043694:1197968..1199298TCONS_00000589-exon-sc0000002-1575043694:1197968..1199298Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1510915933:1202588..1202743TCONS_00000589-exon-sc0000002-1510915933:1202588..1202743Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1510915933:1201833..1202168TCONS_00000589-exon-sc0000002-1510915933:1201833..1202168Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1510915933:1200041..1200273TCONS_00000589-exon-sc0000002-1510915933:1200041..1200273Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1510915933:1197968..1199298TCONS_00000589-exon-sc0000002-1510915933:1197968..1199298Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1491911889:1202588..1202743TCONS_00000589-exon-sc0000002-1491911889:1202588..1202743Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1491911889:1201833..1202168TCONS_00000589-exon-sc0000002-1491911889:1201833..1202168Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1491911889:1200041..1200273TCONS_00000589-exon-sc0000002-1491911889:1200041..1200273Clytia hemisphaericaexon
TCONS_00000589-exon-sc0000002-1491911889:1197968..1199298TCONS_00000589-exon-sc0000002-1491911889:1197968..1199298Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1197968..1202743 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.920443 0.611712 0.512831 0 0 0.866576 6.23041e-06 0 0.359225 0 2.64349e-06 0 0.242119 0.248163 0.342851 0 0 1.03973 0.369801 0.336203 0.334704 1.59126 0.442246 0 0 0
Blast
BLAST of TCONS_00000589 vs. Swiss-Prot (Human)
Match: DHB12 (Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 1.119e-50
Identity = 114/320 (35.62%), Postives = 186/320 (58.13%), Query Frame = 3
Query:  858 SALLSLIFYTWLG-----YWSYRVIKFVLFMITCHVLPSFGIYNDL---KKYGQWAIITGATDGIGKAYAVELAKQKFNIVLISRTEEKLQRVAEEIKNAHGVDTKYIVFDFSTPEGYEERIGNVISDLDVGVLVNNVGMSSKWDRLYDELEMAEHI--RVMHTNTFGEMHMTYMLTKKMIQQKRGIMIHISSFFGYYPIGLISVYSPTKAFVNSFVQNLQAETKHCKDVHHQLVTPFFVATNMTKGSVKVTRVTPDAATFAGAALRTVGLTPHTFGYWTHDILGSILMTFPPFVFGRLPFVKSFQKYCKNRRLKTLEKS 1787
            SAL +  F  W+G     Y + R I + LF      L  +G+ N+       G+WA++TG+TDGIGK+YA ELAK    +VLISR+++KL +V+ EIK    V+T+ I  DF++ + Y ++I   ++ L++G+LVNNVGMS ++   + ++   +++  ++++ N      MT ++   M+++ +G +++ISS  G  P+ L+++YS TK FV+ F Q L  E +  K V  Q V P+FVAT + K   K T   P   TF  +A++TVGL   T GY  H ++GSI+   P +++  L  V +  K  +   LK  +K+
Sbjct:    3 SALPAAGFLYWVGAGTVAYLALR-ISYSLFT----ALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIY-DKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYR-SKGVFVQSVLPYFVATKLAKIR-KPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIY--LKIVMNMNKSTRAHYLKKTKKN 312          
The following BLAST results are available for this feature:
BLAST of TCONS_00000589 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DHB121.119e-5035.63Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sa... [more]
back to top