Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000534 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000534
Unique NameTCONS_00000534
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2132

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000534 ID=TCONS_00000534|Name=TCONS_00000534|organism=Clytia hemisphaerica|type=transcript|length=2132bp
TTTAgtacaaaaataacaatatacagaaataaaaaaataaaagaaataat
ggAAAGTTGGGAGGAAATCGAACAAGCTGCAGATGATGGGCGCCATGAGC
TGCATTTAAATGGTGACGTCATCTCAAGCAAACTGGAacgaaacgagatg
aaattacCTAACAAACTTTTTGAGCTCGTTGCGTTGAATTATTTGGAGAT
TTCAGATACTTCTCTTATTGAGATCCCTGATGATATGGCGAAATTAACAA
ATCTTATCAATTTGGCTTTACATAGGAACAGTATTGAAAAAGTTGGAGAT
TTCTTTAATCATTTACCGAAGCTGAAATTCTTTGATATGTCTTTTAACAA
ATTGACAAGTCTACCAGAGCAATTAAATTTAGGTACTGTACACACGTTGA
ATTTATCTAATAACGAGTTGGCGTCTTTAGGTGATCTAAGTGGGGCTGTT
AATCTTAGTATTTTACACATAGAACACAATGAGCTAGAAGAATTACCTAC
AGGGTTAGTCACCTTAAAACATCTATTAGAAGTGCACGCCAGCAATAACC
TAATAAACACCTTACCTGACGATCTACACACTTTTCCCGCGCTGAAATTA
TTTGACGTCTCCGAAAACAAGTTGAAAGAAGTACCACACTCAATGTCTCA
ATGCCAACGTTTGAAGACGCTCAAACTTGAAGGGAACCCCCTGAAAGATA
ATCGATTACGTAAGATGACAACACAGTGCAATACTAGAGCTATACTGGAA
TACATTGCCAAGCAGAGTGGTGGAGACGGGGGTAAGAAGggcaaaaaagg
aaagaaagggAAGAATCAACCGGTTAAGGAAGAAGCAGAAGAGAACGTCA
GACGTATCGTGATCACTCCGAACACGGATGATGAGAAGCGTGTCATATGT
GACGCCTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCACCGTCATAAA
GAATCTTGACCTGTCGGATGAAATTGTCTTCAAAAACTTCTTATCCCTAC
AAACGAAACTTCACGAGAATGAATGTGACATGCGCACACGTGCTACCATT
GCAACCCATAATGCAACAGGATTGAAATTCCCGCTTGTTTTCAAAGCTTC
GCATGTGGGTCAGACTGTCATCCATGCATTAGGGAAAAAGAAACAATGCA
ATGCGACAACATTGATACAGAATCTGAAAGATGAAAGAGATGCATTGAAg
cagaaaaagaaaagacaacCGAAAACTGGATTGTACAAGTTTATTGAACT
GGTGGATGGACAGGAGATGATAGCTTCAGTTCGAAATCAAGATGGTGACG
TCATTTCGTTGCCTCCGATCACTAATGGTGAAAAAACCaagATCGGTGCT
TCAGTTGGTGATGTTTTCATTGAAATATCATCACCAGTCAGTATCGCACA
ATGCAAGTACGTTATGGAAGAGTTGATCAAGAAAATGTTCCAACAGAATT
TCAACTCGGACATGGAAAGTGATGAAGGGCTTTGGATTGAACCAATCAGA
GTTGtggatgaaaatgaagatttgagaATAGTTTATCCCTCTAAAATTGA
TAtcgatttttcaaatattccaGTCAAACGACTGTGAAATGATTTGATTG
ACCGGATTTAGACGATTCTACTACTTCCCAGGTTTTCCATCATTGTCTTT
GAAGATGATATCATGTATAAGGACTTTGAACTTGGCTTTGAAGGATTGta
cttcaaaataatttgatgttGCATCCTTGACTAGTCAGTCATTTGgttga
ttttcatatttttggtcATCACTCAAAAGGACTGTTGAATTCTGTCCAAC
ATATATGTCATCAACTGCTGTTTCATTCCACGAAGTTGTATTTGAAGTTT
AGATTTTTTGAacgaatttaaatatttccGAAAACATAAATCTATAATTA
AGTCGATCAAAGACTCTATAACTACCTTTGTTAAATGCCCTAAATTCTAC
CAAGGAAATCGAGTGCTATTACGACATTTAGTGTAGTGCCAGTGTTGATA
AACGTTGATCAAAACTCGCCTATCTGTCGCCCATCAGTCAATTCCgtgac
aaaattatttttaagcaTCTCGTTAAGTAAGTGTGCTCAATTAAAAGAAA
CATCTTTAATAAGTTTCTGTTTATCAGTCCca
Run BLAST on NCBI

protein sequence of TCONS_00000534-protein

>TCONS_00000534-protein ID=TCONS_00000534-protein|Name=TCONS_00000534-protein|organism=Clytia hemisphaerica|type=polypeptide|length=528bp
FSTKITIYRNKKIKEIMESWEEIEQAADDGRHELHLNGDVISSKLERNEM
KLPNKLFELVALNYLEISDTSLIEIPDDMAKLTNLINLALHRNSIEKVGD
FFNHLPKLKFFDMSFNKLTSLPEQLNLGTVHTLNLSNNELASLGDLSGAV
NLSILHIEHNELEELPTGLVTLKHLLEVHASNNLINTLPDDLHTFPALKL
FDVSENKLKEVPHSMSQCQRLKTLKLEGNPLKDNRLRKMTTQCNTRAILE
YIAKQSGGDGGKKGKKGKKGKNQPVKEEAEENVRRIVITPNTDDEKRVIC
DASVKDVRPYLCCTVIKNLDLSDEIVFKNFLSLQTKLHENECDMRTRATI
ATHNATGLKFPLVFKASHVGQTVIHALGKKKQCNATTLIQNLKDERDALK
QKKKRQPKTGLYKFIELVDGQEMIASVRNQDGDVISLPPITNGEKTKIGA
SVGDVFIEISSPVSIAQCKYVMEELIKKMFQQNFNSDMESDEGLWIEPIR
VVDENEDLRIVYPSKIDIDFSNIPVKRL
Run BLAST on NCBI

transcript from alignment at sc0000002:400832..417709-

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000534 ID=TCONS_00000534|Name=TCONS_00000534|organism=Clytia hemisphaerica|type=transcript|length=16878bp|location=Sequence derived from alignment at sc0000002:400832..417709- (Clytia hemisphaerica)
TTTAGTACAAAAATAACAATATACAGAAATAAAAAAATAAAAGAAATAAT GGAAAGTTGGGAGGAAATCGAACAAGCTGCAGATGATGGGCGCCATGAGC TGCATTTAAATGGTGACGTCATCTCAAGCAAACTGGAACGAAACGAGATG AAATTACCTAACAAACTTTTTGAGCTCGTTGCGTTGAATTATTTGGAGAT TTCAGATACTTCTCTTATTGAGATCCCTGATGATATGGCGAAATTAACAA ATCTTATCAATTTGGCTTTACATAGGAACAGTATTGAAAAAGTTGGAGAT TTCTTTAATCATTTACCGAAGCTGAAATTCTTTGATATGTCTTTTAACAA ATTGACAAGTCTACCAGAGCAATTAAATTTAGGTACTGTACACACGTTGA ATTTATCTAATAACGAGTTGGCGTCTTTAGGTGATCTAAGTGGGGCTGTT AATCTTAGTATTTTACACATAGAACACAATGAGCTAGAAGAATTACCTAC AGGGTTAGTCACCTTAAAACATCTATTAGAAGTGCACGCCAGCAATAACC TAATAAACACCTTACCTGACGATCTACACACTTTTCCCGCGCTGAAATTA TTTGACGTCTCCGAAAACAAGTTGAAAGAAGTACCACACTCAATGTCTCA ATGCCAACGTTTGAAGACGCTCAAACTTGAAGGGAACCCCCTGAAAGATA ATCGATTACGTAAGATGACAACACAGTGCAATACTAGAGCTATACTGGAA TACATTGCCAAGCAGAGTGGTGGAGACGGGGGTAAGAAGGGCAAAAAAGG AAAGAAAGGGAAGAATCAACCGGTTAAGGAAGAAGCAGAAGAGAACGTCA GACGTATCGTGATCACTCCGAACACGGATGATGAGAAGCGTGTCATATGT GACGCCTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCACCGTCATAAA GAATCTTGACCTGTCGGATGAAATTGTCTTCAAAAACTTCTTATCCCTAC AAGTATGCATTTTATTTACTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACGTATCGTGA TCACTCCGAACACGGATGATGAGAAGCGTGTCATATGTGACGCCTCCGTG AAAGACGTACGCCCGTATTTGTGTTGCACCGTCATAAAGAATCTTGACCT GTCGGATGAAACTGTCTTCAAAAACTTCTTATCCCTACAAGTATGAATTT TATTTACTTTTATCCCTTCCTATTTTTCTTCTTTAAAGAATATAGCTGCA TGCTTTTGAAAATTAGATTTTAAAAACTCGAAGCCAATTGCGAGATTAAT GCTTATTTCGGTGAGTTTTTTTTAAACTTTCATAATTAACCAATTAGCTT TCTCCGGAGATAGCTGTCACCAAAATTCCCCTAACGTTTACCTAATTCAA TATTGGAGCTATTAGGTTTCGTAAAAGTGGTAACTGGAGTGATCGTGATC TGCGGATAAATCTCAGATCTTCAAACTGGAGCTTACTTAATACAACATTT TATCGCAAAGTCATTTGGTTCATTTGACGTTATTAGACAGGTACGAGCCG GGAAGTATCTTATCCATTTGGTGGACTAACTTTCTTGGGGTTTTTCTTGT TCCTTATGTTAATAAGAATGTTTTAAGCTTCTGGGCCACCTGGATTTCTC ACCTGGGTATCCATAATGGCGGATTTTTGGTCATGTGACCCCCGTAGGCA AAACTGAAAATTNGTTGAATTATTTGGAGATTTCAGATACTTCTCTTATT GAGATCCCTGATGATATGGCGAAATTAACAAATCTTATCAATTTGGCTTT ACATAGGAACAGTATTGAAAAAGTTGGAGATTTCTTTAATCATTTACCGA AGCTGAAATTCTTTGATATGTCTTTTAACAAATTGACAAGTCTACCAGAG CAATTAAATTTAGGTACTGTACACACGTTGAATTTATCTAATAACGAGTT GGCGTCTTTAGGTGATCTAAGTGGGGCTGTTAATCTTAGTATTTTACACA TAGAACACAATGAGCTAGAAGAATTACCTACAGGGTTAGTCACCTTAAAA CATCTATTAGAAGTGCACGCCAGCAATAACCTAATAAACACCTTACCTGA CGATCTACACACTTTTCCCGCGCTGAAATTATTTGACGTCTCCGAAAACA AGTTGAAAGAAGTACCACACTCAATGTCTCAATGCCAACGTTTGAAGACG CTCAAACTTGAAGGGAACCCCCTGAAAGATAATCGATTACGTAAGATGAC AACACAGTGCAATACTAGAGCTATACTGGAATACATTGCCAAGCAGAGTG GTGGAGACGGGGGTAAGAAGGGCAAAAAAGGAAAGAAAGGGAAGAATCAA CCGGTTAAGGAAGAAGCAGAAGAGAACGTCAGACGTATCGTGATCACTCC GAACACGGATGATGAGAAGCGTGTCATATGTGACGCCTCCGTGAAAGACG TACGCCCGTATTTGTGTTGCACCGTCATAAAGAATCTTGACCTGTCGGAT GAAATTGTCTTCAAAAACTTCTTATCCCTACAAGTATGCATTTTATTTAC TTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTTAAGCTTCTGGGCCACCTGGATTTCTCACC TGGGTATCCATAATGGCGGATTTTTGGTCATGTGACCCCCGTAGGCAAAA CTGAAAATTCTTCCAACCCGAATATAGGCATATCATATATCAATCGATCG GAAATTCGATACTGATTAATTTTGAGATACAAAGTTGAGTCTGAAAACTT TTCTATCTCGAGATATAAATCACTTTCGTTTTCTCAGGTTTGGCTGCAGT TGTAGGCGGGCTTTCATGGAGTGAGGCAATTCTTTTACTCATATCTCAAG AAATATGCTTTTAAACATATCAAAACTTTATGTGCTCCTAGAAAAGGCAT TAAAAATTGTTTGTGCAAATTTTCAATAAGTTTGCAGTAAAAATGTGTAT TTTACAGACCAGAGTACAATTTCCTTACCGTTGAAAAAAGATCTTTTTCT CTCATAATTAGCCTTTTTGTCTGAAATGAATGAGTGAAATGTTTCCCAAT AGGGTTTAAAACCAATCACTTATTCGTAATCTCACTCAGAGGGGTACTTA GCAACAAGTAAGGGCTAAATGTATCCGGTCAGCACTTTATAAGTACCTAT GATTTACGGTAAGACATGATCCCAAAAACGGTGAAATTTCCAAATAATTA ATGAAAAATTCTCTCATTGCATCTCAACATTAAACGAGAACCTTCTGTTC TTTAGATTGACTAATGCAAAGAATTATGAATAATGTAAATCGTTACAGTG TGTATTTTTACAGACCAGATTTAAGTGCTTCTAGGAGCTTGTCTTGTTCT AAAACGCTTTGGATTACTACAGAAATTCGCGAACTTGAGAATTTACTGAG TTAATCCGTCAAAATTCGCCAATTCCTTTATCTTTATTGTTCATGCATGA AACGAGATTTAGAGGGCTTAGAATCTGTGTTGTCTGTAGGGCCAAAAAAT GTCGGCCTAATATGGCTTCGAGAGGCGATAATCCTAGGCCATTGTAGGAA GCCTAGTGATGGAGCCATTTTTGTGAACCTGCTTGGGGCTATTCTGGTTA CTGTTACAATTATAAGAGGCGTATAATGGTCCAATGCATCATTGTATATC CGCTTTAACTACATGAATGCAACACAACGCCTTCAGCTAGTTGAATAAGT CAGACTGTGGGAATTTTAACTAAAAGCACTTTAAAGAAGTTATTGCCATA CAAAATAATGCTTTAAGCTACATGTCCAAAATATCCCCGTTTTCTTACAA AAATCTTAGTATAATATTAAGCAATCTTGATTTTAAAATTCTTATTTGTT TCGGACATGGCTTGCTGATGACGGTGATCCCATTTTCCTTTCCCCTCATG AGGTTTTGTCAGAACATGAACAAACGACGGGACATCCTTCTCCTTCGTAA GCACTGCTAGCTTCGTTGCCGCCTCGTTAAAACATAAAATGAAACAATAG GTTTTGATGATCTACCTTGGGAATACCTTGCTNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTGTTCTACTCTTCTCCA GTCTTTTATCTATATCATAACAAAGATAACAGATGCGAAATCATCGTCAT TTTTCTAAACTCCGATGAAATAATATCGAGTATATAGGATTGAGAGCATA GGATTCAAATTATGATATTCTTATGACACAGGCTCACAACTTTGGCATAC CTTTTTTTTTTCAAGTCAATAAAAAAACTAATTGGAATGACAAAAGTGAT TCAAAAGTATACACACAGTTGAAATTCTCCATTTCAGCGTATAAAAAAAA TTGAAAATAATTATTTTGTGACTTGAGAGAAACTAGCCGTATGCGCAGCG TCGCACGCTGCATGTCCCAATCCAGCAAATCACATCTAAAAAAAACCCAA CGGAAAAAGGATTGCTGCTGATTGATGATAAGATTTTGATTTTATAAAAG AAAGGAGAAAAAAGTTCAACGCCATGAAGAGGAGGCTTTGTAGAGCTTTG TTAGATTTTCGAAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNAACGTTGTAAACACACACGTTTTAGCATATTAATATATAGATTTTC AAACTATCAAGCTATCTATCAATCATTTTACCTAAGTAATTCAAAGAAAT AGCATTGTGATGGAATATCAACGGATTTTTTATACCAATTTTAAAATACA GGCGGCTACAAAGACACCATGGAAGATAGACGTCCAGTTATGATTTATCC CATGTGAAGGTGCAGTAGTGTACCAAGTATTGACCGTCGTCTAGGAGATC AGGACTAACTCCAACTCGGTGCTGTGTTTCACTTAATGAAAAGTAAATGC TACTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNGTCTCAAAGACAGGCTACACAGATTTCTCGTTACATGC ATGAATAATAAAGATATAGGAATTAGAGGATCTTGACGGATTTTACTCAG TAAGATTCTCCAGCTCCGGATTTTCCATGGTAAGTCTAAACATTTTAGGG TAATATAACCACCTAGAAGCACTTAATTCTGGTCTGTAAAATACACACAG CGATTTACATGTATTCTTGATTCTTTGCATGTGTCAAACTAAAGAATAAG GTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAACTTT GTTTAATGTCGAGATACAATGAGAGACTTTGTCAAATATTTGAGTAATAG CTTGGAAGTTTCACCGTTTTTTGGATCAAATCTTACCAAAAAAACATACT GATAAAGTGCTGACCAGACACATTTAGCCCTTATATATTTCCCAGGTACC TCTCGAATATAATATGAAGAATCGAGTGGCTCTAAACCTTATTAAGCATC ATTTTACTAATTCATTTCAGACAAAAAGGCCAATTTTGAGTAGTCTAGCA AGCTAGAAGACTAATTCAGATATAGTAGAAATAAAACAAAAAGTAATGGA GGGAACAAATTTTAGTCGTCTAGAAACCTTTGTGCAAGCCAAAAGCTTCA TATTAATATTGCTTTGCTATTGTTAATGAAAAAAAAATCTAGGGGGCTTG TTCGGAAAAAAACGGTTTGTTTTGATTTCGTAAATCGATTTAATTGGTTT AGAAAAAACAATCGAGACGCACACCATTGGTCGAAATACATAAAAAGAGA AATCAGAACACACAACAATTTTCTTTCTCGAAAAATTTTTCTCGTTTGTT TTAAACTAACTCCAAACAAAAGAAAAGTGTCATGTCAATATTGCAATTAT AATTTTTCTTCCCGCTCAAAAAAAATTTTCTTTAAAAAAAAAGTGTGTTG ATTTGTTGTGTGTTAAATTTTATTTTATTTTTCGTCTTTCATTTTGTTTT GAGAGTTTGTTGTTGCTTGATCAAAAATTAATTTCTCCTTACCTTTCGCG CGCCAAATTCTTACGGAAGCACCCCTGTCCGAGAAAAGCTTTCTTTTGTT TTCAGAAAAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCGTAACAAT TATCGTATTATCATATAACGCCTATACTACTGTATTACACGCATTATAAA CGACTCCAGTCTAAATTTTGAGAAAAAAAGATCTTTTTTCGACGGTAAGG AAATTGTACTCTGGTCTGTAAAATACACATTTTTACTTCAAAATTTTTGA AAATTTGCACAAACAATTTTTAGTGCCTTTTCTAAGAGCACATAAAGTTT TGATATGTTTAAAAGCATATTTCTTGAGATATGACTAAAAGAATTGCCTC ACTCCATGAAAGCCCGCCTACAACTGCAGCCAAACCTGAGAAAACGAAAG TGATTTATATCTCGAGATAGGAAAGATTTCAGACCCAACTTTGTATCTCA AAATTAATCAGTATCAAATTTCCGATCGATTGATATATGATATGCCTATA TTCGGGTTGGAAGAATTTTCAGTTTTGCCTACGGGGGTCACATGACCAAA AATCCGCCATTATGGATACCCAGGTGAGAAATCCAGGTGGCCCAGAAGCT TAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTA TGTGCATGTTTTGAGTGTATTTTTAAGCAATCTAGAGCTCAAATTTTCAA AATTTCCCCCCTCGGGCCAAACCATGGTTGGCCCTTGCGGTGTCACTAAA CTTCAGCCCCCCCAATATGAAAATGCTTCCTACGGCACTGCCTCAAGGAA ACTAATTTTAGCGGGAACTAAATTTCGCGGTCGAAAAAAAATATGGAAGA AATGACTTTGGAATTAATTTTCGCGGTTTTGCCCTATTTTGGAGATTATT TTTTATTTTCCGAGCGTTTTTCAAATTTTTCGATGGAAAATGGTCGAATT TACGGAAATTAGTTCTTGCGAAAATTTGTTCCCTTAAGGTAACTGAAAGT TTGACAAAAGTGATGCTAAAATCAGGTTTAAATTATATTTCTCTTTCTTT ACAGACGAAACTTCACGAGAATGAATGTGACATGCGCACACGTGCTACCA TTGCAACCCATAATGCAACAGGATTGAAATTCCCGCTTGTTTTCAAAGCT TCGCATGTGGGTCAGACTGTCATCCATGCATTAGGGAAAAAGAAACAATG CAATGCGACAACATTGATACAGAATCTGAAAGATGAAAGAGATGCATTGA AGCAGAAAAAGAAAAGACAACCGAAAACTGGATTGTACAAGTAAGGGATA TTCATTCTCTCGAGACCTATTTCATATAACAGATGCGAAAGGTTGCTTGA CATTTTTTTGTGAAGTGTAACGGATGTTTGTTGATTTGAGGAGTGAGCGA AAAATATCGAAGAAATTCTCAAATACCTATTCATGACATTTGACAACCAA TAGGGGGCTTACCTGAATTTATCAACAAGGACTCGTTTAGCCTGATTCGC AGACCTCTACAAAACCGCAGATAGTATAAGAGCACGAATCCGTCAGGGGA TGCCAGCAGCCTAGGATTTATGTTTTAGTAGATCTTTATGATCTAATGAA GTGGAGCGTATAAAGGTAGAGCATTCGTCTACGGTGCGCAAGGTCGCGGG TTCAATCCTCGGTCTGATCATAACCAAAGACTTCGTACACTGTACAAAAT GGTACTTAAGGACTCTCTGCTCCTTACTCAGCAATTAAGAGAAGGAGTAT TAAGAGTGGAACCCTACCTACCTTCGGATAAATAACTACCGAAAGATGAG TGCTCAGGTCGCTGCCGTCTGTGGTTGCAAGCCTTACTTATTATAGATCT CTAATCAATTTGTTTCACTTTCTTCTGAAGGTTTATTGAACTGGTGGATG GACAGGAGATGATAGCTTCAGTTCGAAATCAAGATGGTGACGTCATTTCG TTGCCTCCGATCACTAATGGTGAAAAAACCAAGGTATTTTTTTTTTCCGA TACTAGTATAGTACCTGTTTCAACTTGATAAAGGCAAACCGTCGAGACGT CGAATACAAAACTGTGTGTTTTTAATGTTCACCTTTTCCTGCTTTAGATA GAGAGAGGAGAACCTATTTTTTTTTCTCGATTCAGATTTTACCAAAATCT CAGTCAAAACTTCTGGAAATCATTTAAATTGATTTTTCCTAACTTCAAGA TGTAAAAAAAGGTACACTTATGCCTCGTTACGCAGCGTCCTTCCCCTCAT GAGTTTTTGGACCTACTTCGGAGTTCGTCCGTCCGTCTGTTACCAGCTTT TCTCTAGATTGGCTCATCAGTTTTTTCTGATTTTTAGCACAAGGATGCAA AATGGCAATGCCCAAAATGTGACGGAACCCGATTTTCGAAAAAAAAAACT TTCCACCGGAAAAACTGTTTTTTTTGTTTTTTTTCGAGATTTTATTTTTT GCTCAAAGATGCGTATTAACAATGCCCTAAACATGGCCGAGTCCGATTTT TGAGAAAAATTTTTTTCCGGCCGAAAATGCCGGAAATATGCCGGAAATCG CTGTTTTTCTGGATTTTCATTGGATTTTTTTCTTAAAATTGCTTGTTTTT TCATTCAAAAACATTATTAATAGCAATGCCCACCATCAAGCATGTTTTAA TTTTCAAAAAATTTGATTTTTGAAGCCGGAACTATTCAAAAATCGCCGGA ACAACCTATTTTCGCCGGAAAGACAGTATTTCTTGAATTTAATGAGCTGT GCTTAATATTTTTTAATTAAATTTTGCACACTGATGCAAAATGACAATAC CTAAAATGTGACGGAGCCTGATTTTCGAAAAACATTTTTTTCTGGCCGAA AATGCCGGAAAAACCGGTTTTGTCTGATTTTTTGCAGAAAGATGCGTATT CGCAATACTAAAAACATGACCGAGTTTGTTTTTTTTGAGAAAAATTCTTT TCCGGCTGAAAATGCCGGAAATATGCTGGTAATTACTGTTTTTGCAGATT GTCATTTGACTTTTCCCTCATTCTTTGTTTTTTCACACAAAAACATTTGC CCACCATTAAGCATGATTAAATTGTCAATAAAACTGATTTTTGCAACTGG AACTTGCTATTTCTATTTTTTCCCTACTCCCCTTCCCTCTTCCCCCATCA ACAATCAATTATAAAATTGAATGTGTTATGCATTTTTGCAAAACGCTATA TCGTCTGACTGATTGTTTTCATTTTTCTCCTTATTGCTATCTAGCTTTCA TCATCAGGTAGGTCCATTCAGCATGTTGCTTGTTGAAATATTTAGACTAG ATTTCATAATTATTCCCTTTTTTTCTTTTCCCTACAGATCGGTGCTTCAG TTGGTGATGTTTTCATTGAAATATCATCACCAGTCAGTATCGCACAATGC AAGTACGTTATGGAAGAGTTGATCAAGAAAATGTTCCAACAGAATTTCAA CTCGGACATGGAAAGTGATGAAGGGCTTTGGATTGAACCAATCAGAGTTG TGGATGAAAATGAAGATTTGAGAATAGTTTATCCCTCTAAAATTGATATC GATTTTTCAAATATTCCAGTCAAACGACTGTGAAATGATTTGATTGACCG GATTTAGACGATTCTACTACTTCCCAGGTTTTCCATCATTGTCTTTGAAG ATGATATCATGTATAAGGACTTTGAACTTGGCTTTGAAGGATTGTACTTC AAAATAATTTGATGTTGCATCCTTGACTAGTCAGTCATTTGGTTGATTTT CATATTTTTGGTCATCACTCAAAAGGACTGTTGAATTCTGTCCAACATAT ATGTCATCAACTGCTGTTTCATTCCACGAAGTTGTATTTGAAGTTTAGAT TTTTTGAACGAATTTAAATATTTCCGAAAACATAAATCTATAATTAAGTC GATCAAAGACTCTATAACTACCTTTGTTAAATGCCCTAAATTCTACCAAG GAAATCGAGTGCTATTACGACATTTAGTGTAGTGCCAGTGTTGATAAACG TTGATCAAAACTCGCCTATCTGTCGCCCATCAGTCAATTCCGTGACAAAA TTATTTTTAAGCATCTCGTTAAGTAAGTGTGCTCAATTAAAAGAAACATC TTTAATAAGTTTCTGTTTATCAGTCCCA

Coding sequence (CDS) from alignment at sc0000002:400832..417709-

>TCONS_00000534 ID=TCONS_00000534|Name=TCONS_00000534|organism=Clytia hemisphaerica|type=CDS|length=6348bp|location=Sequence derived from alignment at sc0000002:400832..417709- (Clytia hemisphaerica)
ATCGGTGCTTCAGTTGGTGATGTTTTCATTGAAATATCATCACCAGTCAG
TATCGCACAATGCAAGTACGTTATGGAAGAGTTGATCAAGAAAATGTTCC
AACAGAATTTCAACTCGGACATGGAAAGTGATGAAGGGCTTTGGATTGAA
CCAATCAGAGTTGTGGATGAAAATGAAGATTTGAGAATAGTTTATCCCTC
TAAAATTGATATCGATTTTTCAAATATTCCAGTCAAACGACTGTGAGTTT
ATTGAACTGGTGGATGGACAGGAGATGATAGCTTCAGTTCGAAATCAAGA
TGGTGACGTCATTTCGTTGCCTCCGATCACTAATGGTGAAAAAACCAAGA
CGAAACTTCACGAGAATGAATGTGACATGCGCACACGTGCTACCATTGCA
ACCCATAATGCAACAGGATTGAAATTCCCGCTTGTTTTCAAAGCTTCGCA
TGTGGGTCAGACTGTCATCCATGCATTAGGGAAAAAGAAACAATGCAATG
CGACAACATTGATACAGAATCTGAAAGATGAAAGAGATGCATTGAAGCAG
AAAAAGAAAAGACAACCGAAAACTGGATTGTACAATTTAGTACAAAAATA
ACAATATACAGAAATAAAAAAATAAAAGAAATAATGGAAAGTTGGGAGGA
AATCGAACAAGCTGCAGATGATGGGCGCCATGAGCTGCATTTAAATGGTG
ACGTCATCTCAAGCAAACTGGAACGAAACGAGATGAAATTACCTAACAAA
CTTTTTGAGCTCGTTGCGTTGAATTATTTGGAGATTTCAGATACTTCTCT
TATTGAGATCCCTGATGATATGGCGAAATTAACAAATCTTATCAATTTGG
CTTTACATAGGAACAGTATTGAAAAAGTTGGAGATTTCTTTAATCATTTA
CCGAAGCTGAAATTCTTTGATATGTCTTTTAACAAATTGACAAGTCTACC
AGAGCAATTAAATTTAGGTACTGTACACACGTTGAATTTATCTAATAACG
AGTTGGCGTCTTTAGGTGATCTAAGTGGGGCTGTTAATCTTAGTATTTTA
CACATAGAACACAATGAGCTAGAAGAATTACCTACAGGGTTAGTCACCTT
AAAACATCTATTAGAAGTGCACGCCAGCAATAACCTAATAAACACCTTAC
CTGACGATCTACACACTTTTCCCGCGCTGAAATTATTTGACGTCTCCGAA
AACAAGTTGAAAGAAGTACCACACTCAATGTCTCAATGCCAACGTTTGAA
GACGCTCAAACTTGAAGGGAACCCCCTGAAAGATAATCGATTACGTAAGA
TGACAACACAGTGCAATACTAGAGCTATACTGGAATACATTGCCAAGCAG
AGTGGTGGAGACGGGGGTAAGAAGGGCAAAAAAGGAAAGAAAGGGAAGAA
TCAACCGGTTAAGGAAGAAGCAGAAGAGAACGTCAGACGTATCGTGATCA
CTCCGAACACGGATGATGAGAAGCGTGTCATATGTGACGCCTCCGTGAAA
GACGTACGCCCGTATTTGTGTTGCACCGTCATAAAGAATCTTGACCTGTC
GGATGAAATTGTCTTCAAAAACTTCTTATCCCTACAAATCGGTGCTTCAG
TTGGTGATGTTTTCATTGAAATATCATCACCAGTCAGTATCGCACAATGC
AAGTACGTTATGGAAGAGTTGATCAAGAAAATGTTCCAACAGAATTTCAA
CTCGGACATGGAAAGTGATGAAGGGCTTTGGATTGAACCAATCAGAGTTG
TGGATGAAAATGAAGATTTGAGAATAGTTTATCCCTCTAAAATTGATATC
GATTTTTCAAATATTCCAGTCAAACGACTGTGAGTTTATTGAACTGGTGG
ATGGACAGGAGATGATAGCTTCAGTTCGAAATCAAGATGGTGACGTCATT
TCGTTGCCTCCGATCACTAATGGTGAAAAAACCAAGACGAAACTTCACGA
GAATGAATGTGACATGCGCACACGTGCTACCATTGCAACCCATAATGCAA
CAGGATTGAAATTCCCGCTTGTTTTCAAAGCTTCGCATGTGGGTCAGACT
GTCATCCATGCATTAGGGAAAAAGAAACAATGCAATGCGACAACATTGAT
ACAGAATCTGAAAGATGAAAGAGATGCATTGAAGCAGAAAAAGAAAAGAC
AACCGAAAACTGGATTGTACAATTTAGTACAAAAATAACAATATACAGAA
ATAAAAAAATAAAAGAAATAATGGAAAGTTGGGAGGAAATCGAACAAGCT
GCAGATGATGGGCGCCATGAGCTGCATTTAAATGGTGACGTCATCTCAAG
CAAACTGGAACGAAACGAGATGAAATTACCTAACAAACTTTTTGAGCTCG
TTGCGTTGAATTATTTGGAGATTTCAGATACTTCTCTTATTGAGATCCCT
GATGATATGGCGAAATTAACAAATCTTATCAATTTGGCTTTACATAGGAA
CAGTATTGAAAAAGTTGGAGATTTCTTTAATCATTTACCGAAGCTGAAAT
TCTTTGATATGTCTTTTAACAAATTGACAAGTCTACCAGAGCAATTAAAT
TTAGGTACTGTACACACGTTGAATTTATCTAATAACGAGTTGGCGTCTTT
AGGTGATCTAAGTGGGGCTGTTAATCTTAGTATTTTACACATAGAACACA
ATGAGCTAGAAGAATTACCTACAGGGTTAGTCACCTTAAAACATCTATTA
GAAGTGCACGCCAGCAATAACCTAATAAACACCTTACCTGACGATCTACA
CACTTTTCCCGCGCTGAAATTATTTGACGTCTCCGAAAACAAGTTGAAAG
AAGTACCACACTCAATGTCTCAATGCCAACGTTTGAAGACGCTCAAACTT
GAAGGGAACCCCCTGAAAGATAATCGATTACGTAAGATGACAACACAGTG
CAATACTAGAGCTATACTGGAATACATTGCCAAGCAGAGTGGTGGAGACG
GGGGTAAGAAGGGCAAAAAAGGAAAGAAAGGGAAGAATCAACCGGTTAAG
GAAGAAGCAGAAGAGAACGTCAGACGTATCGTGATCACTCCGAACACGGA
TGATGAGAAGCGTGTCATATGTGACGCCTCCGTGAAAGACGTACGCCCGT
ATTTGTGTTGCACCGTCATAAAGAATCTTGACCTGTCGGATGAAATTGTC
TTCAAAAACTTCTTATCCCTACAAATCGGTGCTTCAGTTGGTGATGTTTT
CATTGAAATATCATCACCAGTCAGTATCGCACAATGCAAGTACGTTATGG
AAGAGTTGATCAAGAAAATGTTCCAACAGAATTTCAACTCGGACATGGAA
AGTGATGAAGGGCTTTGGATTGAACCAATCAGAGTTGTGGATGAAAATGA
AGATTTGAGAATAGTTTATCCCTCTAAAATTGATATCGATTTTTCAAATA
TTCCAGTCAAACGACTGTGAGTTTATTGAACTGGTGGATGGACAGGAGAT
GATAGCTTCAGTTCGAAATCAAGATGGTGACGTCATTTCGTTGCCTCCGA
TCACTAATGGTGAAAAAACCAAGACGAAACTTCACGAGAATGAATGTGAC
ATGCGCACACGTGCTACCATTGCAACCCATAATGCAACAGGATTGAAATT
CCCGCTTGTTTTCAAAGCTTCGCATGTGGGTCAGACTGTCATCCATGCAT
TAGGGAAAAAGAAACAATGCAATGCGACAACATTGATACAGAATCTGAAA
GATGAAAGAGATGCATTGAAGCAGAAAAAGAAAAGACAACCGAAAACTGG
ATTGTACAATTTAGTACAAAAATAACAATATACAGAAATAAAAAAATAAA
AGAAATAATGGAAAGTTGGGAGGAAATCGAACAAGCTGCAGATGATGGGC
GCCATGAGCTGCATTTAAATGGTGACGTCATCTCAAGCAAACTGGAACGA
AACGAGATGAAATTACCTAACAAACTTTTTGAGCTCGTTGCGTTGAATTA
TTTGGAGATTTCAGATACTTCTCTTATTGAGATCCCTGATGATATGGCGA
AATTAACAAATCTTATCAATTTGGCTTTACATAGGAACAGTATTGAAAAA
GTTGGAGATTTCTTTAATCATTTACCGAAGCTGAAATTCTTTGATATGTC
TTTTAACAAATTGACAAGTCTACCAGAGCAATTAAATTTAGGTACTGTAC
ACACGTTGAATTTATCTAATAACGAGTTGGCGTCTTTAGGTGATCTAAGT
GGGGCTGTTAATCTTAGTATTTTACACATAGAACACAATGAGCTAGAAGA
ATTACCTACAGGGTTAGTCACCTTAAAACATCTATTAGAAGTGCACGCCA
GCAATAACCTAATAAACACCTTACCTGACGATCTACACACTTTTCCCGCG
CTGAAATTATTTGACGTCTCCGAAAACAAGTTGAAAGAAGTACCACACTC
AATGTCTCAATGCCAACGTTTGAAGACGCTCAAACTTGAAGGGAACCCCC
TGAAAGATAATCGATTACGTAAGATGACAACACAGTGCAATACTAGAGCT
ATACTGGAATACATTGCCAAGCAGAGTGGTGGAGACGGGGGTAAGAAGGG
CAAAAAAGGAAAGAAAGGGAAGAATCAACCGGTTAAGGAAGAAGCAGAAG
AGAACGTCAGACGTATCGTGATCACTCCGAACACGGATGATGAGAAGCGT
GTCATATGTGACGCCTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCAC
CGTCATAAAGAATCTTGACCTGTCGGATGAAATTGTCTTCAAAAACTTCT
TATCCCTACAAATCGGTGCTTCAGTTGGTGATGTTTTCATTGAAATATCA
TCACCAGTCAGTATCGCACAATGCAAGTACGTTATGGAAGAGTTGATCAA
GAAAATGTTCCAACAGAATTTCAACTCGGACATGGAAAGTGATGAAGGGC
TTTGGATTGAACCAATCAGAGTTGTGGATGAAAATGAAGATTTGAGAATA
GTTTATCCCTCTAAAATTGATATCGATTTTTCAAATATTCCAGTCAAACG
ACTGTGAGTTTATTGAACTGGTGGATGGACAGGAGATGATAGCTTCAGTT
CGAAATCAAGATGGTGACGTCATTTCGTTGCCTCCGATCACTAATGGTGA
AAAAACCAAGACGAAACTTCACGAGAATGAATGTGACATGCGCACACGTG
CTACCATTGCAACCCATAATGCAACAGGATTGAAATTCCCGCTTGTTTTC
AAAGCTTCGCATGTGGGTCAGACTGTCATCCATGCATTAGGGAAAAAGAA
ACAATGCAATGCGACAACATTGATACAGAATCTGAAAGATGAAAGAGATG
CATTGAAGCAGAAAAAGAAAAGACAACCGAAAACTGGATTGTACAATTTA
GTACAAAAATAACAATATACAGAAATAAAAAAATAAAAGAAATAATGGAA
AGTTGGGAGGAAATCGAACAAGCTGCAGATGATGGGCGCCATGAGCTGCA
TTTAAATGGTGACGTCATCTCAAGCAAACTGGAACGAAACGAGATGAAAT
TACCTAACAAACTTTTTGAGCTCGTTGCGTTGAATTATTTGGAGATTTCA
GATACTTCTCTTATTGAGATCCCTGATGATATGGCGAAATTAACAAATCT
TATCAATTTGGCTTTACATAGGAACAGTATTGAAAAAGTTGGAGATTTCT
TTAATCATTTACCGAAGCTGAAATTCTTTGATATGTCTTTTAACAAATTG
ACAAGTCTACCAGAGCAATTAAATTTAGGTACTGTACACACGTTGAATTT
ATCTAATAACGAGTTGGCGTCTTTAGGTGATCTAAGTGGGGCTGTTAATC
TTAGTATTTTACACATAGAACACAATGAGCTAGAAGAATTACCTACAGGG
TTAGTCACCTTAAAACATCTATTAGAAGTGCACGCCAGCAATAACCTAAT
AAACACCTTACCTGACGATCTACACACTTTTCCCGCGCTGAAATTATTTG
ACGTCTCCGAAAACAAGTTGAAAGAAGTACCACACTCAATGTCTCAATGC
CAACGTTTGAAGACGCTCAAACTTGAAGGGAACCCCCTGAAAGATAATCG
ATTACGTAAGATGACAACACAGTGCAATACTAGAGCTATACTGGAATACA
TTGCCAAGCAGAGTGGTGGAGACGGGGGTAAGAAGGGCAAAAAAGGAAAG
AAAGGGAAGAATCAACCGGTTAAGGAAGAAGCAGAAGAGAACGTCAGACG
TATCGTGATCACTCCGAACACGGATGATGAGAAGCGTGTCATATGTGACG
CCTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCACCGTCATAAAGAAT
CTTGACCTGTCGGATGAAATTGTCTTCAAAAACTTCTTATCCCTACAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000325XLOC_000325Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000534-exon-sc0000002-1575043694:416708..417709TCONS_00000534-exon-sc0000002-1575043694:416708..417709Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1575043694:403670..403905TCONS_00000534-exon-sc0000002-1575043694:403670..403905Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1575043694:402977..403079TCONS_00000534-exon-sc0000002-1575043694:402977..403079Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1575043694:400832..401622TCONS_00000534-exon-sc0000002-1575043694:400832..401622Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1510915933:416708..417709TCONS_00000534-exon-sc0000002-1510915933:416708..417709Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1510915933:403670..403905TCONS_00000534-exon-sc0000002-1510915933:403670..403905Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1510915933:402977..403079TCONS_00000534-exon-sc0000002-1510915933:402977..403079Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1510915933:400832..401622TCONS_00000534-exon-sc0000002-1510915933:400832..401622Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1491911889:416708..417709TCONS_00000534-exon-sc0000002-1491911889:416708..417709Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1491911889:403670..403905TCONS_00000534-exon-sc0000002-1491911889:403670..403905Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1491911889:402977..403079TCONS_00000534-exon-sc0000002-1491911889:402977..403079Clytia hemisphaericaexon
TCONS_00000534-exon-sc0000002-1491911889:400832..401622TCONS_00000534-exon-sc0000002-1491911889:400832..401622Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000534-proteinTCONS_00000534-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:400832..417709 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
45.0875 43.6941 30.91 25.8876 26.8452 15.3102 27.3703 31.7986 14.9162 18.7185 14.0338 9.80798 9.41004 10.5117 10.6538 14.2084 15.7751 16.389 4.86931 4.71 12.0449 12.2515 21.4512 21.8915 12.592 22.6166 6.76396 5.4299 12.9405 12.7362
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR001611Leu-rich_rpt
IPR032675L_dom-like
IPR020825Phe-tRNA_synthase_B3/B4
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00000534 vs. Swiss-Prot (Human)
Match: LRC47 (Leucine-rich repeat-containing protein 47 OS=Homo sapiens GN=LRRC47 PE=1 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 7.437e-69
Identity = 192/572 (33.57%), Postives = 288/572 (50.35%), Query Frame = 1
Query:   46 IMESWEEIEQAADDGRHELHLNGDVISSKLERNEMKLPNKLFELVALNYLEISDTSLIEIPD-DMAK-LTNLINLALHRNSI-EKVGDFFNHLPKLKFFDMSFNKLTSLPEQLNLGT--------VHTLNLSNNELASL-GDLS-GAVNXXXXXXXXXXXXXXPTGLV---TLKHLLEVHASNNLINTLPDDLHTFPALKLFDVSENKLKEVPHSMSQCQRLKTLKLEGNPLKDNRLRKMTTQCNTRAILEYIAKQSXXXXXXXXXXXXXXXNQPVKEEAEENVRRIVITPNTDDEKRVICDAS-----------------------VKDVRPYLCCTVIKNLDLSDEIVFKNFLSLQTKLHENECDMRTRATIATHNATGLKFPLVFKASHVGQTVIHALGKKKQCNATTLIQNLKDERDALKQKKKRQPKTGLYKFIELVDGQEMIASVRNQDGDVISLPPITNGEKTKIGASVGDVFIEISSPVSIAQCKYVMEELIKKMFQ----------QNFNSDMESD-----------------EG---LWIEPIRVVDENEDLRIVYPSKIDI 1554
            + ESW E+E A  + R EL L G  +  ++     +LP +LF L  L+YLE+S    +  P   +A+ L  L +L L RN++   +      LP L+  D+S N L +LP    LG         + +LNLS N L  L  DL+  A  L  L++  N L+  P  L     L  L E+ A++N +  L  D+    +LK  D+S N+L E+P  ++ C +LK +   GN L+D RL KM + C TR+ILEY+       G   GK   + +    +E   +   R       D E++ + DA                        V+DVRPY+   V++ +DL      K FL+ QTKLHE+ C+ RT AT+ATH    +K PL++ A       I  LG+K +  A  L++ L+ E +  +++KKRQ  +GL++++ L+DG E    + + DGDVIS PPITN EKTK+  +  D+F+E++S  S+  CK VM+ LI KM +          +   SD E+D                 +G   L +E +RVVD    L++VYPSK D+
Sbjct:    6 VSESWPELELAERERRRELLLTGPGLEERVRAAGGQLPPRLFTLPLLHYLEVSGCGSLRAPGPGLAQGLPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALEALPPGQGLGPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLRELSPDIAHLASLKTLDLSNNQLSEIPAELADCPKLKEINFRGNKLRDKRLEKMVSGCQTRSILEYL----RVGGRGGGKGKGRAEGSEKEESRRKRRERKQRREGGDGEEQDVGDAGRLLLRVLHVSENPVPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRK-EAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEKTKVKKTTSDLFLEVTSATSLQICKDVMDALILKMAEMKKYTLENKEEGSLSDTEADAVSGQLPDPTTNPSAGKDGPSLLVVEQVRVVDLEGSLKVVYPSKADL 572          
The following BLAST results are available for this feature:
BLAST of TCONS_00000534 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LRC477.437e-6933.57Leucine-rich repeat-containing protein 47 OS=Homo ... [more]
back to top