Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000577 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000577
Unique NameTCONS_00000577
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2019

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000577 ID=TCONS_00000577|Name=TCONS_00000577|organism=Clytia hemisphaerica|type=transcript|length=2019bp
CNTTTAAACAACATACAATATGAGAGAGTGTATTTCCATCCACATTGGAC
AAGCTGGTTGTCAAATTGGCAATGCATGTTGGGAATTATACTGCATGGAA
CACAATATCAAACCTGATGGTCTAATGAACGAAGAAGGGTCACAACGAGA
TGATGAATCTTTCAGTACTTTCTTCAATGAAACCGGGAATGGTAAACATG
TACCACGTGCTCTCTTCCTTGACCTGGAACCTAATGTTATTGATGAAATC
CGAACAGGAGCATACAGTAAATTGTATCACCCGGAACAGTTGATCAGTGG
AAGTGAAGATGCAGCTAATAATTATGCTCGTGGTCATTACACAGTTGGAA
AACAAATGATCGATGATGTCTTGGATAAAGTCCGAAGGTTAACCGAGAAC
TGTACCGGTCTTCAAGGTTTCTTAATGTTCCATTCCTTTGGTGGAGGTAC
TGGATCTGGTTTCACATCTCTCCTCATGGAACGAATCACAGCCGACTATA
GCCGTAAATCTAAACTGGAGTTTGCAATCTATCCAGCTCCTCGAGTATCT
ACAGCTGTCGTTGAGCCATATAATGCTTGCTTAACGACGCATACGACATT
GGATAATTCAGATTGTGCTTTCATGGTTGATAACGAAGCTATCTATGATA
TCTGTAGACGCAATCTTGATATTGATCGTCCATCCTATACTAACTTGAAT
CGGTTGATTGGTCAAATTGTCTCCTCGATCACAGCTTCGTTGCGTTTCGA
TGGCTCCTTGAATGTTGATCTGAATGAGTTTCAAACCAACTTGGTCCCAT
ACCCCAGAATTCATTTCCCAGTTGCCACCATAGCTCCAGTTCTGTCAGCT
GCGAAAGCGTACCATGAGAAAATCTCCGTATCGGAAATAACACATCAATG
CTTCGAGCCTGCAAACCAAATGGTGAAGTGTGATCCAAGGCTAGGTAAAT
ACATGGCTGTGTGCTTGTTATACCGTGGTGATGTTGTCCCTAAAGATGTT
AATACGGCAATTGCTCatttaaaaacgaaaaagaataTCCAATTCGTTGA
TTGGTGTCCAACTGGATTCAAAGTTGGAATCAATTACCAACCACCAACGA
CAGTGCCTGGTGGTGATCTCGCTAAAGTTCCTCGGTCTGTCTGCATGTTA
TCTAACACAACTGCTGTTGCTGAGGCCTGGGCTCGATTGGATCATAAGTT
CGATTTGATGTATGCTAAACGTGCTTTTATACATTGGTATGTCGGTGAAG
GGATGGAGGAAGGTGAATTTGCTGAAGCCAGGGAGAATATGGCATCTTTG
GAGAGAGATTATGAAGAAGTTGCTTCAGATTCAGTGGCTGATGATTATGA
TGAAGATGAGGAGGGAGAAGGAAGCGGTGAAGAATACTGAAGATCGTGTA
TTTCTCCCATTGCATTCACAGCTAAGTCTTTAAGATATCTTtagaatttt
atgaatttttgattgaaagcaAATTTAGAATGTATGATACTTAGAGATTg
ttgatttaaaaataaatttgaaaataatttacacACCCCAACCTAAGCTA
CTATCCCGgataaaattgcatttttgatAACAACAAGGGAGATATCCGTG
GTGGTTTGTGGGTTCCTCTAAAATTAGGAGAGTTTTATTAAATCTTTCAC
TTTTTGAGCGTTTGTCCCGGGGTAATGGAGCCTGTTAAATATCTTCAGGA
CCACTTGGACCAGTGGCACGTgaccgtacccaattttgcctttTCTCTGT
TTTGAACTATCACAGCAAATCAAAAAATGTCTGGaataatttcattgaat
ttactTCTTGCTAAGGTTAactgtaatatttttttgcatttgtGTACATA
GATTATGGCGAttatcataaaattttatgttaATTTTAGAAATagggaaa
atcaaaattatctaAATGCCGAAACACCTCTCTTGGTAAGTTccttaaaa
gttcaaaaatcaaTGGTCGTAATGTCTCTACTCTCTACTAAAGTTCTACT
TCCAAGCAATATAAGGGGG
Run BLAST on NCBI

protein sequence of TCONS_00000577-protein

>TCONS_00000577-protein ID=TCONS_00000577-protein|Name=TCONS_00000577-protein|organism=Clytia hemisphaerica|type=polypeptide|length=456bp
MRECISIHIGQAGCQIGNACWELYCMEHNIKPDGLMNEEGSQRDDESFST
FFNETGNGKHVPRALFLDLEPNVIDEIRTGAYSKLYHPEQLISGSEDAAN
NYARGHYTVGKQMIDDVLDKVRRLTENCTGLQGFLMFHSFGGGTGSGFTS
LLMERITADYSRKSKLEFAIYPAPRVSTAVVEPYNACLTTHTTLDNSDCA
FMVDNEAIYDICRRNLDIDRPSYTNLNRLIGQIVSSITASLRFDGSLNVD
LNEFQTNLVPYPRIHFPVATIAPVLSAAKAYHEKISVSEITHQCFEPANQ
MVKCDPRLGKYMAVCLLYRGDVVPKDVNTAIAHLKTKKNIQFVDWCPTGF
KVGINYQPPTTVPGGDLAKVPRSVCMLSNTTAVAEAWARLDHKFDLMYAK
RAFIHWYVGEGMEEGEFAEARENMASLERDYEEVASDSVADDYDEDEEGE
GSGEEY
Run BLAST on NCBI

transcript from alignment at sc0000002:1071636..1075486-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000577 ID=TCONS_00000577|Name=TCONS_00000577|organism=Clytia hemisphaerica|type=transcript|length=3851bp|location=Sequence derived from alignment at sc0000002:1071636..1075486- (Clytia hemisphaerica)
CNTTTAAACAACATACAATATGGTAAGTGTTTTTTAATGTACTTCTACCT TTAACATTTTATTCTTCTTCGTTTTCATTTTTTCTTCAATATTTACTATA TTTGATGATGGACTGATCCACTCGCATTATTTCTTCCACAACCAAAAATA CCGAGCTCATTCCAGATCTATCACAGTGCACAGCTTTTTTCATTGCTTCT ATAACAGACTTGAGTAGAAATTTTACTATCCAACAAACTCAAACCCAGTC CCTTAGTTTACTTTTTCATGATTCCTGATTGCATCACGTCTATCAGTAAA ATCAAAAAATGGTGCAAGTGGTTTGTGATACGAGATAAGCTGAAATTCTT TAGCGGTACGCTTGACTTTTGAGAAAAGGCCTGGTAGTGAATTTGCATTT TTCACAAGAGCGCTTTTCACGCTTGTGTTTTCTATACCATCATCAAAAGA AATTTTCCTTGTAAATTCAATAGTCTCATGAGTCTCCTCTACATGAACCG TGCCAATAAGAGTTGATATAGGTGTATTAGCATAATTTTGGGAGTGAAAT ATCTTTCATGGCACTAAAACAAACTAACTTTCAAATTCAACAATTGTTAT CATAGAGAGAGTGTATTTCCATCCACATTGGACAAGCTGGTTGTCAAATT GGCAATGCATGTTGGGAATTATACTGCATGGAACACAATATCAAACCTGA TGGTCTAATGAACGAAGAAGGGTCACAACGAGATGATGAATCTTTCAGTA CTTTCTTCAATGAAACCGGGAATGGTAAACATGTACCACGTGCTCTCTTC CTTGACCTGGAACCTAATGTTATTGGTAAGCAACTTAATCTAATACTGAT TCATCGGTGTGGTTTGTGGTTTGTGTTTTTTTGTGCCATTCGACAAAGAG TTTTACTTCACTGCCAAGCTCATTTCAGAAATCTCTCGGAATCTTATCTA ACCTCTTGGAATTTTATCGAAGAGTTTGACTTTTAGAGGCACATCCACAT GTGGTCTGAGTTTTGTTTCAAATGTCTTTGAATTGTATATCAATCGATCA GTTGCAAAATTTCACGTAGATTTAAAAAATGCAATAAAAAAGTAAGAACA ACTTTCTTTATCAAAACTATGACTCTTTGAAGTACTACCTGTATTTTGAC CCCTCTTCCTCTAATACGAGTATACTCGTAGTTGGCACCGAAAGTGTTAA GTTACGCTCTTTCGCAGGAACTATTGTTAAAACTCAATGGGTAAGTACCG ATTAAAAATATGGTAAACGTAGAGTAAATCCACCGCTATGGAATTGAGAC AGGTCAGGGGAGTTTTTCTGAGAGCGTTTAGATATGCTATTTCATTGATA TTTTAAGCCCGGGGGGGGGGTACTACCCTTGTCGACCGACGGGGGTGCTC CGCTGAGGTTCGAAAAATGGACCCTACGTGGGACTCGAAATTTGCGAAAA AAGTNTTTGAATATTCAATTAAATAAACAACTGAAATAGCTGAAATAGTA ACAAATCTCAGAAATATATTTATAACATGGGAATAAACCTAATAAAACGA ACAATTATGAAAATTATGGAATTACTGTATTCTTGTTTTTGTCCCCCCCC CACCAGGCAGAGGACTGAATATACCCCCATTTGTATTTCTCTCCCCATGA AGCTTGTAATTCTCACTCCCCCCTAGTACCAAAATCTGATTTCCCCCCAT CTTCCTGGGGGGATTATCCCATGTGTATATCAATCGATCAGTTGCAAAAT TTCACGTAGATTTAAAAAATGCAATAAAAAAGTGAGAGCAACTTTCTGTA TCAAAACTATGACTCTTTGAAGTACTACCTTTATTTTGACCCCTCTTCCT CTACTACGAGTATACTCGTAGTTGGCACCGAACGTGTTAAGTTACGCTCT TTCGCAGGAACTATTGTTAAAACTCAATGGGTAAGTACCGATTAAAAATA TGGTAAACGTAGAGTAAATCCACCGCTAAGGAATTGAGACAGGTCAGGGG AGTTTTTCTGAGAGGGTTTAGATATGCTATTTCATTGATATTTTAAGTGA ATATTTTCTTCTTCTACTCAACAGATGAAATCCGAACAGGAGCATACAGT AAATTGTATCACCCGGAACAGTTGATCAGTGGAAGTGAAGATGCAGCTAA TAATTATGCTCGTGGTCATTACACAGTTGGAAAACAAATGATCGATGATG TCTTGGATAAAGTCCGAAGGTTAACCGAGAACTGTACCGGTCTTCAAGGT TTCTTAATGTTCCATTCCTTTGGTGGAGGTACTGGATCTGGTTTCACATC TCTCCTCATGGAACGAATCACAGCCGACTATAGCCGTAAATCTAAACTGG AGTTTGCAATCTATCCAGCTCCTCGAGTATCTACAGCTGTCGTTGAGCCA TATAATGCTTGCTTAACGACGCATACGACATTGGATAATTCAGATTGTGC TTTCATGGTTGATAACGAAGCTATCTATGATATCTGTAGACGCAATCTTG ATATTGATCGTCCATCCTATACTAACTTGAATCGGTTGATTGGTCAAATT GTCTCCTCGATCACAGCTTCGTTGCGTTTCGATGGCTCCTTGAATGTTGA TCTGAATGAGTTTCAAACCAACTTGGTCCCATACCCCAGAATTCATTTCC CAGTTGCCACCATAGCTCCAGTTCTGTCAGCTGCGAAAGCGTACCATGAG AAAATCTCCGTATCGGAAATAACACATCAATGCTTCGAGCCTGCAAACCA AATGGTGAAGTGTGATCCAAGGCTAGGTAAATACATGGCTGTGTGCTTGT TATACCGTGGTGATGTTGTCCCTAAAGATGTTAATACGGCAATTGCTCAT TTAAAAACGAAAAAGAATATCCAATTCGTTGATTGGTGTCCAACTGGATT CAAAGTTGGAATCAATTACCAACCACCAACGACAGTGCCTGGTGGTGATC TCGCTAAAGTTCCTCGGTCTGTCTGCATGTTATCTAACACAACTGCTGTT GCTGAGGCCTGGGCTCGATTGGATCATAAGTTCGATTTGATGTATGCTAA ACGTGCTTTTATACATTGGTATGTCGGTGAAGGGATGGAGGAAGGTGAAT TTGCTGAAGCCAGGGAGAATATGGCATCTTTGGAGAGAGATTATGAAGAA GTTGCTTCAGATTCAGTGGCTGATGATTATGATGAAGATGAGGAGGGAGA AGGAAGCGGTGAAGAATACTGAAGATCGTGTATTTCTCCCATTGCATTCA CAGCTAAGTCTTTAAGATATCTTTAGAATTTTATGAATTTTTGATTGAAA GCAAATTTAGAATGTATGATACTTAGAGATTGTTGATTTAAAAATAAATT TGAAAATAATTTACACACCCCAACCTAAGCTACTATCCCGGATAAAATTG CATTTTTGATAACAACAAGGGAGATATCCGTGGTGGTTTGTGGGTTCCTC TAAAATTAGGAGAGTTTTATTAAATCTTTCACTTTTTGAGCGTTTGTCCC GGGGTAATGGAGCCTGTTAAATATCTTCAGGACCACTTGGACCAGTGGCA CGTGACCGTACCCAATTTTGCCTTTTCTCTGTTTTGAACTATCACAGCAA ATCAAAAAATGTCTGGAATAATTTCATTGAATTTACTTCTTGCTAAGGTT AACTGTAATATTTTTTTGCATTTGTGTACATAGATTATGGCGATTATCAT AAAATTTTATGTTAATTTTAGAAATAGGGAAAATCAAAATTATCTAAATG CCGAAACACCTCTCTTGGTAAGTTCCTTAAAAGTTCAAAAATCAATGGTC GTAATGTCTCTACTCTCTACTAAAGTTCTACTTCCAAGCAATATAAGGGG G

Coding sequence (CDS) from alignment at sc0000002:1071636..1075486-

>TCONS_00000577 ID=TCONS_00000577|Name=TCONS_00000577|organism=Clytia hemisphaerica|type=CDS|length=4113bp|location=Sequence derived from alignment at sc0000002:1071636..1075486- (Clytia hemisphaerica)
ATGAAATCCGAACAGGAGCATACAGTAAATTGTATCACCCGGAACAGTTG
ATCAGTGGAAGTGAAGATGCAGCTAATAATTATGCTCGTGGTCATTACAC
AGTTGGAAAACAAATGATCGATGATGTCTTGGATAAAGTCCGAAGGTTAA
CCGAGAACTGTACCGGTCTTCAAGGTTTCTTAATGTTCCATTCCTTTGGT
GGAGGTACTGGATCTGGTTTCACATCTCTCCTCATGGAACGAATCACAGC
CGACTATAGCCGTAAATCTAAACTGGAGTTTGCAATCTATCCAGCTCCTC
GAGTATCTACAGCTGTCGTTGAGCCATATAATGCTTGCTTAACGACGCAT
ACGACATTGGATAATTCAGATTGTGCTTTCATGGTTGATAACGAAGCTAT
CTATGATATCTGTAGACGCAATCTTGATATTGATCGTCCATCCTATACTA
ACTTGAATCGGTTGATTGGTCAAATTGTCTCCTCGATCACAGCTTCGTTG
CGTTTCGATGGCTCCTTGAATGTTGATCTGAATGAGTTTCAAACCAACTT
GGTCCCATACCCCAGAATTCATTTCCCAGTTGCCACCATAGCTCCAGTTC
TGTCAGCTGCGAAAGCGTACCATGAGAAAATCTCCGTATCGGAAATAACA
CATCAATGCTTCGAGCCTGCAAACCAAATGGTGAAGTGTGATCCAAGGCT
AGGTAAATACATGGCTGTGTGCTTGTTATACCGTGGTGATGTTGTCCCTA
AAGATGTTAATACGGCAATTGCTCATTTAAAAACGAAAAAGAATATCCAA
TTCGTTGATTGGTGTCCAACTGGATTCAAAGTTGGAATCAATTACCAACC
ACCAACGACAGTGCCTGGTGGTGATCTCGCTAAAGTTCCTCGGTCTGTCT
GCATGTTATCTAACACAACTGCTGTTGCTGAGGCCTGGGCTCGATTGGAT
CATAAGTTCGATTTGATGTATGCTAAACGTGCTTTTATACATTGGTATGT
CGGTGAAGGGATGGAGGAAGGTGAATTTGCTGAAGCCAGGGAGAATATGG
CATCTTTGGAGAGAGATTATGAAGAAGTTGCTTCAGATTCAGTGGCTGAT
GATTATGATGAAGATGAGGAGGGAGAAGGAAGCGGTGAAGAATACTGAAG
AGAGTGTATTTCCATCCACATTGGACAAGCTGGTTGTCAAATTGGCAATG
CATGTTGGGAATTATACTGCATGGAACACAATATCAAACCTGATGGTCTA
ATGAACGAAGAAGGGTCACAACGAGATGATGAATCTTTCAGTACTTTCTT
CAATGAAACCGGGAATGGTAAACATGTACCACGTGCTCTCTTCCTTGACC
TGGAACCTAATGTTATTGATGATGAAATCCGAACAGGAGCATACAGTAAA
TTGTATCACCCGGAACAGTTGATCAGTGGAAGTGAAGATGCAGCTAATAA
TTATGCTCGTGGTCATTACACAGTTGGAAAACAAATGATCGATGATGTCT
TGGATAAAGTCCGAAGGTTAACCGAGAACTGTACCGGTCTTCAAGGTTTC
TTAATGTTCCATTCCTTTGGTGGAGGTACTGGATCTGGTTTCACATCTCT
CCTCATGGAACGAATCACAGCCGACTATAGCCGTAAATCTAAACTGGAGT
TTGCAATCTATCCAGCTCCTCGAGTATCTACAGCTGTCGTTGAGCCATAT
AATGCTTGCTTAACGACGCATACGACATTGGATAATTCAGATTGTGCTTT
CATGGTTGATAACGAAGCTATCTATGATATCTGTAGACGCAATCTTGATA
TTGATCGTCCATCCTATACTAACTTGAATCGGTTGATTGGTCAAATTGTC
TCCTCGATCACAGCTTCGTTGCGTTTCGATGGCTCCTTGAATGTTGATCT
GAATGAGTTTCAAACCAACTTGGTCCCATACCCCAGAATTCATTTCCCAG
TTGCCACCATAGCTCCAGTTCTGTCAGCTGCGAAAGCGTACCATGAGAAA
ATCTCCGTATCGGAAATAACACATCAATGCTTCGAGCCTGCAAACCAAAT
GGTGAAGTGTGATCCAAGGCTAGGTAAATACATGGCTGTGTGCTTGTTAT
ACCGTGGTGATGTTGTCCCTAAAGATGTTAATACGGCAATTGCTCATTTA
AAAACGAAAAAGAATATCCAATTCGTTGATTGGTGTCCAACTGGATTCAA
AGTTGGAATCAATTACCAACCACCAACGACAGTGCCTGGTGGTGATCTCG
CTAAAGTTCCTCGGTCTGTCTGCATGTTATCTAACACAACTGCTGTTGCT
GAGGCCTGGGCTCGATTGGATCATAAGTTCGATTTGATGTATGCTAAACG
TGCTTTTATACATTGGTATGTCGGTGAAGGGATGGAGGAAGGTGAATTTG
CTGAAGCCAGGGAGAATATGGCATCTTTGGAGAGAGATTATGAAGAAGTT
GCTTCAGATTCAGTGGCTGATGATTATGATGAAGATGAGGAGGGAGAAGG
AAGCGGTGAAGAATACTGAAGAGAGTGTATTTCCATCCACATTGGACAAG
CTGGTTGTCAAATTGGCAATGCATGTTGGGAATTATACTGCATGGAACAC
AATATCAAACCTGATGGTCTAATGAACGAAGAAGGGTCACAACGAGATGA
TGAATCTTTCAGTACTTTCTTCAATGAAACCGGGAATGGTAAACATGTAC
CACGTGCTCTCTTCCTTGACCTGGAACCTAATGTTATTGATGATGAAATC
CGAACAGGAGCATACAGTAAATTGTATCACCCGGAACAGTTGATCAGTGG
AAGTGAAGATGCAGCTAATAATTATGCTCGTGGTCATTACACAGTTGGAA
AACAAATGATCGATGATGTCTTGGATAAAGTCCGAAGGTTAACCGAGAAC
TGTACCGGTCTTCAAGGTTTCTTAATGTTCCATTCCTTTGGTGGAGGTAC
TGGATCTGGTTTCACATCTCTCCTCATGGAACGAATCACAGCCGACTATA
GCCGTAAATCTAAACTGGAGTTTGCAATCTATCCAGCTCCTCGAGTATCT
ACAGCTGTCGTTGAGCCATATAATGCTTGCTTAACGACGCATACGACATT
GGATAATTCAGATTGTGCTTTCATGGTTGATAACGAAGCTATCTATGATA
TCTGTAGACGCAATCTTGATATTGATCGTCCATCCTATACTAACTTGAAT
CGGTTGATTGGTCAAATTGTCTCCTCGATCACAGCTTCGTTGCGTTTCGA
TGGCTCCTTGAATGTTGATCTGAATGAGTTTCAAACCAACTTGGTCCCAT
ACCCCAGAATTCATTTCCCAGTTGCCACCATAGCTCCAGTTCTGTCAGCT
GCGAAAGCGTACCATGAGAAAATCTCCGTATCGGAAATAACACATCAATG
CTTCGAGCCTGCAAACCAAATGGTGAAGTGTGATCCAAGGCTAGGTAAAT
ACATGGCTGTGTGCTTGTTATACCGTGGTGATGTTGTCCCTAAAGATGTT
AATACGGCAATTGCTCATTTAAAAACGAAAAAGAATATCCAATTCGTTGA
TTGGTGTCCAACTGGATTCAAAGTTGGAATCAATTACCAACCACCAACGA
CAGTGCCTGGTGGTGATCTCGCTAAAGTTCCTCGGTCTGTCTGCATGTTA
TCTAACACAACTGCTGTTGCTGAGGCCTGGGCTCGATTGGATCATAAGTT
CGATTTGATGTATGCTAAACGTGCTTTTATACATTGGTATGTCGGTGAAG
GGATGGAGGAAGGTGAATTTGCTGAAGCCAGGGAGAATATGGCATCTTTG
GAGAGAGATTATGAAGAAGTTGCTTCAGATTCAGTGGCTGATGATTATGA
TGAAGATGAGGAGGGAGAAGGAAGCGGTGAAGAATACTGAAGAGAGTGTA
TTTCCATCCACATTGGACAAGCTGGTTGTCAAATTGGCAATGCATGTTGG
GAATTATACTGCATGGAACACAATATCAAACCTGATGGTCTAATGAACGA
AGAAGGGTCACAACGAGATGATGAATCTTTCAGTACTTTCTTCAATGAAA
CCGGGAATGGTAAACATGTACCACGTGCTCTCTTCCTTGACCTGGAACCT
AATGTTATTGATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000341XLOC_000341Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000577-proteinTCONS_00000577-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000577-exon-sc0000002-1575043694:1075465..1075486TCONS_00000577-exon-sc0000002-1575043694:1075465..1075486Clytia hemisphaericaexon
TCONS_00000577-exon-sc0000002-1575043694:1074662..1074881TCONS_00000577-exon-sc0000002-1575043694:1074662..1074881Clytia hemisphaericaexon
TCONS_00000577-exon-sc0000002-1575043694:1071636..1073412TCONS_00000577-exon-sc0000002-1575043694:1071636..1073412Clytia hemisphaericaexon
TCONS_00000577-exon-sc0000002-1510915933:1075465..1075486TCONS_00000577-exon-sc0000002-1510915933:1075465..1075486Clytia hemisphaericaexon
TCONS_00000577-exon-sc0000002-1510915933:1074662..1074881TCONS_00000577-exon-sc0000002-1510915933:1074662..1074881Clytia hemisphaericaexon
TCONS_00000577-exon-sc0000002-1510915933:1071636..1073412TCONS_00000577-exon-sc0000002-1510915933:1071636..1073412Clytia hemisphaericaexon
TCONS_00000577-exon-sc0000002-1491911889:1075465..1075486TCONS_00000577-exon-sc0000002-1491911889:1075465..1075486Clytia hemisphaericaexon
TCONS_00000577-exon-sc0000002-1491911889:1074662..1074881TCONS_00000577-exon-sc0000002-1491911889:1074662..1074881Clytia hemisphaericaexon
TCONS_00000577-exon-sc0000002-1491911889:1071636..1073412TCONS_00000577-exon-sc0000002-1491911889:1071636..1073412Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1071636..1075486 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
26.622 24.0359 29.8176 29.2441 13.5233 9.55132 18.8763 10.8303 26.301 31.6539 29.0768 21.6747 11.7256 10.9753 9.02913 7.4042 15.7363 18.2601 17.7865 16.5026 13.5575 11.4855 14.4215 12.3263 5.21385 2.60659 14.2158 17.1915 13.2066 13.1772
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002452Alpha_tubulin
IPR000217Tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR017975Tubulin_CS
IPR008280Tub_FtsZ_C
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005874microtubule
Vocabulary: Biological Process
TermDefinition
GO:0007017microtubule-based process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007017 microtubule-based process
cellular_component GO:0005874 microtubule
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
molecular_function GO:0005200 structural constituent of cytoskeleton
Blast
BLAST of TCONS_00000577 vs. Swiss-Prot (Human)
Match: TBA1A (Tubulin alpha-1A chain OS=Homo sapiens GN=TUBA1A PE=1 SV=1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 358/440 (81.36%), Postives = 407/440 (92.50%), Query Frame = 2
Query:   20 MRECISIHIGQAGCQIGNACWELYCMEHNIKPDGLM-NEEGSQRDDESFSTFFNETGNGKHVPRALFLDLEPNVIDEIRTGAYSKLYHPEQLISGSEDAANNYARGHYTVGKQMIDDVLDKVRRLTENCTGLQGFLMFHXXXXXXXXXXXXLLMERITADYSRKSKLEFAIYPAPRVSTAVVEPYNACLTTHTTLDNSDCAFMVDNEAIYDICRRNLDIDRPSYTNLNRLIGQIVSSITASLRFDGSLNVDLNEFQTNLVPYPRIHFPVATIAPVLSAAKAYHEKISVSEITHQCFEPANQMVKCDPRLGKYMAVCLLYRGDVVPKDVNTAIAHLKTKKNIQFVDWCPTGFKVGINYQPPTTVPGGDLAKVPRSVCMLSNTTAVAEAWARLDHKFDLMYAKRAFIHWYVXXXXXXXXXXXXXXNMASLERDYEEVASDSV 1336
            MRECISIH+GQAG QIGNACWELYC+EH I+PDG M +++     D+SF+TFF+ETG GKHVPRA+F+DLEP VIDE+RTG Y +L+HPEQLI+G EDAANNYARGHYT+GK++ID VLD++R+L + CTGLQGFL+FHSFGGGTGSGFTSLLMER++ DY +KSKLEF+IYPAP+VSTAVVEPYN+ LTTHTTL++SDCAFMVDNEAIYDICRRNLDI+RP+YTNLNRLIGQIVSSITASLRFDG+LNVDL EFQTNLVPYPRIHFP+AT APV+SA KAYHE++SV+EIT+ CFEPANQMVKCDPR GKYMA CLLYRGDVVPKDVN AIA +KTK+ IQFVDWCPTGFKVGINYQPPT VPGGDLAKV R+VCMLSNTTA+AEAWARLDHKFDLMYAKRAF+HWYVGEGMEEGEF+EARE+MA+LE+DYEEV  DSV
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV 440          
The following BLAST results are available for this feature:
BLAST of TCONS_00000577 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TBA1A0.000e+081.36Tubulin alpha-1A chain OS=Homo sapiens GN=TUBA1A P... [more]
back to top