Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000586 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000586
Unique NameTCONS_00000586
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1323

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000586 ID=TCONS_00000586|Name=TCONS_00000586|organism=Clytia hemisphaerica|type=transcript|length=1323bp
GCTTACACCATGGAAGAAACATACTTGGTCTATCTTGGCTGGTTATGTTT
GATGTACATTGTATACCATATTGTTTCATACACTTGGTTTATCGTTCGTA
CTTATTACTTGACTCGCATCCCTTATTTTCGTAAGAATTTGAAGGAATAT
GGTCAATGGGCAGTAGTGACGGGTTGTACTGATGGAATCGGTAAAGAATA
TGCTAAACAACTTGCATCTAAAGGACTCAATGTTGTTCTCATCAGCCGTA
ATGTGGAAAAGTTGAATCAATTGGCTTCTGAAATCAAAGAATCTAGTAAT
GTTGAAACgaaaattattcaacatgacttTTGTAATATTGACGATGAAAA
AGCTTatgaaataatggcttctgagCTGAATGGTTTGGATATTGGTATTT
TGATCAATAACGTTGGAATGGCTTATGGTGGCCCTTTGAAAATGCTCCAC
GATTTGGATCACGATCGACTTTCTAACATCATGAAAGTAAATATGTTCAA
CGTGGTCCGTATGACACACATGCTTCAAGGTGGAATGGTCAAAAGAGGGC
GTGGCGCTATTGTTCATATCTCGTCTGGAACAGTCTTCTTGAAATCTGGA
ATGGCAAATGTTTATTCCTCTACTAAATCATTTGTATTGAAGATGGCTGA
AACGCTACGTTTAGAATGTCAAGGGATCGTCGATCACCAAGTTTTGACCA
CAATGTATGTTTCTTCTAAGATGTCCAAAGTGAGACCAGCTCCCACTATC
CCGACTCCTCAAGATTATGTTGCATCAGCTCTTCGAACCCTTGGTGTTGC
CCCTATTGCATGTGGATACCCATCGCATGAAATGATAAGACTCATCTTGT
TAGCTTTGCCGGAAAAAGTTTGTTATTGGGTTTTCAAGATTGCCAGAAGC
AGGAAAGAAAAAATGAGATGAACGGTTAAGGATGGaatattagaaatatt
tttgaaatttatgggGATGGCAATTTTGATCACTAAAATatgattgattt
ttatgttcaattttgatttcttttcatTCGATTAATATGACATTATGATA
GAATCATGATAGGTAGAATATATTTTGGAATTTAGTCAAATTATAATAAA
TGAATATTAgtagatttttttccatttaactgTCTTGGCAGTATAGGGCA
ATAACAGAAGTTTTTTAAttactttgtttttgtttgattggttAAGTTCG
AATCGACATTTCTGAGTTTAACCAAGATTCACGAAAGGTTTTTGACCCCG
TGCTACCGCCCCAAGATTCAGGAATGGTTAAATTAAAATAATAAGATTTA
GGAACGTTCACTTTCTAATACGG
Run BLAST on NCBI

protein sequence of TCONS_00000586-protein

>TCONS_00000586-protein ID=TCONS_00000586-protein|Name=TCONS_00000586-protein|organism=Clytia hemisphaerica|type=polypeptide|length=306bp
AYTMEETYLVYLGWLCLMYIVYHIVSYTWFIVRTYYLTRIPYFRKNLKEY
GQWAVVTGCTDGIGKEYAKQLASKGLNVVLISRNVEKLNQLASEIKESSN
VETKIIQHDFCNIDDEKAYEIMASELNGLDIGILINNVGMAYGGPLKMLH
DLDHDRLSNIMKVNMFNVVRMTHMLQGGMVKRGRGAIVHISSGTVFLKSG
MANVYSSTKSFVLKMAETLRLECQGIVDHQVLTTMYVSSKMSKVRPAPTI
PTPQDYVASALRTLGVAPIACGYPSHEMIRLILLALPEKVCYWVFKIARS
RKEKMR
Run BLAST on NCBI

transcript from alignment at sc0000002:1189751..1192737-

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000586 ID=TCONS_00000586|Name=TCONS_00000586|organism=Clytia hemisphaerica|type=transcript|length=2987bp|location=Sequence derived from alignment at sc0000002:1189751..1192737- (Clytia hemisphaerica)
GCTTACACCATGGAAGAAACATACTTGGTCTTGGTCTATCTTGGCTGGTT ATGTTTGATGTACATCACGTACCATATTGTTTCATACACTTGGTTTATCG TTCGTACTTATTACTTGACTCGCATCCCTTATTTTCGTAAGGATTTGAAG GAATATGGTCAATGGGCAGTAGTGACGGGTTGTACTGATGGAATCGGTAA AGAATATGCTAAACAACTTGCATCTCAAGGACTCAATGTTGTTCTCATCA GCCGTAATGTGGAAAAGTTAAATCAAGTGGCTTCTGAAATCAAAGAATCT AGTAATGTTGAAACGAAAATTATTCAACATGACTTTTGCAATATTGACGA TGAAAAAACTTATGAATCAATGGCTTCTGACCTAAGGGATCTGGATATTG GAATTTTGGTCAATAACGTTGGAATGGCTCATGGTGGTCCTCTAAAAGCT TTTGACGAATTCAACCTTAATCGAATGTTAAGCATCATAAAAGTGAACAA TTTTTCAACTGTTCGAATGACACACATGATTCAAGGTGGAATGGTCAAAA GAGGGCGTGGCGCAATGGTTCATATCTCGTCTGGACTTGTATTCTTTAAA GGTGCAAAGGCTAACACGTACACGGCTTCCAAACAGTTTGTTTTGAAGCT AGCAGAATCGTTACGCTTAGAATGTCAAGGAGTTGTAGATCACCAGGTAC TCACCACTATGCAAGTGTCGACAAAAATGACTGGAGCAAATCCTGATTTT GCAACACCTACTTCTGAAAATTATGTGTCGTCAGCTCTTCGTACTATCGG CATTGCGCCCATAGCTTGCGGTACTCCAGTTCATGAACTCCATCGTTTAT TCATGATTTGTCTGTCGGAGAAAATCAGCAATTTGGTGCATACATATACT TTTAGTAGCAGAAGCGATGCAAAGGGCAAAAGAGATTAATTTCCTTTTCA ATTTTTCCATTCGATTGCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTC GTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGT TCGTTCGTTCGTTCTCCAACCAGTCATTCATTCATTCAACCGTCCACTCA CCCATTCACACATTCTTTTATCTTTGAAATAATGATACACAAAAGAAAGT TACAACTTTTAAACGTTAGCATTTTCTTTCCATAATTTAATTTAGTAAAA GTACCTTTTGGGAATATATTTATGTATAGAGTTGGAGATGGCCGCTCTGC ATCAAAATGAGGCCAGAAAAGATTTACACGCTTTTTTTATAAGAATATCT TCTATAAGAATATCAGGGTGAGTTTCACAGAATTTGATAAGAATACTGTC ATTTTGTATTTGGTTAATAAAAAAAAACTGCTTACTTTGTTAGACAGAAA TGTAATTTTAGCTCCAAATGTTCATTCAAAAGTACAAAACTCTCAAATTG ATCATTTCTCATGTTTGTAAAAAAAGTCTGAAAAATTAAGAATACGTTAA GAATATTTCACCCTCAATTTTGGCAATTTCTTAAAAATACTTGACCCTCA TCGAAAGTACACTATTCTTATAAAAAAAAGCATCTAATGTATTTAAAAAA AAGGTGCAAGAATCCATGGTATATAATATTTTTGTTTTCATTGCAGATAA ATAAAATTAAAAACAGGAAGAAAATGGAAGAAACATACTTGGTCTATCTT GGCTGGTTATGTTTGATGTACATTGTATACCATATTGTTTCATACACTTG GTTTATCGTTCGTACTTATTACTTGACTCGCATCCCTTATTTTCGTAAGA ATTTGAAGGAATATGGTCAATGGGCAGTAGTGACGGGTTGTACTGATGGA ATCGGTAAAGAATATGCTAAACAACTTGCATCTAAAGGACTCAATGTTGT TCTCATCAGCCGTAATGTGGAAAAGTTGAATCAATTGGCTTCTGAAATCA AAGAATCTAGTAATGTTGAAACGAAAATTATTCAACATGACTTTTGTAAT ATTGACGATGAAAAAGCTTATGAAATAATGGCTTCTGAGCTGAATGGTTT GGATATTGGTATTTTGATCAATAACGTTGGAATGGCTTATGGTGGCCCTT TGAAAATGCTCCACGATTTGGATCACGATCGACTTTCTAACATCATGAAA GTAAATATGTTCAACGTGGTCCGTATGACACACATGCTTCAAGGTGGAAT GGTCAAAAGAGGGCGTGGCGCTATTGTTCATATCTCGTCTGGAACAGTCT TCTTGAAATCTGGAATGGCAAATGTTTATTCCTCTACTAAATCATTTGTA TTGAAGATGGCTGAAACGCTACGTTTAGAATGTCAAGGGATCGTCGATCA CCAAGTTTTGACCACAATGTATGTTTCTTCTAAGATGTCCAAAGTGAGAC CAGCTCCCACTATCCCGACTCCTCAAGATTATGTTGCATCAGCTCTTCGA ACCCTTGGTGTTGCCCCTATTGCATGTGGATACCCATCGCATGAAATGAT AAGACTCATCTTGTTAGCTTTGCCGGAAAAAGTTTGTTATTGGGTTTTCA AGATTGCCAGAAGCAGGAAAGAAAAAATGAGATGAACGGTTAAGGATGGA ATATTAGAAATATTTTTGAAATTTATGGGGATGGCAATTTTGATCACTAA AATATGATTGATTTTTATGTTCAATTTTGATTTCTTTTCATTCGATTAAT ATGACATTATGATAGAATCATGATAGGTAGAATATATTTTGGAATTTAGT CAAATTATAATAAATGAATATTAGTAGATTTTTTTCCATTTAACTGTCTT GGCAGTATAGGGCAATAACAGAAGTTTTTTAATTACTTTGTTTTTGTTTG ATTGGTTAAGTTCGAATCGACATTTCTGAGTTTAACCAAGATTCACGAAA GGTTTTTGACCCCGTGCTACCGCCCCAAGATTCAGGAATGGTTAAATTAA AATAATAAGATTTAGGAACGTTCACTTTCTAATACGG

Coding sequence (CDS) from alignment at sc0000002:1189751..1192737-

>TCONS_00000586 ID=TCONS_00000586|Name=TCONS_00000586|organism=Clytia hemisphaerica|type=CDS|length=1842bp|location=Sequence derived from alignment at sc0000002:1189751..1192737- (Clytia hemisphaerica)
ATACTTGGTCTATCTTGGCTGGTTATGTTTGATGTACATTGTATACCATA
TTGTTTCATACACTTGGTTTATCGTTCGTACTTATTACTTGACTCGCATC
CCTTATTTTCGTAAGAATTTGAAGGAATATGGTCAATGGGCAGTAGTGAC
GGGTTGTACTGATGGAATCGGTAAAGAATATGCTAAACAACTTGCATCTA
AAGGACTCAATGTTGTTCTCATCAGCCGTAATGTGGAAAAGTTGAATCAA
TTGGCTTCTGAAATCAAAGAATCTAGTAATGTTGAAACGAAAATTATTCA
ACATGACTTTTGTAATATTGACGATGAAAAAGCTTATGAAATAATGGCTT
CTGAGCTGAATGGTTTGGATATTGGTATTTTGATCAATAACGTTGGAATG
GCTTATGGTGGCCCTTTGAAAATGCTCCACGATTTGGATCACGATCGACT
TTCTAACATCATGAAAGTAAATATGTTCAACGTGGTCCGTATGACACACA
TGCTTCAAGGTGGAATGGTCAAAAGAGGGCGTGGCGCTATTGTTCATATC
TCGTCTGGAACAGTCTTCTTGAAATCTGGAATGGCAAATGTTTATTCCTC
TACTAAATCATTTGTATTGAAGATGGCTGAAACGCTACGTTTAGAATGTC
AAGGGATCGTCGATCACCAAGTTTTGACCACAATGTATGTTTCTTCTAAG
ATGTCCAAAGTGAGACCAGCTCCCACTATCCCGACTCCTCAAGATTATGT
TGCATCAGCTCTTCGAACCCTTGGTGTTGCCCCTATTGCATGTGGATACC
CATCGCATGAAATGATAAGACTCATCTTGTTAGCTTTGCCGGAAAAAGTT
TGTTATTGGGTTTTCAAGATTGCCAGAAGCAGGAAAGAAAAAATGAGATG
AGCTTACACCATGGAAGAAACATACTTGGTCTATCTTGGCTGGTTATGTT
TGATGTACATTGTATACCATATTGTTTCATACACTTGGTTTATCGTTCGT
ACTTATTACTTGACTCGCATCCCTTATTTTCGTAAGAATTTGAAGGAATA
TGGTCAATGGGCAGTAGTGACGGGTTGTACTGATGGAATCGGTAAAGAAT
ATGCTAAACAACTTGCATCTAAAGGACTCAATGTTGTTCTCATCAGCCGT
AATGTGGAAAAGTTGAATCAATTGGCTTCTGAAATCAAAGAATCTAGTAA
TGTTGAAACGAAAATTATTCAACATGACTTTTGTAATATTGACGATGAAA
AAGCTTATGAAATAATGGCTTCTGAGCTGAATGGTTTGGATATTGGTATT
TTGATCAATAACGTTGGAATGGCTTATGGTGGCCCTTTGAAAATGCTCCA
CGATTTGGATCACGATCGACTTTCTAACATCATGAAAGTAAATATGTTCA
ACGTGGTCCGTATGACACACATGCTTCAAGGTGGAATGGTCAAAAGAGGG
CGTGGCGCTATTGTTCATATCTCGTCTGGAACAGTCTTCTTGAAATCTGG
AATGGCAAATGTTTATTCCTCTACTAAATCATTTGTATTGAAGATGGCTG
AAACGCTACGTTTAGAATGTCAAGGGATCGTCGATCACCAAGTTTTGACC
ACAATGTATGTTTCTTCTAAGATGTCCAAAGTGAGACCAGCTCCCACTAT
CCCGACTCCTCAAGATTATGTTGCATCAGCTCTTCGAACCCTTGGTGTTG
CCCCTATTGCATGTGGATACCCATCGCATGAAATGATAAGACTCATCTTG
TTAGCTTTGCCGGAAAAAGTTTGTTATTGGGTTTTCAAGATTGCCAGAAG
CAGGAAAGAAAAAATGAGATGAGCTTACACCATGGAAGAAAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000347XLOC_000347Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000586-proteinTCONS_00000586-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000586-exon-sc0000002-1575043694:1192718..1192737TCONS_00000586-exon-sc0000002-1575043694:1192718..1192737Clytia hemisphaericaexon
TCONS_00000586-exon-sc0000002-1575043694:1189751..1191053TCONS_00000586-exon-sc0000002-1575043694:1189751..1191053Clytia hemisphaericaexon
TCONS_00000586-exon-sc0000002-1510915933:1192718..1192737TCONS_00000586-exon-sc0000002-1510915933:1192718..1192737Clytia hemisphaericaexon
TCONS_00000586-exon-sc0000002-1510915933:1189751..1191053TCONS_00000586-exon-sc0000002-1510915933:1189751..1191053Clytia hemisphaericaexon
TCONS_00000586-exon-sc0000002-1491911889:1192718..1192737TCONS_00000586-exon-sc0000002-1491911889:1192718..1192737Clytia hemisphaericaexon
TCONS_00000586-exon-sc0000002-1491911889:1189751..1191053TCONS_00000586-exon-sc0000002-1491911889:1189751..1191053Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1189751..1192737 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 1.04476 1.33443 0 0 0.791969 0 0 0 0.581603 0.675598 0 0 0 0 0 0 0 0 3.21318 0.773438 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
Blast
BLAST of TCONS_00000586 vs. Swiss-Prot (Human)
Match: DHB12 (Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 2.425e-52
Identity = 103/249 (41.37%), Postives = 160/249 (64.26%), Query Frame = 1
Query:  151 GQWAVVTGCTDGIGKEYAKQLASKGLNVVLISRNVEKLNQLASEIKESSNVETKIIQHDFCNIDDEKAYEIMASELNGLDIGILINNVGMAYGGPLKMLHDLDHDR-LSNIMKVNMFNVVRMTHMLQGGMVKRGRGAIVHISSGTVFLKSGMANVYSSTKSFVLKMAETLRLE--CQGIVDHQVLTTMYVSSKMSKVR-PAPTIPTPQDYVASALRTLGVAPIACGYPSHEMIRLILLALPEKVCYWVF 885
            G+WAVVTG TDGIGK YA++LA  G+ VVLISR+ +KL+Q++SEIKE   VET+ I  DF +   E  Y+ + + L GL+IGIL+NNVGM+Y  P   L   D D  +  ++ +N+ +V +MT ++  GMV+R +GAI++ISSG+  L   +  +YS+TK+FV   ++ L  E   +G+    VL   +V++K++K+R P    P+P+ +V SA++T+G+     GY  H ++  I+  LP     W++
Sbjct:   50 GEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFAS---EDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVL-PYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPS----WIY 290          
The following BLAST results are available for this feature:
BLAST of TCONS_00000586 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DHB122.425e-5241.37Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sa... [more]
back to top