Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000533 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000533
Unique NameTCONS_00000533
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1284

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000533 ID=TCONS_00000533|Name=TCONS_00000533|organism=Clytia hemisphaerica|type=transcript|length=1284bp
NNGACGTATCGTGATCACTCCGAACACGGATGATGAGAAGCGTGTCATAT
GTGACGCCTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCACCGTCATA
AAGAATCTTGACCTGTCGGATGAAACTGTCTTCAAAAACTTCTTATCCCT
ACAAACGAAACTTCACGAGAATGAATGTGACATGCGCACACGTGCTACCA
TTGCAACCCATAATGCAACAGGATTGAAATTCCCGCTTGTTTTCAAAGCT
TCGCATGTGGGTCAGACTGTCATCCATGCATTAGGGAAAAAGAAACAATG
CAATGCGACAACATTGATACAGAATCTGAAAGATGAAAGAGATGCATTGA
AgcagaaaaagaaaagacaacCGAAAACTGGATTGTACAAGTTTATTGAA
CTGGTGGATGGACAGGAGATGATAGCTTCAGTTCGAAATCAAGATGGTGA
CGTCATTTCGTTGCCTCCGATCACTAATGGTGAAAAAACCaagATCGGTG
CTTCAGTTGGTGATGTTTTCATTGAAATATCATCACCAGTCAGTATCGCA
CAATGCAAGTACGTTATGGAAGAGTTGATCAAGAAAATGTTCCAACAGAA
TTTCAACTCGGACATGGAAAGTGATGAAGGGCTTTGGATTGAACCAATCA
GAGTTGtggatgaaaatgaagatttgagaATAGTTTATCCCTCTAAAATT
GATAtcgatttttcaaatattccaGTCAAACGACTGTGAAATGATTTGAT
TGACCGGATTTAGACGATTCTACTACTTCCCAGGTTTTCCATCATTGTCT
TTGAAGATGATATCATGTATAAGGACTTTGAACTTGGCTTTGAAGGATTG
tacttcaaaataatttgatgttGCATCCTTGACTAGTCAGTCATTTGgtt
gattttcatatttttggtcATCACTCAAAAGGACTGTTGAATTCTGTCCA
ACATATATGTCATCAACTGCTGTTTCATTCCACGAAGTTGTATTTGAAGT
TTAGATTTTTTGAacgaatttaaatatttccGAAAACATAAATCTATAAT
TAAGTCGATCAAAGACTCTATAACTACCTTTGTTAAATGCCCTAAATTCT
ACCAAGGAAATCGAGTGCTATTACGACATTTAGTGTAGTGCCAGTGTTGA
TAAACGTTGATCAAAACTCGCCTATCTGTCGCCCATCAGTCAATTCCgtg
acaaaattatttttaagcaTCTCGTTAAGTAAGTGTGCTCAATTAAAAGA
AACATCTTTAATAAGTTTCTGTTTATCAGTCCca
Run BLAST on NCBI

transcript from alignment at sc0000002:400832..414423-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000533 ID=TCONS_00000533|Name=TCONS_00000533|organism=Clytia hemisphaerica|type=transcript|length=13592bp|location=Sequence derived from alignment at sc0000002:400832..414423- (Clytia hemisphaerica)
NNGACGTATCGTGATCACTCCGAACACGGATGATGAGAAGCGTGTCATAT GTGACGCCTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCACCGTCATA AAGAATCTTGACCTGTCGGATGAAACTGTCTTCAAAAACTTCTTATCCCT ACAAGTATGAATTTTATTTACTTTTATCCCTTCCTATTTTTCTTCTTTAA AGAATATAGCTGCATGCTTTTGAAAATTAGATTTTAAAAACTCGAAGCCA ATTGCGAGATTAATGCTTATTTCGGTGAGTTTTTTTTAAACTTTCATAAT TAACCAATTAGCTTTCTCCGGAGATAGCTGTCACCAAAATTCCCCTAACG TTTACCTAATTCAATATTGGAGCTATTAGGTTTCGTAAAAGTGGTAACTG GAGTGATCGTGATCTGCGGATAAATCTCAGATCTTCAAACTGGAGCTTAC TTAATACAACATTTTATCGCAAAGTCATTTGGTTCATTTGACGTTATTAG ACAGGTACGAGCCGGGAAGTATCTTATCCATTTGGTGGACTAACTTTCTT GGGGTTTTTCTTGTTCCTTATGTTAATAAGAATGTTTTAAGCTTCTGGGC CACCTGGATTTCTCACCTGGGTATCCATAATGGCGGATTTTTGGTCATGT GACCCCCGTAGGCAAAACTGAAAATTNGTTGAATTATTTGGAGATTTCAG ATACTTCTCTTATTGAGATCCCTGATGATATGGCGAAATTAACAAATCTT ATCAATTTGGCTTTACATAGGAACAGTATTGAAAAAGTTGGAGATTTCTT TAATCATTTACCGAAGCTGAAATTCTTTGATATGTCTTTTAACAAATTGA CAAGTCTACCAGAGCAATTAAATTTAGGTACTGTACACACGTTGAATTTA TCTAATAACGAGTTGGCGTCTTTAGGTGATCTAAGTGGGGCTGTTAATCT TAGTATTTTACACATAGAACACAATGAGCTAGAAGAATTACCTACAGGGT TAGTCACCTTAAAACATCTATTAGAAGTGCACGCCAGCAATAACCTAATA AACACCTTACCTGACGATCTACACACTTTTCCCGCGCTGAAATTATTTGA CGTCTCCGAAAACAAGTTGAAAGAAGTACCACACTCAATGTCTCAATGCC AACGTTTGAAGACGCTCAAACTTGAAGGGAACCCCCTGAAAGATAATCGA TTACGTAAGATGACAACACAGTGCAATACTAGAGCTATACTGGAATACAT TGCCAAGCAGAGTGGTGGAGACGGGGGTAAGAAGGGCAAAAAAGGAAAGA AAGGGAAGAATCAACCGGTTAAGGAAGAAGCAGAAGAGAACGTCAGACGT ATCGTGATCACTCCGAACACGGATGATGAGAAGCGTGTCATATGTGACGC CTCCGTGAAAGACGTACGCCCGTATTTGTGTTGCACCGTCATAAAGAATC TTGACCTGTCGGATGAAATTGTCTTCAAAAACTTCTTATCCCTACAAGTA TGCATTTTATTTACTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAAGCTTCTGGGCCAC CTGGATTTCTCACCTGGGTATCCATAATGGCGGATTTTTGGTCATGTGAC CCCCGTAGGCAAAACTGAAAATTCTTCCAACCCGAATATAGGCATATCAT ATATCAATCGATCGGAAATTCGATACTGATTAATTTTGAGATACAAAGTT GAGTCTGAAAACTTTTCTATCTCGAGATATAAATCACTTTCGTTTTCTCA GGTTTGGCTGCAGTTGTAGGCGGGCTTTCATGGAGTGAGGCAATTCTTTT ACTCATATCTCAAGAAATATGCTTTTAAACATATCAAAACTTTATGTGCT CCTAGAAAAGGCATTAAAAATTGTTTGTGCAAATTTTCAATAAGTTTGCA GTAAAAATGTGTATTTTACAGACCAGAGTACAATTTCCTTACCGTTGAAA AAAGATCTTTTTCTCTCATAATTAGCCTTTTTGTCTGAAATGAATGAGTG AAATGTTTCCCAATAGGGTTTAAAACCAATCACTTATTCGTAATCTCACT CAGAGGGGTACTTAGCAACAAGTAAGGGCTAAATGTATCCGGTCAGCACT TTATAAGTACCTATGATTTACGGTAAGACATGATCCCAAAAACGGTGAAA TTTCCAAATAATTAATGAAAAATTCTCTCATTGCATCTCAACATTAAACG AGAACCTTCTGTTCTTTAGATTGACTAATGCAAAGAATTATGAATAATGT AAATCGTTACAGTGTGTATTTTTACAGACCAGATTTAAGTGCTTCTAGGA GCTTGTCTTGTTCTAAAACGCTTTGGATTACTACAGAAATTCGCGAACTT GAGAATTTACTGAGTTAATCCGTCAAAATTCGCCAATTCCTTTATCTTTA TTGTTCATGCATGAAACGAGATTTAGAGGGCTTAGAATCTGTGTTGTCTG TAGGGCCAAAAAATGTCGGCCTAATATGGCTTCGAGAGGCGATAATCCTA GGCCATTGTAGGAAGCCTAGTGATGGAGCCATTTTTGTGAACCTGCTTGG GGCTATTCTGGTTACTGTTACAATTATAAGAGGCGTATAATGGTCCAATG CATCATTGTATATCCGCTTTAACTACATGAATGCAACACAACGCCTTCAG CTAGTTGAATAAGTCAGACTGTGGGAATTTTAACTAAAAGCACTTTAAAG AAGTTATTGCCATACAAAATAATGCTTTAAGCTACATGTCCAAAATATCC CCGTTTTCTTACAAAAATCTTAGTATAATATTAAGCAATCTTGATTTTAA AATTCTTATTTGTTTCGGACATGGCTTGCTGATGACGGTGATCCCATTTT CCTTTCCCCTCATGAGGTTTTGTCAGAACATGAACAAACGACGGGACATC CTTCTCCTTCGTAAGCACTGCTAGCTTCGTTGCCGCCTCGTTAAAACATA AAATGAAACAATAGGTTTTGATGATCTACCTTGGGAATACCTTGCTNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTGT TCTACTCTTCTCCAGTCTTTTATCTATATCATAACAAAGATAACAGATGC GAAATCATCGTCATTTTTCTAAACTCCGATGAAATAATATCGAGTATATA GGATTGAGAGCATAGGATTCAAATTATGATATTCTTATGACACAGGCTCA CAACTTTGGCATACCTTTTTTTTTTCAAGTCAATAAAAAAACTAATTGGA ATGACAAAAGTGATTCAAAAGTATACACACAGTTGAAATTCTCCATTTCA GCGTATAAAAAAAATTGAAAATAATTATTTTGTGACTTGAGAGAAACTAG CCGTATGCGCAGCGTCGCACGCTGCATGTCCCAATCCAGCAAATCACATC TAAAAAAAACCCAACGGAAAAAGGATTGCTGCTGATTGATGATAAGATTT TGATTTTATAAAAGAAAGGAGAAAAAAGTTCAACGCCATGAAGAGGAGGC TTTGTAGAGCTTTGTTAGATTTTCGAAAACNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNAACGTTGTAAACACACACGTTTTAGCATATTA ATATATAGATTTTCAAACTATCAAGCTATCTATCAATCATTTTACCTAAG TAATTCAAAGAAATAGCATTGTGATGGAATATCAACGGATTTTTTATACC AATTTTAAAATACAGGCGGCTACAAAGACACCATGGAAGATAGACGTCCA GTTATGATTTATCCCATGTGAAGGTGCAGTAGTGTACCAAGTATTGACCG TCGTCTAGGAGATCAGGACTAACTCCAACTCGGTGCTGTGTTTCACTTAA TGAAAAGTAAATGCTACTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNGTCTCAAAGACAGGCTACACAGAT TTCTCGTTACATGCATGAATAATAAAGATATAGGAATTAGAGGATCTTGA CGGATTTTACTCAGTAAGATTCTCCAGCTCCGGATTTTCCATGGTAAGTC TAAACATTTTAGGGTAATATAACCACCTAGAAGCACTTAATTCTGGTCTG TAAAATACACACAGCGATTTACATGTATTCTTGATTCTTTGCATGTGTCA AACTAAAGAATAAGGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNCAACTTTGTTTAATGTCGAGATACAATGAGAGACTTTGTCAAA TATTTGAGTAATAGCTTGGAAGTTTCACCGTTTTTTGGATCAAATCTTAC CAAAAAAACATACTGATAAAGTGCTGACCAGACACATTTAGCCCTTATAT ATTTCCCAGGTACCTCTCGAATATAATATGAAGAATCGAGTGGCTCTAAA CCTTATTAAGCATCATTTTACTAATTCATTTCAGACAAAAAGGCCAATTT TGAGTAGTCTAGCAAGCTAGAAGACTAATTCAGATATAGTAGAAATAAAA CAAAAAGTAATGGAGGGAACAAATTTTAGTCGTCTAGAAACCTTTGTGCA AGCCAAAAGCTTCATATTAATATTGCTTTGCTATTGTTAATGAAAAAAAA ATCTAGGGGGCTTGTTCGGAAAAAAACGGTTTGTTTTGATTTCGTAAATC GATTTAATTGGTTTAGAAAAAACAATCGAGACGCACACCATTGGTCGAAA TACATAAAAAGAGAAATCAGAACACACAACAATTTTCTTTCTCGAAAAAT TTTTCTCGTTTGTTTTAAACTAACTCCAAACAAAAGAAAAGTGTCATGTC AATATTGCAATTATAATTTTTCTTCCCGCTCAAAAAAAATTTTCTTTAAA AAAAAAGTGTGTTGATTTGTTGTGTGTTAAATTTTATTTTATTTTTCGTC TTTCATTTTGTTTTGAGAGTTTGTTGTTGCTTGATCAAAAATTAATTTCT CCTTACCTTTCGCGCGCCAAATTCTTACGGAAGCACCCCTGTCCGAGAAA AGCTTTCTTTTGTTTTCAGAAAAAACNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNCCCGTAACAATTATCGTATTATCATATAACGCCTATACTACTGTATT ACACGCATTATAAACGACTCCAGTCTAAATTTTGAGAAAAAAAGATCTTT TTTCGACGGTAAGGAAATTGTACTCTGGTCTGTAAAATACACATTTTTAC TTCAAAATTTTTGAAAATTTGCACAAACAATTTTTAGTGCCTTTTCTAAG AGCACATAAAGTTTTGATATGTTTAAAAGCATATTTCTTGAGATATGACT AAAAGAATTGCCTCACTCCATGAAAGCCCGCCTACAACTGCAGCCAAACC TGAGAAAACGAAAGTGATTTATATCTCGAGATAGGAAAGATTTCAGACCC AACTTTGTATCTCAAAATTAATCAGTATCAAATTTCCGATCGATTGATAT ATGATATGCCTATATTCGGGTTGGAAGAATTTTCAGTTTTGCCTACGGGG GTCACATGACCAAAAATCCGCCATTATGGATACCCAGGTGAGAAATCCAG GTGGCCCAGAAGCTTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNCTTATGTGCATGTTTTGAGTGTATTTTTAAGCAATCTAGA GCTCAAATTTTCAAAATTTCCCCCCTCGGGCCAAACCATGGTTGGCCCTT GCGGTGTCACTAAACTTCAGCCCCCCCAATATGAAAATGCTTCCTACGGC ACTGCCTCAAGGAAACTAATTTTAGCGGGAACTAAATTTCGCGGTCGAAA AAAAATATGGAAGAAATGACTTTGGAATTAATTTTCGCGGTTTTGCCCTA TTTTGGAGATTATTTTTTATTTTCCGAGCGTTTTTCAAATTTTTCGATGG AAAATGGTCGAATTTACGGAAATTAGTTCTTGCGAAAATTTGTTCCCTTA AGGTAACTGAAAGTTTGACAAAAGTGATGCTAAAATCAGGTTTAAATTAT ATTTCTCTTTCTTTACAGACGAAACTTCACGAGAATGAATGTGACATGCG CACACGTGCTACCATTGCAACCCATAATGCAACAGGATTGAAATTCCCGC TTGTTTTCAAAGCTTCGCATGTGGGTCAGACTGTCATCCATGCATTAGGG AAAAAGAAACAATGCAATGCGACAACATTGATACAGAATCTGAAAGATGA AAGAGATGCATTGAAGCAGAAAAAGAAAAGACAACCGAAAACTGGATTGT ACAAGTAAGGGATATTCATTCTCTCGAGACCTATTTCATATAACAGATGC GAAAGGTTGCTTGACATTTTTTTGTGAAGTGTAACGGATGTTTGTTGATT TGAGGAGTGAGCGAAAAATATCGAAGAAATTCTCAAATACCTATTCATGA CATTTGACAACCAATAGGGGGCTTACCTGAATTTATCAACAAGGACTCGT TTAGCCTGATTCGCAGACCTCTACAAAACCGCAGATAGTATAAGAGCACG AATCCGTCAGGGGATGCCAGCAGCCTAGGATTTATGTTTTAGTAGATCTT TATGATCTAATGAAGTGGAGCGTATAAAGGTAGAGCATTCGTCTACGGTG CGCAAGGTCGCGGGTTCAATCCTCGGTCTGATCATAACCAAAGACTTCGT ACACTGTACAAAATGGTACTTAAGGACTCTCTGCTCCTTACTCAGCAATT AAGAGAAGGAGTATTAAGAGTGGAACCCTACCTACCTTCGGATAAATAAC TACCGAAAGATGAGTGCTCAGGTCGCTGCCGTCTGTGGTTGCAAGCCTTA CTTATTATAGATCTCTAATCAATTTGTTTCACTTTCTTCTGAAGGTTTAT TGAACTGGTGGATGGACAGGAGATGATAGCTTCAGTTCGAAATCAAGATG GTGACGTCATTTCGTTGCCTCCGATCACTAATGGTGAAAAAACCAAGGTA TTTTTTTTTTCCGATACTAGTATAGTACCTGTTTCAACTTGATAAAGGCA AACCGTCGAGACGTCGAATACAAAACTGTGTGTTTTTAATGTTCACCTTT TCCTGCTTTAGATAGAGAGAGGAGAACCTATTTTTTTTTCTCGATTCAGA TTTTACCAAAATCTCAGTCAAAACTTCTGGAAATCATTTAAATTGATTTT TCCTAACTTCAAGATGTAAAAAAAGGTACACTTATGCCTCGTTACGCAGC GTCCTTCCCCTCATGAGTTTTTGGACCTACTTCGGAGTTCGTCCGTCCGT CTGTTACCAGCTTTTCTCTAGATTGGCTCATCAGTTTTTTCTGATTTTTA GCACAAGGATGCAAAATGGCAATGCCCAAAATGTGACGGAACCCGATTTT CGAAAAAAAAAACTTTCCACCGGAAAAACTGTTTTTTTTGTTTTTTTTCG AGATTTTATTTTTTGCTCAAAGATGCGTATTAACAATGCCCTAAACATGG CCGAGTCCGATTTTTGAGAAAAATTTTTTTCCGGCCGAAAATGCCGGAAA TATGCCGGAAATCGCTGTTTTTCTGGATTTTCATTGGATTTTTTTCTTAA AATTGCTTGTTTTTTCATTCAAAAACATTATTAATAGCAATGCCCACCAT CAAGCATGTTTTAATTTTCAAAAAATTTGATTTTTGAAGCCGGAACTATT CAAAAATCGCCGGAACAACCTATTTTCGCCGGAAAGACAGTATTTCTTGA ATTTAATGAGCTGTGCTTAATATTTTTTAATTAAATTTTGCACACTGATG CAAAATGACAATACCTAAAATGTGACGGAGCCTGATTTTCGAAAAACATT TTTTTCTGGCCGAAAATGCCGGAAAAACCGGTTTTGTCTGATTTTTTGCA GAAAGATGCGTATTCGCAATACTAAAAACATGACCGAGTTTGTTTTTTTT GAGAAAAATTCTTTTCCGGCTGAAAATGCCGGAAATATGCTGGTAATTAC TGTTTTTGCAGATTGTCATTTGACTTTTCCCTCATTCTTTGTTTTTTCAC ACAAAAACATTTGCCCACCATTAAGCATGATTAAATTGTCAATAAAACTG ATTTTTGCAACTGGAACTTGCTATTTCTATTTTTTCCCTACTCCCCTTCC CTCTTCCCCCATCAACAATCAATTATAAAATTGAATGTGTTATGCATTTT TGCAAAACGCTATATCGTCTGACTGATTGTTTTCATTTTTCTCCTTATTG CTATCTAGCTTTCATCATCAGGTAGGTCCATTCAGCATGTTGCTTGTTGA AATATTTAGACTAGATTTCATAATTATTCCCTTTTTTTCTTTTCCCTACA GATCGGTGCTTCAGTTGGTGATGTTTTCATTGAAATATCATCACCAGTCA GTATCGCACAATGCAAGTACGTTATGGAAGAGTTGATCAAGAAAATGTTC CAACAGAATTTCAACTCGGACATGGAAAGTGATGAAGGGCTTTGGATTGA ACCAATCAGAGTTGTGGATGAAAATGAAGATTTGAGAATAGTTTATCCCT CTAAAATTGATATCGATTTTTCAAATATTCCAGTCAAACGACTGTGAAAT GATTTGATTGACCGGATTTAGACGATTCTACTACTTCCCAGGTTTTCCAT CATTGTCTTTGAAGATGATATCATGTATAAGGACTTTGAACTTGGCTTTG AAGGATTGTACTTCAAAATAATTTGATGTTGCATCCTTGACTAGTCAGTC ATTTGGTTGATTTTCATATTTTTGGTCATCACTCAAAAGGACTGTTGAAT TCTGTCCAACATATATGTCATCAACTGCTGTTTCATTCCACGAAGTTGTA TTTGAAGTTTAGATTTTTTGAACGAATTTAAATATTTCCGAAAACATAAA TCTATAATTAAGTCGATCAAAGACTCTATAACTACCTTTGTTAAATGCCC TAAATTCTACCAAGGAAATCGAGTGCTATTACGACATTTAGTGTAGTGCC AGTGTTGATAAACGTTGATCAAAACTCGCCTATCTGTCGCCCATCAGTCA ATTCCGTGACAAAATTATTTTTAAGCATCTCGTTAAGTAAGTGTGCTCAA TTAAAAGAAACATCTTTAATAAGTTTCTGTTTATCAGTCCCA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000325XLOC_000325Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000533-exon-sc0000002-1575043694:414270..414423TCONS_00000533-exon-sc0000002-1575043694:414270..414423Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1575043694:403670..403905TCONS_00000533-exon-sc0000002-1575043694:403670..403905Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1575043694:402977..403079TCONS_00000533-exon-sc0000002-1575043694:402977..403079Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1575043694:400832..401622TCONS_00000533-exon-sc0000002-1575043694:400832..401622Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1510915933:414270..414423TCONS_00000533-exon-sc0000002-1510915933:414270..414423Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1510915933:403670..403905TCONS_00000533-exon-sc0000002-1510915933:403670..403905Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1510915933:402977..403079TCONS_00000533-exon-sc0000002-1510915933:402977..403079Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1510915933:400832..401622TCONS_00000533-exon-sc0000002-1510915933:400832..401622Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1491911889:414270..414423TCONS_00000533-exon-sc0000002-1491911889:414270..414423Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1491911889:403670..403905TCONS_00000533-exon-sc0000002-1491911889:403670..403905Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1491911889:402977..403079TCONS_00000533-exon-sc0000002-1491911889:402977..403079Clytia hemisphaericaexon
TCONS_00000533-exon-sc0000002-1491911889:400832..401622TCONS_00000533-exon-sc0000002-1491911889:400832..401622Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:400832..414423 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
13.007 10.9522 8.64234 8.126 0 0 0.300291 0 6.18945 5.37285 4.15239 2.76419 3.25026 2.44041 2.94272 4.58882 5.79692 5.49715 2.09499 3.21205 3.56573 3.29774 7.41387 5.11514 0 0.306107 1.88356 2.11914 2.52932 2.59489
Blast
BLAST of TCONS_00000533 vs. Swiss-Prot (Human)
Match: LRC47 (Leucine-rich repeat-containing protein 47 OS=Homo sapiens GN=LRRC47 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.547e-43
Identity = 94/245 (38.37%), Postives = 140/245 (57.14%), Query Frame = 2
Query:   62 VKDVRPYLCCTVIKNLDLSDETVFKNFLSLQTKLHENECDMRTRATIATHNATGLKFPLVFKASHVGQTVIHALGKKKQCNATTLIQNLKDERDALKQKKKRQPKTGLYKFIELVDGQEMIASVRNQDGDVISLPPITNGEKTKIGASVGDVFIEISSPVSIAQCKYVMEELIKKMFQ----------QNFNSDMESD-----------------EG---LWIEPIRVVDENEDLRIVYPSKIDI 706
            V+DVRPY+   V++ +DL      K FL+ QTKLHE+ C+ RT AT+ATH    +K PL++ A       I  LG+K +  A  L++ L+ E +  +++KKRQ  +GL++++ L+DG E    + + DGDVIS PPITN EKTK+  +  D+F+E++S  S+  CK VM+ LI KM +          +   SD E+D                 +G   L +E +RVVD    L++VYPSK D+
Sbjct:  329 VRDVRPYIVGAVVRGMDLQPGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRK-EAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEKTKVKKTTSDLFLEVTSATSLQICKDVMDALILKMAEMKKYTLENKEEGSLSDTEADAVSGQLPDPTTNPSAGKDGPSLLVVEQVRVVDLEGSLKVVYPSKADL 572          
The following BLAST results are available for this feature:
BLAST of TCONS_00000533 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LRC471.547e-4338.37Leucine-rich repeat-containing protein 47 OS=Homo ... [more]
back to top