Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000519 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000519
Unique NameTCONS_00000519
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4364

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000519 ID=TCONS_00000519|Name=TCONS_00000519|organism=Clytia hemisphaerica|type=transcript|length=4364bp
TAGAAATGCGTGTGTGAGGACGGTTATTCGGGATACGATAAATGATATAT
AATTTTCATGTTATAATAGTTGTGGCTGCTGtcaattaaaatcttaaatg
gTAATTGCAATTGGTACTTGGCACTATCATGGAGTATCATTATGTCATCA
TTGTGTTACTTTCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAA
GTTAATTTCCTAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGA
ATTGACAAAACTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCAAA
ACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGATGACCAGGCC
ACCCTCGATAATTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCGA
AAACGTATTGAACGAAATGTCGAGTCACATTTTGGACGATTATAAAACGA
ACAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATGATTCA
AAACTGGGATTTGTTTCAGTCTTTGGTGAAAACGTTTCGATGAGCGACAT
TTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAA
GTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGAGGATTTGGTCACG
AAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCA
ATACGACTCTTTAGATGGTTATTCGTTCACTTATCCTGCTTATCAAGATC
CTTCACCAATGGAATGCACATGCGCACAAAGGGATCCCAGATTCAGTTCG
CGACTATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTAT
TCTGGATTATTCCGAAGAAATTAAAGATACAATCTCAATTGTGAAGAAAG
TTGCAAAGACATTGCTCAACCTTGTCACATTTAAAGATGAGATTTCAGTA
AAATTTTATCATGAGGATAATTTGGTACCATCGGACAATAAAGCAGATTG
TTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCC
aacaaattgaaaacaaacAGCCAAAAGGTGAAGCAGCTAGCTATAAGAAG
ATCTTTGAAGAAACTTTTCAGATACTATACAATGATAAGAATAATCAAAC
AGaaaaacattTCATCTTTGTGACAAGTGGATACTACAAGGATGGCAGTT
GGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGT
GGCGTTTCTTTTTCTCTTCTACTAATATATGATGGAAAACTAGCGGGAGC
AACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGg
gTCGTGACAACTTTATGGAATTTGAACTTGGAAAGGATAATAATCATTTT
ACCATCAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAA
CGACTTCGACGACAAAGTTCATTACATCATGCCTATATCTGATCGATTTG
GAAGAGGCACAACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCA
TCTTCACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAA
TGAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCC
TTATCAAAAGAAACGGTCAAACATTTATTCATCCGAAATTCGGACAACCG
CTTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTACAAATCGAATC
TTCACAAAGTTTCAAAGATGAAGTGTACAATGATATGATAAGCGGTGTTC
CTGGATCAAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCCT
TTTGGAGCCACTTCACAAAATAAAACATTGACTTATACTTGGAAAGCTGT
TCCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTGATTACGAAA
AATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCGC
CTTGATCTATGGAATTCCACATATTTAGATGATCATATTTGCAAATACAG
TGAAACACAGGTAGCAGTCAAAGACTTGGCAGTAATCAAATTTCCAGCAG
ATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAATGAGACG
GTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAACACCTCG
TGGCCTCTTCAAGAGTAtcgatgtttttaaaaatatacggTTATCGGCAC
AAGCTACAAAATCTATGGATCAATATTGGAAAAATGATACATCAGAGAAA
GCAATCAGTATCATCGCAAGGTACATTGGTATGGAGAATGGTTTCTTCCG
TATTTACCCTGGCTTACTGATGAATCCTTCATACGACCCAAGAGCTCGAC
CATGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACCACGCCC
TACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCCT
ACACATGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCGATGGATT
TCAAACTACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAATGAATGC
GAAACTGATGGAGCATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTA
CCAATCGAGTTTTAtggaaaagaatgaaaattcaaCCCTCGAAAATCAAC
ACATCATTAAGATGcatAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGa
gttatgataaaaaattattgtttgGAATTCCGAAACAATATAACCATCAA
GGAATGGTTTTACTCTcttgATCACGTGACCGAAGCGAAGAAATATGAAT
CGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCAAT
CTTTTATTATTGTATATTAATGACGCTTGCACTTTACCAGAAAATTGTAA
CTGTGAAGAACCAATCAACAACgaaagatTTGGGTATTGTTCGAACGATA
TCAGCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTC
AGTGATCTTCGAATTACCCCAGGCAGACTTGAATGCAACCCAGAGGACAA
ACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGC
TTACTCTCTGTTTTGACCCTGAATGCAAGAAACGCGACACATGGGATAAT
TGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGG
AACCCATGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAAT
GTTTTCCGACGCCATCACCACCCATCATAACGCCTGCACCACCCACAACA
CCTGACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGAT
TATACTATTTAGTATAATATTTGTATGCTCCATACTGGGTGGTATCTACT
GGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTAATAACAATAACAAC
GGGAATAATTCTAACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGA
TGATGACCAATATCAACCAGGATATCAACCATCAGGCCACGCACCAAACG
ATCGACTAGGATCAGTACCATCACCGACTGATACCAAAGATGCTGCAGTA
GAGATAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGG
TTCAGTTAGTACCACGGCTTAAACCATCGCATAGTatgtaaaaattaatt
tttctgagtactattcaataaacaAAGACTTAAAAGATTTCATTACATTA
AAAGGACATTTCacatcagacacatatttcatatcaggacagtgtctccc
tattgttttCTTATACTGATTTAagcaaaaagatgtttttcttttccttt
tttctgaccaatcttgctccatatCCGTGTCAATCCGATGTGATAAAGCT
TGTGAGTTGaagttgatgagtaagcaaacgatatcactcttatttgaaaa
caaaagactttttgaaatctgaataagTTTACTACGAGTATTATTAGCAA
AACGTTTTGCAGTTAGAAGTGtccaaaaatataattttatggTGTTGCAA
AACCGTAATCTGGAAACATTTTGGGATCCCTCTCCCTCCCTAGGCCCACT
TAATGCAAGTCAAAGTGACTCATAAAAAAGAGCTTTTttgaagaacaaat
tagtgggTTGCTTTGAAGGATCTTATATTACACGAAGCTGACATTTTGTA
CTTTCAAGATCCTGCagattctaatttattttttctcgACACATTGTAAA
TATCTAGCTATTTTATTGTATACACACCTTTCATTGTATATTTGGGATAg
aatttttcaaagtc
Run BLAST on NCBI

protein sequence of TCONS_00000519-protein

>TCONS_00000519-protein ID=TCONS_00000519-protein|Name=TCONS_00000519-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1197bp
MEYHYVIIVLLSFHWSNVNGQNNQVNFLDLLKDDAKTFQQELTKLVNENL
GHETLQQNLNDMSEDDATSFDDQATLDNFVKDLAGKTTIAENVLNEMSSH
ILDDYKTNNGDQRPIESCCQFDDSKLGFVSVFGENVSMSDICEQTPPSNS
KVCPSLGSPPSESIHYLKKEDLVTKCKDVYKEAKGEARNIQYDSLDGYSF
TYPAYQDPSPMECTCAQRDPRFSSRLLETLPGSEGRHFVIILDYSEEIKD
TISIVKKVAKTLLNLVTFKDEISVKFYHEDNLVPSDNKADCLKISSKATP
YLKDKILQQIENKQPKGEAASYKKIFEETFQILYNDKNNQTEKHFIFVTS
GYYKDGSWSEVEKGFKDGRKSLECGVSFSLLLIYDGKLAGATYSNNKNLA
GVGCDIEGRDNFMEFELGKDNNHFTINSKISAILSSAKNFNDFDDKVHYI
MPISDRFGRGTTIDACKAVVDKSSSSQNPMKGAVCLSFLTNEFIREEWSQ
TENSYWFLIKRNGQTFIHPKFGQPLGSDELSRTVNILQIESSQSFKDEVY
NDMISGVPGSKILSDVMMPISRGPFGATSQNKTLTYTWKAVPKSDFILTI
VTSSDYEKSELKITNQGGAEDYHRLDLWNSTYLDDHICKYSETQVAVKDL
AVIKFPADAFLRPSIYFKLETNETVQELKDLFMPGETATPRGLFKSIDVF
KNIRLSAQATKSMDQYWKNDTSEKAISIIARYIGMENGFFRIYPGLLMNP
SYDPRARPWYRLMIAQKGMTLTTPYLDAFTGETVMTLGQVLHMGKTSTEK
AGNIAMDFKLPYFKVLLDKSINECETDGACVVIDRNGFVVYQSSFMEKNE
NSTLENQHIIKMHSRVAKSMIEEGVMIKNYCLEFRNNITIKEWFYSLDHV
TEAKKYESNRNCLDYRVVPIVDSNLLLLYINDACTLPENCNCEEPINNER
FGYCSNDISETNCECPCIQPVTCLSDLRITPGRLECNPEDKRKTDFSEKW
FKGNISELTLCFDPECKKRDTWDNCESFKPACNWCFKFPNGTHVADEKKH
CDYSDEECFPTPSPPIITPAPPTTPDSQETEDLSDGAIAVIILFSIIFVC
SILGGIYWWFNKKAKRRQRNNNNNGNNSNTTLTPRANSGFDDDQYQPGYQ
PSGHAPNDRLGSVPSPTDTKDAAVEITMPAVYEERPADENGSVSTTA
Run BLAST on NCBI

transcript from alignment at sc0000002:268592..319544-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000519 ID=TCONS_00000519|Name=TCONS_00000519|organism=Clytia hemisphaerica|type=transcript|length=50953bp|location=Sequence derived from alignment at sc0000002:268592..319544- (Clytia hemisphaerica)
TAGAAATGCGTGTGTGAGGACGGTTATTCGGGATACGATAAATGATATAT AATTTTCATGTTATAATAGTTGTGGCTGCTGTCAATTAAAATCTTAAATG GTAATTGCAATTGGTACTTGGCACTATCATGGAGTATCATTATGTCATCA TTGTGTTACTTTCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAA GTTAATTTCCTAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGA ATTGACAAAACTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGGTAT AAATGTAATTTACAGTGGCGGTGAAAGGGTGTTTGTGGGCGCTTCAAAAT CCTTTAAGGGTACCAGTGAAGAATATGATTTGAAATCGCATAAAAGAAAT ATATTTTAAAATGCTCATTCTTTGCAGGAGAGAAACTCATCATACACATT TTTTCTTTATAAGAACAAACTATATAAGAACGTAAGGCTTCCATGGGTAA AATATCAAGAGCAAGTACACCCCTGTGTCACAAACCCACTGGGACCTCAG GCCCACTGGAAAATTTGGTCAAAATTTGGTCCCCGGTGGGAATAATCCTG GAATTTCAGCCCCACTCGGAAAATGACTTTGATTTCATCCCTATTCGGCA TTCAATGTTTTAAAATATTGTACTCCAAAACTATCCCCACTGGATTTTTT AACATTGGAACAATAGAATTTCTATCCCTATCAGGAATTCAATAGGAATG TTTATCCCCACTGAGGAAAAAGGTTCCAGTGGGGCTGTGAGACAGGGGTG TGCAAGTTAAGCACATTTTAAGGCTTTGTAGTCTCTAAAACACCTGATTT TTTAGGAAGATGGACTAAAATCCTCTCAATTTGGTTAAGATAAGATTATG TTAAGAACATTTTAGGTTTAAAACTCAGAAAGTTAAGGCTTCAAAAAAAT TTGGATGTCCTTTAATAAAGATATTTTATAGTCATTCTTTGCTATCTTCA TATGTATGTTTTTTCAGCAAAACCTTAATGATATGTCTGAAGATGATGCA ACTAGCTTTGATGACCAGGCCACCCTCGATAATGTAAGTCGACTCTCGTG TTATATCGTCCGTAACCTAAATCCATTCGCTTCAAGTATGTAGTTTTCCT TCCCCCCATTTTGAAACCAGAGTCGACTTAAGTCGACTTGAAATGACATT GAAACTGTGCCTTTTTAATTTATTTCGTGTATCTGTTGCATGCTACCCTA TTCAATTTACAAGGGAAAAAATGCACAAATATGTGAAGATTTCCTTCGAG GTTGAATAAAATGATTCAATTGACTTCCAAATTCAACAAAAACTCTTTTC TATTGCTGCTGCCTTTTTGTAAAACCTATATCTCAATTCGCAAAAGTGTT CAACCATAAAAAGTTGATGACTGCAGTGACGTAGAAAAAAATCATGTACG AAAAACACGAATTCTATGAAATAGGGTATTGAAAATATGAAAAGGAGATT ATCGACCCGAAATTTATAGAATCAAATTATTGTCTCACGAATTTCAGTTT GTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAAAACGTATTGAACGA AATGTCGAGTCACATTTTGGACGATTATAAAACGAACAACGGTGATCAAA GACCCATCGAAAGTTGTTGTCAATTTGATGATTCAAAACTGGGATTTGTT TCAGTCTTTGGTGAAAACGTATTCAGATAATTTTCATTTAACTTTTCATA AAAGTTTTAGATTTTTTGATTTTTTTTGAAGATAGGCCCCCAAGCGGTTT GCATGATGTCATGATAGGGACTTTTTTCTAGCGTGATTACGTGATTTGGA ATTTTTTTTCATGATAGCGTGATCAGAGGTCAAAGCGTGATCGTGATTTG ATTGAAAATTTTTTGTGCCTTTATATGAGATTTGGACTATTTCAAAGGGA TGTGTGATTATCTAATATTTTTTGCTGATTTGCTCGATCGTAATAGACGA TATCGCGTTTAGATAAATGCAATGCATTCTGGTTTCTCGGGGACCCTGAA GGGAATTATAATCTATTCCAGATCATTATATAATCGACATTATAATTTCT TTGAGAGTCCCCGAGAAACCAGAATGCATTGCATTTATTTAAACGCGATA TCGTCTATTGAAAACAAAAGTTTGCGTGATATCGTGATGGGAATCGTGAT CAGTGTTACCACTGGGGGGCGGGGGCTCTTTGAAGAATATGAGAATTTTC CTTTTGCACTCCTCCACATCTATTATTTCTTGCTTGGTGTCATTTATTGC TAAAAGAAATCCCTTTCTTGACAGGTTTCGATGAGCGACATTTGTGAGCA AACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCAT CAGAATCCATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAG GATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTC TTTAGATGGTTATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAA TGGAATGCACATGCGCACAAAGGGATCCCAGATTCAGGTTTGATAATCTT TTTTTTCAACTCAATTTTAAGCCATACAACGTGTTTTTGTAATGGTATAG TGAAGTCTCTATAACTCAAACACTCGCCAGAGAACACAAGTTTGTTCAAG CGAAGTGGTGCAGTGGTAGAGCATCCTGCTACGGTACGCAAAGTTGTGGG TTCAACCTCTAGCGGGGTCATACCAAAGATTTCCAAAATGGTACTTGATG TTTCTCTGCTTGATGCTCAGTAATTAAGAGAAGGAGCGAGGGTAAGTGGA GTAACCCAGGGAGAAAGAGTGGCACCCTCCCCTACCTTCGGGTAGATAGC TATCGAAAGAGGAGCCTTTGGATCGCCTACGACTGCGATCGCAGCCTTAC TTTCTTGTTCGAGTTAAAGAGACATTTGAATTATAGAGGTTCGATTTATT ATGAAAACTCAACTATAGTAAAAATAAAGGCTCAGATTTCGAAAAACACG GATTTAAAGACGCTTTAAAAACTCTTAGATGAATAAAGAAGATCTTTGGG ATATCTTCGAAGTCGCTCAGACAAAGCTCGGTAAAAGAATCGGTACATTT TTTTTTCAAATCATTTTCTTCATACAGTTCGCGATTGGCAGAAACTTTAG CAGGTAACAAAGGTAGACATTTTTTGATTGTTCTCGATTACTCAGAGAAA ATTCAAAACACCATTGCCATCATGAGGAAAGTTGCAACGACATTGCTTAA ACTGGTTACTTCCAAAGATATGGTATGATACATTATTTATTTAATGTCAG GGATTTTTCAATTTTTCAAAGTACCTCATTACACGAATACTAGGTAAGTA TTGAAATTTGGACGATCTGAAATAAACTTTTTCAAGGAAACATCGGCTGG TTTTAATCAAGGGGGTTTTTATTAATACGAAATTTTTCAATTCGTGTTAA TAAAATGACTAGTTATATTCGTGTAATAAGGTAGCTTTGAATACACCTTT TTTATAAGTTTTTAGAGCCTGGAAATATTTTTGAGATGTTCTTATTTACA GNGGCGCTAACCACCTTAGTCATTATATTTTTGCTGGCCCCCTCACTTTC AAAATCGTGGCTCGGGCCCTGGATACAAGAGTGGGGGGAGATATCCCTGA CTCTGTGGTGTGGTTGCTAATACTTGTCAGGTTCGACCATGTGAGGATAC ACTGTCCTCCTGAGCTGTTCGAGTATAGTAACTATACGCCAGCAGCTCTG TGTGTCGCGAGCACGATTCAGGTAAGCGCAGTGATTTTTCCATCCTAGAA TAGTAAATGCTACCTTTGATAAGGTCTGTTGCGTTCATCAGAAGGACTAT ATCCTATCCACAAAAAGGAAGTCACTGTTCAACCCCGGGGGTAATAATGT CCCCTTTTCTTTACCCCCTAACTAGACAGTCCTTTGGGTGAGTGAGACAG GAGTGTGCACTACATACTATAATTTTCTTCATACAGTTCACGATTGGCAG AAACTTTAGCAGGCAACGAAGGCAGACATTTTGTGATTGTGCTCGATTAT TCCGAGAAAATTCAAAACACAATTGACATCATGAGGAAAGTTGCAACGAC ATTGTTTAAACTTTTTACATCCAAAGATATGGTAAATTGCTAAATGCTAA TTTTGTTGAATTTCACAATGACTAATTTCAAAACATTCATTCATATGCCA TTCATATATTCCTGATTATAAAAAAAATTCTGGCGTTACCATTCCGGCGG TTTCAGAAGTTTTTCTGTCAACGCCCCTGTGTCACAGACCCGCTAGGACC CCAGCTCTGTCCCCGGTGGGAAAATACCCTGTAATTTCAGCCTCTCTTGG AAATCGACTTTGATTTGATCTCCATTCGAAATTCAAATCAAATTGCACTC CAAAACCATCCCCACCTTGGAACAATAGAATTTTTATCTCCACATTGGGA TTTCAATAGGAATTTTTATCCCCACTGAAGGAAAAAGCTCCACTGGGCGT CTGTCAGTTTTCTTTCATTTTCTCTTATCATCACTGTGTACCAAGTTTCA AGTATCAGTCAGAAAAAATATCAGTCAAATCGAACAATTCAAACAGTTAA TTTACGGTTTTGGTCAAGTTTACATTCTGGTCTGTAAAATGCCAACCACA TAGATGGCTGAACCAAAATTTTGTCAATTATCCATATCTACTTCAAGATC ATGGCACTTTTCAACCTTCTTTAAGACTGAGATTTTAAGGGAGTGTTACT AATAATATTACCATATAGCCAGGCCACTAAAGTCTATCGAATCAGCCATA AGTAGACATTGCGCTAAATCTGACCCTGAGATATTTCCACAAGGAATGTT GCCATAGATTCTGCCCATTTTCATCTTTATAGATTTCAGTGAAATTTTAT CACGAGGATAATTTGGTACCAGCGGACAAAACAGCAGATTGTTTGAAAAT TTCATCACAAGCTACTCCTTATATCAAAGATAAAATTCTCGGAGAGATTG AGACTAAACAGCCAAAAGGTAAGGAAAATAATTATTGATGAACTGGCTTG TGGCAGCCAAGCGTTCATAGCTTCGTTACTTTTTGATCCTTCGATGTCGG CTCTTCCTATCATCGTGAAGCAGAAAATATTGTAAACTTATTTTCAAGGG AAATGTGCTCTCAAGTATCTAAAGGATGGGTGATCTGCTAAATGTGAAAT GCTAAAAAAAAAGTCTTTAGCTGAAGACTGGAGTTAGAATGGATGTGATT TGGTTGGAAAGGAATTTTCAAAACAAATAATAGGATAAGTTATTTTCAAA AACCTCTTCTACTCTGACACCACTAATACAAAATTTCTTATCCTTGCAGG AGACGCAGCAAGCTATTCCAAGGTTTTCCGCGAATCTTTTACTGCTCTCA AGAATGATAACAGCAATCAAACTGGTAGGTGAATTAGTATATGGTCTTCA AGACTAACTGATGTAAAACTTTTTTCTAAAATTGAAGGTTCTTAATAAAT TCTTCGCATGTGCTGGTTTGATCTTTTTTAGAGAAACATTTCATCTTTGT CACAAGTGGTCATTACATTGATAATTGGTCAGAGATTGACCAAGTCTTCA AAGAAAGGAGAAAAACGAATTCAGAATGCAATGATATGTACTTTTCGTTG TTATTAATAAATGGTAAGTCACTTTAAATCAGGCACATGCGCAGTAGTTT CGCTCAATATTTTTTGGTACAATTACTTTGACAGGTAAAGCTGGAACTCA CCACAAATCATCTTTGGACAAAACAAGAATTTGAGAATCTGATTTACGCT GTCAATTCGGCAAAACTAGTTTTCGTCAAAATCTAAAATTTGGTCACTTA AATTAGGCTTTCACCAAATTTAGCTTTTTAAGTATTTTTGCTACTCACCA AAATTAGTTTACAAAGGACACCCAAACAACTAAAGTTCCATATTACCATT TTCCAAAATCAAGCTATATACTTTATGATTTTTCTGTGACTTTGTTCGCC TATTATTTATTTTATAATTTTAAAATATAATTTTAGATGGCAAACTACCA AAAGCTAATTTCGTCAAAAATAAGAACCTCAAAGAGGGTTGTAATGTAAG TCATGTTTAAATCTGGATCTGGAAGTTTGTGATCTAATTCTTTCTTAAAT CAAATTCTATTGTCTAGAAATAATACTCCAATTCTTGCACCTGAGTAGAT CAAGTCAGTCCCAGTTAAAGGCATTCACCTTGCAATCCAAGCTAGGGTTA TTAATTTATCATTGGTTCAAGTCACCACAAGTTTAGCTAAAAATCTCGAT GTTGCAATCAAATAAGATAGGGTTCCCGGCAAACTCTACTAACCTAATAA AGTTTTATTTTCTATAGGACAATTTTATTGATTTTGAGCTTAGTGGAGAC AACAATCATTTTACAATCAATTCCAAGATATCTGAAATTCTACCCTCTGG AAGAAATATCGACGATAAAGTTTATTACATCATGCCTATATCTGATCGAT TTGGTAGAGGTATTTACAATAGAATCTAGTGTTGACCAGTAGCGTGTTGG TAGGGGGTCAGGGGCAGTGGCGTGGTGGGAAAATTTCTCTGGGGTGGCCA AGGCAAATATGGCGCCCTTTTTAAAGATTTTTTGTTTTTGGCGCCCCTCT ACGCTCATTATGAACACAAAAAAGGGAGTGTGTGAGCGAAGCGAGCCAGA AAATTTTGAGTTTTTGAGGTAATGAGGGCGCCATTTTTGTTTTCTCTGTC AATCTTTCTATATGGGCGCCTGAAAAATCCTTCTTGGCGTCCCTTATTTT TGGGCGCCCCTTCTCAAAAGGGCTCCGCTGGGGGGGGGGGGGCCCGGCCC CCCCCGCCCCCCCCCCCCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCCTTATTT TTGGGCGCCCCTTCTCAAAAGGGCTCCGCTGGGGGGGCCTGGCCCCCCTG GCCCCCCCTGCCACCACGCCACTGGTCAGGGGGCTGTTTGTTCAGGGGTT GGCAAAAGACAAGGGGTGCAAAAGTCGCCTCTGATTACTAATTTCGTTAC CCCTTTACCTTTTCACACCTAGGAACTAGCAGTTTCAGGTAAAGATATAA AAAAAGTCAAACATTTTCGTACACGCTTCGCTCGTGTGTATTTACTTACG TATTTTACAACGATATTTACTTTTGATAGGGGAAGCCAAAATCACAACTT TGGAAATTGCCTCCTCAATTATGCTCAATTTTAGTCGACCCACCACGATA CTGGTGCTACCCCCCCCCTCTCCTAGTGTATATTGTACTATAACTTCCTT TCCGGTTCTAACGTTGGACTTTTTCAGAAGAAAACAGTATACCCCTGTTG TGGAAGTCCAAATTCCCACCGAATTCTAGCTGGAATTAATTCAATTCCAA TTTGTTCCAACTTTAGGCACAACGATTGATGCATGTAAAGCAGTGGTGGA TAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGTTGTTTGTCTTTCTT TCTTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCT TATTGGTTCCTTATAAAGAGAAACGGTGAGATTGACATGAGAAAAAAAAG AAGAAAAAAAAGAGAAATGAGATTGACATGCAGTCCCGAAAAAAGGATTC AATAAATTTTGTCAACTAATCTAGACTCGATGTCTAAATTTAGTTATACC CATATTTAGTTATAAAGCTTACTTGAAGTTCAGATTCCTTCTTTNGTAGA CAAAATTGTTTACATTAAAAAGATATGCCAGTTATCTTGCAGTTGTAACA GCAATATCGTGTAGAAGGATGGGAAGTCATGACGTAACGTGGTAACAGTA GCAGTAAACGAGGTAACATTGCGTTGTCAAGGTAAACGAATCCTCATTCA TAAAAAGCTTAAAGGAAAAATAAGAAACATGAAATTAGATGATATGGCGG TCATCGAAAAAATGCGTTCTCTGTTCGCGTCGCAACGGGTGTTAAAAATT CATGCGGGCAGACGGGCGGTCGAAAACATTCCCGGGTTTTTTTTAATCAC GCCAATAACTCAGGGGCGGGTGGTAACGCGAGCAAAACAATTNGACTAAA TTTTGTCAACTAATCTAAACTCGATGTCTAAATTTAGTTATACCCATATT TAGTTACTAGCCATAGCTTTCACTAACTGACACCCGCTAGTACAAATGCT TGTAAAAACTAATTAATGCTAATTAAGGCTTTTTAATGCTTTATAGCAAA AGTTTGGAATGATTTGGAATAGTTAGAATGATTCTTCTCAGCATTTTCTT TGAGATATCAATGAATAAGCTAACATAAACGAAACATATTTTTTTTTCTA AAAATGTGAATTACTTTTTACAAAGAATAAAATACGAATCTTAAAACATT AATTAGGAAAAGTGTCCAGGTATAATCAATTACAGACAGTTACAGATACT AAACCAGTCAAAAGACATGCAACTATTATTTATTTCAACCAATTTGAAAT ATAAATGAAACATAGTAGAACCAAACANNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAAGAAAAAGTT TTTAGGCTAGCAACTGCCGTCCCGGAAAAAAACCGAACATTTACGGAAGA GACTAACTACGGGTAGGCTTGCGCGACAAAACAAAACAAAACACGCAAAG ATTCGAGATTCCAGTCCAATATCTATGCGTGAAACTATGAGTGCCTCCTC GTCGCTGCGCTCCTGTGGGGGCAATGAAACTATGAGTGCCTCCTCGTCGC TGCGCTCCTGTGGGGGCAATAAAGCTTACTTGAAGTTCAGATTCCTTCTT TTTTTTATTCACACGATTCTAAATTTTTTTTTCTCGAATTTTTTACTTTT TATTTCTACACAGGCCAAACATTCATACACCCGAAATTCGGACAACCACT TGGATCAGATGAACTTTCTCGGACAGTTAGTATTTTACAAACCGAATCTT CACAAAGTTTCAAAGATGAAGTTTACAATAATATGATAAGGTAAACCTTT CTTTTAAGACTCTTTTTTGTATTTTATTTATCCATGACATAATCATCATA TCGCCACAAATTTAATTTGGTCGTAGAATATTAAAAAATAACCGTATGAG AGCGATGTTTGATTAAAAAGACTATTTATATGGGGGGATTCGAAATCTAC CAATTTACCAGAAAATATCTTGAGATCTAAATCGTATTGCTCTACCACTA GCGGCGTTCCCGGGTCAAAGACATTATCACACGTAATGAAACCAATATCT CGAGGGCCTTTTGGAGCAACCTCACAAAACAAAACATTGACTTATACTTG GAAAGCTGTTCCAAAGTCTGACTTCATTATGACCATTGTGACGTCATCTG ATTACGAAAAGTCCGAACTCAAAATCACCAATCAAGGAGGGAAAGAAAAT TACCATCGCATTGACTTGATTCCAGATAATTACGCGAATGATTTGTGCAA ATACAGTAGTGAACATGTTGCTACAAAAGGTACTTCTTTTTTCCTGCCGC TGTTGGCATATGCCGACAAAATCATTTTCGATTTCTTTGCCGGTATCGGC ATTTGCCGACAAGAGTGATCTGGACCTGTTGCCAGTAGACTCTCTCTAGC TCGGAAAATCTAAATCTTAAAAATCTAAAAATCAAGGCTCTAATTTACTT TTAGAATATAGAGTTTTAACATTAGACTTAAAACCTTACGACCTTAGGTT CCCAGGATCCCCAAAAGTTCAGAAATTGTTCACATGAGGCTTAGATCATA GCTTAGGAACCATCGAATCCCTCTAAAATTGAAATATCAAATGAAATAAA GTGAAGTTACTGAAATCGAAATTCTCGCATGAACTTTAAGTTCTGTAGAA AACTATCACTATATTTTGAACTTTCAATGTAGCTATAATTTCTACTCTTT TTCAAATTTTATTTATTTTATTTATGTGGAACGACATCAAATTTCTTCCA AAGTTTCATCAAAAGGGTCTCTAGAGAATCGATGACAAGGTTCTATGAAA AATTGACTTTTAATGTGTTAGAAAGATGATTTCGAAAGAGGGTTGTTCTC CCAAATGTTTAAATAGAGAGTTTATGTATTTGTGTTTTTCTGCGAGGGAG ATGGTTAGCTTCTGATTTGACTAGCTCCTGATCAATTTATTTTTGATTTA TTTTTGATTTATTTTTGATTTATTTTTGATTTATTTTTGATTTATTTTTG ATTTATTTTTGATTCATTTTTGATTTATTTTTGATTTATTTATGATTTAT TTATGATTTATTTTTGATTTATTTTTGATTTATTTTTGATTTATTTTTGA TTTATTTATGATTTATTTATGATTTATTTTTGATTTATTTATGGTTTATT TTTGATTTATTTATGATTTATTTCTGATTTATTTTTGATTTATTTTTGAT TTATAAAATTGTGTACGAGATTTATTTCAGTGATCCTCGATTTTTTCGGG TCAGAACTTCAGTCACTCTGCCGTCCTCAAAAGTGTAAATACATAAACTC GCTGATATTTGAGTGAATGGTATTTACACTTTTGAGGACGACAGAGTGAC TGAAGTTCTGACCCGCAAAAATCGAGGACAGTAAAAGAATGTAAACTAGC TGATACTTGAGTGAATGACATGAATATGAAACTCTCATTTTTTCCAGATC TTTCGGTTATCAAATTCCCAGCAGATGCTTTTCAACGACCAAGTTTTTAC TTCAAACTTGAAACTAATGAAACTGTAAAAGAATTGAATGATTTGTTTAC ACCTGGGAACACGGCAACCCCTCCTGATGAATTGTTCAAGGTTTGATAAC ATATATTTTCTTTATTCGCACCTGAAGGGGATTAATTTTCGCAAGAAAAA ATCTTAGTACTCGCGAAAATTTTGATAACACTGCTTTTAGAAAAATGAAA GAAATTAGTTGAAAAAGGGGGAGATTCGCGAAAATAAATGAAACTATTTT TGAAATAATGGTCTCACGAAATATGCGCTCGCGAAAGTTTAAGGTCATAA ATGTTTGATTCATCATTTTTTCAATACGGGCTTTGCCTTTTTTCAACCCC GGCTCCCGGGAGCTGGCAGGCTCTGAAAAACCTTTTTTCATTTCTGTTGA CTATGTCTTAAATTATAATGTTTTACAACTTTTTTTTCGACAGGACATGG ATGTGTTCAACCATCTTCGTCAGTCAGTGCAAGCTACACATTTGATGGAG GGATATTGGAAAAATGACACATCTGAAGCTGCAAAGAACACGTTAACAAG GTTCTTATATTTGATATAGTGACCAGGTAGCTCAGTCAGTAAAGTATTCG ACTCACAATCCAAGAGTTGTGGGTTCGATTCCCGGTCCACCAACTCAGTG AATGAGTAGCTTAGATTGGGTAATCCGATCTAAGCGGAAAGTTGCTGAGA GATGAATATAGGTGTTTTACCTCAGCATTCAATTTCCCGGGTGTAGCCCA AATAGAAAAGGGAAAAGACTTCCTCACTCCCGGCTCTGCCGGCAGCCACC AGATGAATATACTTATTTACTCTATTTGATTTATATGATATAATTTAGTC GTAAGTGACAAGGCGAGATTACATTGAAATTCCACTGAGTTATACATTTT CGAGATAGGGGTATAAACGGGAAATCTTTGGCTTTGGGTCCTATCATTGT AACGTTCAATGGCCAAAAATTTAGCTGTTTATACCCGTCATTTTCACCTC TAGATACATTGGTATGCATAATGGCTTCTTTCGAACGTTTCCTGGACATT TGATGAATCCTTCATACGATCCAAGAGCTCGACCATGGTGACAAATTTAC TCTTTATTCAGCTTAGTCTCAATCAAATCGAACTTAGTTTTATAGATGGA AATGAGTTTATATTTAATGTGGAAAGCTAAGTCATCTTGTAGATTGCGTC TCTTGATTGCCAACTGGATCAGCTATTTTTCCCTATATGGGGTGGGGATT TGTTTAAGGAAACCCTCGTTTGTGACGCTGTTGTCTTACAGCTCAGCCAG CAAAAAAAGAAACAAGAAAAAACTTAATTTGATCATCAACCCCTGTAAAT CAAGGTCTTTCTAACTGCGTATCTTTAAATGATATTCTATTCATCTAGGT ATCGATTGATGATTGCACAAAAAGGAATAACTTTAACAACACCCTATCCA GATGCCTTTACCGGTGAAATTGTCATGACGCTAGGGAAAGTTCTACTGAA GTAAGCAATATCATTCAAGGTTTGCTCCAATTCCTCTAGAACTTATAATT GTGCTAATTTCACTTAAATGTTCGAGTTGAACACAATTCTCAATCAAAGG TCATCAAAACATGCAATAAATTTTTTGTATCATTACGTCAGTTTTCTCAC ATCAATAAGTTTGAATCAATCTTTGCCAATGATCTCTATATGACGTTTTC AAGCTTCAAGCTATTTGACCAAGACTTTATTTAACACAATCACTTTATCT TTACTTCTGATGTTAAAGAGGAAAGAAGTCAGTAGAAAAAGCAGGGAACA TTGCTATGGATTTCAAACCACTCTACTTCAAAGAGTTACTAGAAAGATCG ATCAAAGAGTGTGCATCTGGGTAAGTGCTGGCTTAGTATTTTTATTCACT TTTTGATCATTATAAAGTCAAATATCCTTAGCTATTCTCTGTGGCCGTGG TGCAAAGTTAGACCATCCGGATACGGTATGCAAGGACGTCGAGAGTAAGA GTAAATTCTATCGTGGGTTCAATCCCCAGCCGGGTCCTACCAAAGACTTC GTACTTGACTTGCAGTTCAGCAATTAAGAGAAAGATCAAGGGTAATTAGA GCAATCCAGGAAGAAAGAGTGGTGCCCTCCTTTACCTTCGAGTAGACAGA TATTATGAAAAGGGAGCCTTCGGGTTGCCTCGACTGCGGTCGCAGGCTTA CTTACTTATCCTATTTAGCTCACGACCAAACTTTACCAATGATAACGGTG GACATAAACTTGCTCTTTTTCCAAGAAATCTATCCTAAGCAACCTGGCAG CATCTCAAAGTAAACTCAATTTAGAGACAACCGTTTAAGTTTTTCAGACT TGAGAACTTTAATATTTCTTTTACAGAGCATGTGTTGTGATTGATCGAAA CGGCTTCGTAGTTTATCAATCGAGTTTTATGGAAGAGAATGAAAATTCAA CCCTCGAAAATCAACACATCGTGAAGATGGTAAGTCACAGAAAGAATTGC TTGTTTAAACCTTAACAATGCCTACATAAAACAAAAGGTTTTGAAAGGGA CTTATTTTGCGAAAAAAATTTCTAATATTAGTACTATCGTTCAACTATCT TAACATTAAAAACCATCGAGCTACCAGGTGGGGTACTAGTGTTGGCGGAT GAGGGGTATGTGTTGGCGGGACCTCCGAAAACCGACCCTTAGAATGATTT TTACTGAAAAGTTGACCCTTAGAGAGACTTTTTTGAAAAATTTTCTTCCA CTTTTGAAAAAAGTCCTACCCTTAGAGAGACTTTTTTACAATTTTTTCTC TCAAAACCAAAAAAATTTCCTAGAAATTGTGAATTTTCATACCCTTAGAG AGACTGATTTTTCCGACCCTTAGAGGACTTTGAATATTGAAAAAACCGAC TCTTACCTGGGACTCGTGGAGGTGAAAAAAGGTACCTTTACCAGCGACTC TAAATACTCTTAACTCCACGGAAAGGTAGTACCCTAGCCTCAACGTTCAA CGGGGCCATTATCTCCTTCCTCTTGGACGATGAAGAGGGAAAAAATCATG AATTTGTAAATTAGATTATTTTATGAACTGTATATGGTATGTACACCAGA AAGCGTCAAGAAAAATAAGAATTGTTTCATGAATTTTCCCGGGGGGAGGA GATATTTGGGCAAAAGCAGTGCGGGGATGTGTCGCTGGTTAAGGTACCTT TTTTCGCCTCCATTAGTCCCAGGTAGGGTTGCAAAAACACCGAAATAGAC AAATCAGTCCCTCGTAGGGTACCTTTTTGGGGGAAATTGGAAAAATATAG AAATTTTTGAGAGCATTTTGGAATTTCAGTCCCATTCAGGGTCACTTTTT CATAAAAACGAGTTCCACGTAGGGTCCATTTCTCGAACTTCAGCGGCACA ACCCCGTCGGTTAGGCCAAAAAATTAAGAAAATGCTTAAGAATATCACCA TCATGAAATTTGGCAACATAACCTAAGAATGCCATTTTTAGAGTATATTT AACTGTAAATTTCCAGTTTCACAAAAATGTCATTTAATTAATCGGAATTG TATTCGTGCTCAATTTAGGTAGATTTTTTATCCTAACCTAAGAATACCGA AAAAAGTTAAGAACATCCATGATGAAATGGAAATCCATTGCATTATTATA AAAATAGTGTATATTTCTGGAGAATATCTCCGAAGAAATGTACCATCAGG AATAATTTTCTGAGAGGTTATCGTCCAGAGGGGCATGTCTGCAGGAATGA TTTTTTTGTCCAATCTTAAGACAGTAATTTTTTCATTTTAGCATGGTAGA CTCGCAAAGACGATGATTGAGAATGGAGTTATGATAAAAAATTATTGTTT GGAATTCCGAAACAATGTAACCGTAAAAGAATGGTTTTACTCTGTAAGTT TCAAAAACCAACTCAATTAAGAAAATCGTCTACTTAAGTTTAGCTTTATG ATTAAAATATGATTTCTGATTTCTACGTACCGCGCTCTACCTAAAGAGAT ATTGTGAATGTGACGATCTGACCTGGTTGTTCAACCAAAACATTCGAAAC CGCGTTTGCCTTTTACTTGGAAATGCATGCGAACAGGAAAGCGACTGGGT ACTTATGTATATTGTTTATGTATTTGATTGACAGTTGATTTTGGTGCGAT GGTTTTGCTTTAGCCAATCACTGTGCTGAAAAGCTCATTTAAAATCGAAA TCTGAATGAAAAAGATCAAATCCGTGCGACAACCTGAGCAGATTATCTTA CGGAGCGATGGCCTTTAGAGTGAATGCGTGCCATGCGTGGAGTATCAGAA TCTGCTCGGAGATTAGTTGTAATCTATTTATCACTTTTCTTCATCTTTTT CAGCTTGACCACGTGATAGAAGCGAAATCGTATAGCAAGGGGTGTTTGAA GGATTATCATGTTGTGCCGATTATCGATTCCAATCTTTTATTGTTGTATA TTAATGATCGATGTGATGTTAAAGAGAAATGTACTTGCAGAGAACCGATA AACGGGGTAATTGTCAATGTCGAACAAAATATCACATATGTTTTAGTATG GGAAGCAGTTTGTGATTTACATTCTTTCAAACAACATTCATTTTCAATTA ATTTCCGCCGGGGAAAAATCAATTTTTCGGTTTAACATTTAAAGTCTAAA ACTTGCGGCGATCTCCAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCC CCCCCCCCCGAGGGTATTTAACCAGGTTGGTCAATGTGTTTAGATTGCAG TAAAATTTCTGTAAATAATCTTTTCCATTATCTTTATTAAGGATTCTGCA TTTTTTGTATGTCTGAAATAATTATGTTGAGTAATATTAGATGATTTGTG GTAGAATAAAAAGGTTTTTCAACCTATGTAGACGAAAACCTGGCAAAGTC CAAGAACTTATTTTTATGGATTGGTGAAATGAGTAGCTCGTGTAACAAGG AGCTTTCAACTAATGATTATAGTAGGGTTGAAAGCGTCAAAGGGGTTGCC TTGGTAACTCAAACTTCCATCTCTGTATTTTCTTTAAGAAACATTTTTCC TTAGATAATGAGTATCTCAATCAAGAAGTCAATGTTGCTTGCCAATATAA AGAATGGCTGAAAGAAGTATTTGTGGAATTTGATAATCATTCATTTTCTA TTCTTAGAAATTAAGAAAGGGAACTCATTTAGTAGTTTAGTGATTAAAGT ATGATGGTATTAAGGTACCAGCAGTTTGGAGTTCGGTTTGCATTCGAGTA AGTATGAAGCAGTAGTCTTTTTTTTAATTACTTTTGGTGTTGAAAATGAA TAGATAAACCAAAAAAGTCAAGGTTCCTAAATTAGCAATTTGGTACCGAT AGTTACTTGTTTACCTTTTTACTGACCGACGCGCAACATATTACGTTTTA TAATATACAACTATGTTATATCATAATATCATAATAATATATTACAAACG GACGATAGCCTCGTCTTGCTCCACTTTTTACTGGTACCGTAGCAGAATAG AAGAACACGAACCAAGGGGTTTGGGTACAAGCTTGAAAAATGAGGTGAAA GTTTATTTACACCCCTGTCTCCCAGCACTGGTGGAACTTTTTCTAACAGT GAAGGATAAATATTTCCATCTATTGTATTCTATTCTATTAAATTTCGAAT GGGGATGAAATCAAAGTCAATTTTCCATAGGGGGTTGAAATTTAGGGTAT TTTTCCTAACGGGAACGAAATTTCGGCCAAATTTTCTAGTTGGGCTTGGG TTCCGGTGGGTCTACAGAGTTATTAGTTTAATGATGACGTCTGTTATTTT TACGTTTCCAATGGGGTTTAGTATCATAGAAAAGTTCTCCATCTTGATTT CTAAACAAAGCTACTATCATTCGAGATCATCGTTTCTCAAAGGTGGGGAC GATTTCGTTGTAGTATGAGAATATCAAACTGTAAGATCATATCATAGGCC CCATGGAGCCGTTTGAAGTAAGATGGCCAAACTTTTGAGATCAGGGTTGA GCGACGAAGAAATCTTTCACTTTTACGACTTCTCAACACCATTTTCCTAA GAATTCAGGTGTTTTAGAGTCCGCAAAATATTCTTCACTTGTTCTTAATT TTTGGCCATCAAAACCTTTTGTTCTTATATAGTTTATTCTTATAAAAAAC GTACATCTAATCTGACAAAAAGATTTTTTGACTTTTTTTTGAAGGGAAGA AATACTAATCAATTAAACTTATTTGTTTATTTTTAGTCAAAAATGTCAAC GTGTAATGACCCTTTAATATGCTTGTTTTAATTTCTAAAATATTTGGCCA TACATTTAAAGAATAATTGACATCATTATGAATATTCAACTTGCCTTGAT AATAACATATATGAAAGTTGTAAAAATCATGTAGAGATAAAATAATAAGC GAGACTTAAAAGGGATTTTAAAGTTGTTGTTTTTTCACATAGCTATCCTA GTCTTTTGTTTTCTCAACTTATTACCTTTAGGGTTTTATTTAGCTAAAGC ATCAGAACCTGAAAGTACGAATAAACGAATTGATTTAAGTCCAATTGGTC TCATTTTTCCAGCTGAGATAATCTTTTTGAGCCTATTATAGCCTGTTTAA AGACAATTTCAAAAAGGCTTTTTACTTTCAGTGATTGAGTTTATATTCTC TAAGACTTTATTAATTCCTTGGAGGATTGGGGAAACTCAGATCGACTTTA CAAAAGATAATATTCATCAGTAATAATCATCGTTGTTGCGATTTTATTTT GATTTAGAGGATGGTCTTTTAGGAGGACTGGACATAATGTAATACAGTTG ACACTCTCTAATTTGATTTTCGTAGGGAATTGATTTTCATCAAATAAGGG AGCATATCAAATAGTAGAGCGTTGTTTATGAGAGTTTATCGTTGACAGTG GCTTTCAATATTATCGAATAATGGAGTCTATCGAATAATAGAGCGTCTAA TAAGAGAGCGTCAACTGTAAAGGCCTACTTTGAGGCTAGAAATTATATCC ATTTTACAACACTTAATTACTAGGTTTTCTTATTGTTCTGACTGTTTCAA AGCATGCCAGCTTTGCAATGTCATTATTGACGCATTAAACAAATCGTTTC TGATTTATCCATGTTAAACCGCAAATCTTGAGAAAAGCTTCAGAAAATTG TTGATTGTTGTAATTATTGTAGAAAACTTCAGAGCTGTACCATTATGAAT TACTACGTCATCATTGTGTTATCTTTATTTCATTGGTCACACGTGGGTGG TGATCCTATCTTAAATCGATTGAAAGATGGCTCCAAAGATTTTCAACAAG AATTGACAAAACTGGTCAATGAGAATCTTGGCTATAAAACTTTACAGGTA TATATTGTCTTTAAAATTTAAGCTTCTACAAATTCAAATGACTGAGAAAT AGGTCTTGTCACTTAGATTTGGGTAACTGACATATTGTTGAACCATAAAC TTGTTCGTGTACTTGGTTAAAGAGATATTTGGGTTTATTCAAGGATTATT GGGCCATTTCATTTATATTCATACATGGGGATGGACAAACATTCCCAGGG AGGGGGAGCAGAATTTCCAGGGGTCTAAAAGAGTGTTTTCTCATTTTTCA AAATTTCCAAGAGGTAAAAGGCTGATTTTTGTTCGTCCACTGACCCTTTA AGATATAGAAAGAAGTTTCGCAAGGGTTTTTCGACTTGAAAAGGTTCGTC CACCCCGGTATGGAAATTCAATGGAATGATCGATTATCGCTATATTATAG TCCTTGATCTCTTTCAAATTATAGGATAAATTCCATAAAATGTCTCAAAA AGAAGACCCCTTAACACTTGACGCACAACAAACTGTTGATGATGTGAGTA TGGTATTTCGAAATTTTTGGCTTTGCTAACGTTATTTACTTTTGTTTGAG AAAGATTGCTCCTGTTATACGTATCTATCTATTAAGACCATGTTCTAGTG ACCAAAATTACAGCCCTATGTCACAGCCCCACTGGGAAGTTTGACAAAAA TTTCGTCCCCGGTGGGAAAAATGCCCTAGAATTTCAGCCCTACTGAGAAA TTGACTTTGATTTTATTCCCATTCGAAATTCATTGTTTAGAAATTGCAAC TCCAAAACCATTCCCACTAGATTTCTTAACCTTGGAACAATACAATTTTT ATCCCCACTGAGATTTCAATCGAAATTTTTATTCCCGCTGTAAGACTAGC CGTATTGTATAAGGGTTGCGAAGCGATCCAGACTCCACCTCAATTCGCAA ATTGCTAGCAAAATAAGAGACTCTCTAAAAATCCCTCTTCTAATAAAAGC GCTACAGGGTCGTAAGAGCCTTAATGCCCCAAACACACCACATAATCCAC GGCGGCACAACACCCGCCGCTGCCCGCGCATCGCTCTTTTGTTTTCCTTC TAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNCTAGTTATTCTAGTGTAAATGGTGCCTTAATAAAATCGAACG ATATTCGTCGAACGATCGAACATTTTTATTCGAATCACGAATCGTCTGTC GAAATCATCAGAAAACATAAAAGTAAAACAAAAACAAAAATGTACAAAGA TGGCTTGTTGGTTCTTCAAATTCGACAAATTTGATTACCTCCGTACTTCT TTATCATAGAATATCCACTTGGTTTTGCAAGGTAAAGTTTCGTTCACTAA AAGAGCACTCCTCCCGCCCGCGCGACTTGCAAAAACTCTCATTGATTGAC CTTATTTGATACTTGATACTTGCTGTTAAAAGTCAAGGGATGACGAAGAT CCTTTCCGTCACCGTTCAACTATTTTTTTTCCATTTTAACAGCAAAATAA ACATTAAAAACCGAAGAACCACTGCTTAGATTGCTTAGATGCGTGCCGCC CGCGCGGTAATTTGATCAACTCCAGACAGTCAAGAACACCTTCAAATTAG CCTATCATAGGCTGATTAGCCTATCATAGGCTATTTAGACTATTTTATAT AGGCTATTTAGCCGAAATCGATAAAAACCTCGATTTCTAACGAAATATAA ATAGTCGCGTCTATTTTTCACCATTACTTCATTGCCCAAAGCCAAAAGAA TCTTTTTCACTTAAACTGATATGACATTCAATTTTGGAAACAGAAATATA TAAATAAATCTATTTTTATAGGCTAATTTTCTTATAATGAAGTGCCGTGT GCAAAAATACATGTTTGTTTTTTCTTTTTTTTTTTTTTTAAAAAAATTTA TTTTATCCAAGACTTTGAGCGAAAAACAGCAATAGCCGAAAACGTATTGA ACAAAATGGCGAGTCACATTTTGGATGATTACAAAACGAAAAACGGTGAT CAAAGACCCGTCGAAAGTTGTTGTCAGTTTGATGATTTAAAACTTGATTT TGATCCCATTTTTGGTGAAAAGGTATCTCTTAACTTTGGGCTTGTTATTG ATAAATTTATTATGAATAATCCAGTCATTTTGATTCCAACCCAACATCAC AACTGTAGAACATGACCATACTAGCAGTAGCATGGTAACTTATCTTCTCC AATTTTGGCGCACCTTAGTAAAGATAGTAGCGAATTAAAAATACCTGGAC GCGTTTTGCGTTTTTGGTAATTTCTTTATTTTTGGGGCACCAAAATTGGT GATTGGATGAAATCTCCGCGTTCTTTAACATCTCCAAATAACTGAGTTTA TGTATATGTTTTTTTCTGCGACAGAGGCGGTAAGGTTCTAATTAATCTGC ATCCTAACTGACTGAGAACGACGGGAAATCAACACTTTTATCCGTCCTCG ATTTTTTAGCTTATAACTGGGGGTTTTTCCAAATCACTTGAGACACTTCA CTGCCCTCAAAAATGCAAATACATAAACTCGCTAAAATCAATGCTAAGAG AATTATTGACTNATTCTAAGTCCGTGTTTCGGCTTCCGGTAATTTTGTTG CTGTTCACTGCTAGGGTACACCATTTTAAAAAGGCATTTTTTGCAGTCCT AGCTATCAAACCGAGAAAATTTGCGTGGCTTCAAGCCAAATCATTCAAGG TCATTTTGATAAAATCATCGGTTGGAAGATGTGATTTATATAGCAAATTT TATAGCAAATTTTCGCTTGGGATAGAAGTTAAAGGTACGTGCACAATATA GCAAAACTGCTTCGCTCATAAATTCGCTTCGCAAAAAGTTTCACCGGGGC TGTGAGACAGGGGTGTAAAATTGTTACAAATCCCAGCTGGCACACAACGT TTTTTCGACGTTTATCTAACGTTCACAACGTCCATATAAGGTTAGGTGAA CGTTGAAATAACGTTGTGTGCCAGGAGATGAGATTAGCTCCAAACTTATT TACTGAATGATTTAATTTTTTTTTTTTCAAATAATTTAGTTTATCCAAGA CTTTGAGCGAAAAACAGCAATAGCCGAAAACGTATTGAACAAAATGGCGA GTCACATTTTGGATGATTACAAAACGAAAAACGGTGATCAAAGACCCGTC GAAAGTTGTTGTCAGTTTGATGATTTAAAACTTGATTTTGATCCCATTTT TGGTGAAAAGGTATCTCTTAACTTTGGGCTTGTTATTGATAAATTTATTA TGAATAATCCAGTCATTTTGATTCCAACCCAACATCACAACTGTAGAACA TGACCATACTAGCAGTAGCATGGTAACTTATCTTCTCCAATTTTGGCGCA CCTTAGTAAAGATAGTAGCGAATTAAAAATACCTGGACGCGTTTTGCGTT TTTGGTAATTTCTTTATTTTTGGGGCACCAAAATTGGTGATTGGATGAAA TCTCCGCGTTCTTTAACATCTCCAAATAACTGAGTTTATGTATATGTTTT TTTCTGCGACAGAGGCGGTAAGGTTCTAATTAATCTGCATCCTAACTGAC TGAGAACGACGGGAAATCAACACTTTTATCCGTCCTCGATTTTTTAGCTT ATAACTGGGGGTTTTTCCAAATCACTTGAGACACTTCACTGCCCTCAAAA ATGCAAATACATAAACTCGCTAAAATCAATGCTAAGAGAATTATTGACTG TCGCAACTTCACTATATACACCCTCCCCATATATCTAAACGATATTCCCA AAGGTTTCAATGGAAGACATTTGCGAGCAAACACCTCCAAGCAATTCGAA AGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAA AGAAAGAGGATTTGGTCACAAAATGCAAGGATGTTTATAAAGAAGCCAAA GGCGAAGCAAGGAACATTCAATACGACTCTTTAGACGGTTATTCGTTCAC TTATCCTGCTTATCAAGATCCTTCACAAATGGAATGCACATGCGCACAAA GGGATCCCAGATTCAGGTTTGATAGTTTTTTTTTTCATGATGGTACAAAA AAAAGCAAAAGCTGTAAACGAACAGAATTGCTTACGTCAGCAAATATTTT TTAGTAACAGGAATACGTTAGTGGAGCCAGTAGCCTAAGTTCGATTGAGG TCCTATGGTATAGTGATGTAACCACCAGGGATGTATTATAATAATTAAAA AAATTAATTAATTTATTAATTGATTTATCTTCAAGTTCGCGACTATTGGA AACGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATT CCGAAGAAATTAAAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACA TTGCTCAACCTTGTCACATTTAAAGATGAGGTGATTTTCTTTCTTATGAC TCAGGAGACTTCTAAAACTTTAAAGACTAAGGGGGGGGGTACTTAGGCAA ACTGGATGCGAGCCATAAGGGTCCCTTTTTCACACCCTCGAAACTCTTTC AAAGGGGTGCAAAAATCCTCCTCTCTCAAAGGGTCTTGATTTTCTAAAAT TTGGATAAAAATCGATTGAAAATTGACAAAGATTTTGAAAAAAGTCCTCT CTAAGGGTCCCAAAACACAAATTTTTCCNACACCCTCGAAACTCTCTCAA AGGGGTGCAAAAATCCTCCTCTCTCAAAGGGTCTTGATTTTCTAAAATTT GGATAAAAATCGATTGAAAATTGACAAAGATTTTGAAAAAAGTCTCTCTA AGGGTCCCAAAACACAAATTTTTCCTCTCTTTAAGGGTCGACATACCCGT CACCTTGCAAACCTAGTACCCCTCAGGCTAGTCGTCAAAGACCAATTGAT TAAAATTTCCAACTCTATCGTTTATAGAAATCTTGTACCAAAGTCACTAA CATCACCTTTTTATTTTACTGATTTTGGTAGGATCTGTGTTTAATTTTTC ATCTTTATAGATTTCAGTAAAATTTTATCATGAGGATAATTTGGTACCAT CGGACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTAT CTCAAAGATAAAATTCTCCAACAAATTGAAAACAAACAGCCAAAAGGTAG GAAAGAGAAGATCTTAACAAATTAAGGAAATCTGGTAAAATTAAATCTTT TTAGAAATAAGTTGTCCGGAAAACACCGACCAAATTTAAAAATGCGAAAA ACTGACCATAGTTTATAAAGGTCACTATATCTTCCCTGAAATCCCCTGGA CATCAGGAATCGCACTTAAAGCCACAGATTTTCTTAACCGAAGTTTTACT CTCTCATTTTTTCAAGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGA AACTTTTCAGATACTATACAATGATAAGAATAATCAAACAGGTCAGTTAT TAGACGATCCTCTCGTCTACATAAGGTCAAAAAGGTTATAGTTTAGAGGA GACGAGATAATTTTGAAAAGCAGCGACAAGCACGTGGCAGATTAAGAAGT GGTAGAAGTGTTTACTGGTGTATTCTTTCCAAACTCTACCACCACTATTT TTCCCCGTAAACTTCCCTGACGCCCTGACGCCCTGACTTTGCACATATTT TGTTGGAATCAATGTTGTTGAAAATTTCCAGGGTTTTTAATCCTTGGTTC TCTGTAGATAAGAATAATTTTTGTCTCTATATCCCCTCGTCTCATTGATC GGTGAAAGATGATTAGTAAGCGGGGATAAAAAAAGATTCTGGGGAATTTG CCTTCTAGGAAAACTTTATCCCTGGAAATTTTCATGTCACCGGAGATAAA TTCTAAAGAAGGTTGAAAATGTATTTCTTCTAAAAGATCAATTAGGATTC TCAGAAAATTTTCCCAGATGAAAGGGGAATTAAAGCTTCACAACAGAGAT AAAAGTTTGCAGCTTTTGATATTTTTTGGATAACTTTCCCAGTGGGTAAT AGGGTCTCATCGGTTCTATGTTAGAGACAGACCAGGTACTTCGGAATTAT TGAAATCTTTGTGAATACAACCATAATGAATGAGAGGTACTTCTCATCCT TTTTTTTCAGAAAAACATTTCATCTTTGTGACAAGTGGATACTACAAGGA TGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTT TGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGTAAGCTTTAT AGGGCAGAGTAAATACACGCTTTTTTAGAAGAATGGTGTATATCCATTCC ATCGTGGATATTCTTAACTTTTTTTGGGGAAATCGTCCTAAAATATTCTT ACAGCATTCTTAGGTTAGGATCCAATTCAGACTAGCTTGAGTAGCAAAAT TCCATGATGGTGATAATATTCTTAGTCTTGTATTCTTAGTCTTTTTAGCC ATTTTCATCATATTTCTTATAAAGTGTATTCTTATAAAAAAGCGTGTAGA TACTATTTTCCTTCGTTACACTATGAACTATAAAATCAATAGTCACAGGA AAAAATTAGCAGATCACAAGTTTGTGAAACGTTGTTTCCGGCCCTTAAAA ATCGGATTTTCAAAATTTAGTTTGTGAAATAAAGTTTGGGATATTGTGAA CATTGGGTTTTATTATTTCACATTGAGACTTTCTTTTCACAAGGTCATCG TGAATTTGATTTTCACAATGACAAAATTAATTTTCACAAGCTTAAGAAAA ATAGGTTGTAAAATTCAATTTCACAAGTTTGTTAATTTTATATATCATAA CTTGGGATATTGATTGACAATCACAATGTAAAATAGTATTGGTAATAACC ATTCTGATACCAAGTTTGGGAAAGTCAATTTCCGACCCCAAAAACATTTT CTTTGGTCTGATTGGGATTTTGCAAATGCTGGGTATGTTTTATTCTTTGC TAAGGCAAATTTGTGAATTTAGTATTTGCAATGTAAAAATTGTTTTCACA AGTTTCAAAAGTAAGCTTGTTAAATTCCATTTCACAAGGTTAAGTTAATT GTGGTTACCATAGATTGGGATGTTGAGAATAACAATACAAACTAGCACAA ATTCACTAGTTGATACCAAATTCGGAAAAACTCGTTTCCGTATCTCTCCT ATCGTCTAATCTGGGAGTTTGTTAATCCCAAATGTTTTACGAACTTATAA TGACTTTTACAATGAAAAAATATACATATGTACAATGAAGAAAAATGATA AAAAATGTTCTTAACCTGTTATTTATAGTCGTGTAAGATTTTAGAATTTG GGAAACAGCCAAAATATATTTATTTTTTACTGTACAAAGATTTAGGTGCT CATTTTTGATTTTATACAATATTTGTAATATTTTCAGATGGAAAACTAGC GGGAGCAACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATA TAGAGGTGGGTCTGTGTACTAATAATATGTTCCTTTTTTCCAAACAATAC ATCAATTTCTGAAAACTTAAAATGTTGAAGCAGCAAATATGTAAAACAGC AAAAATGAATGCAATTTCTGAAAATAATATTTCACCCCTGTCTCAGTGAC AGTGTCTGTAAAACCCCCTGGTGGATTTCATTAATACAAAATATCTACTG AGCCTGGATTGCTTGTTTTCGAGCTGCCTTCGAGGTAATGAAGTGAATAA ATAAGCGATAATTGTTGCATTAACCTTCAATTTCATTTTTCTAGGGTCGT GACAACTTTATGGAATTTGAACTTGGAAAGGATAATAATCATTTTACCAT CAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACT TCGACGACAAAGTTCATTACATCATGCCTATATCTGATCGATTTGGAAGA GGTATTTGCAAAATAGTTTAAAGTTTTTTAAAGGATTGTGATCCAAGAGA CACTTAATGAATCCATTTGATTTCCACCCACGAAAAAAAGGAGCAACTAG AGCCCAGAACTAGACTAAAATGATCTAAAAATCGAAAGTTTCTGATCTCA AAGGGCCATGGTTTTCTTAAATTTGGACCAAAGTTTTATAAAAATCCCTT GCAACTGTTCTAAGAGTTTTTTCTCTCCAAGGTAAAGTCAATTTTTGTTA TTTCGAACCGCAAATTTTAACCCTATTTGCGAAAATTAGTCCTCGCAAAA TATTTAAAATCAGGACTTCGGCCAAAACCCCTAGGAAAATGAAAGAAATT GGCAGAATAAGTGGTCGATTCGCGAAATTTTGTCCACACAAGAATTTTGG ATTTTCAATCAGCGAAAAACATTCCGCACGAAAATTAATCTATTAAGGTA CTACCTACTGTTAGTTTTTCAAAATCTTGTTCCAATCATATTGAAAGTAA CTTCCAATATGAATATCACTGGGTCGATAAACGCAAACTTATTAATTTCG CCTTAGCGAAAGTATTACAATGAAATTGAAATCAAGTCAATAACTCTTGA TAGACGGTGATATACTTTTTGGTGATTAGTTCTTACAAAGTAAACAAAGG ATGACGAAAAAGATGAGCATATTCATTTTTCTTATAAGCATTTACTTTAT AAGAATCAAGTCAATAACTCTTGATAGACAGCCATATACATTTCGGTAAT TAGGTCTTACAAAGTAAACAAGGGATGGCGTGCAATATGAGCATATTTAT TTTTATAAGCATATAATTTATAAGAGTTCTTAAAAATTAAACAGTAATTG TTGTTAAATTGGTTTTATTTTTTTAGCGTTTTTAAGCCTCGGTGTTCTTG GAAAATTGTTTCATCAAGGCCCGATGTAGACAGGAACCCGTCTGCGTATT TTTTTAAATCTGATGAATACTTGACGGGTCAGAGCTGTGAGTCCGATTTT GGCCTCAAAAAAATTACAGTGGGAAATTCAAACTGTCAGCCCATACCATG CTATATATTTCGCCATCAGTATATAGAATAAGAAATCATAGCATGGATCT CCAGGCTAGGCCCGATGTAAAGTAGATTTCAGATTAGCTTCAATCTCTAC TTCTTGTTTTCCCCATGTAGCTAAAATTTTAGGCGAAACTTTCGACTTCA AGTCGTCTTGTTTAGATTAATCTTGTTTCAATCTTAGGCACAACCATTGA CGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGA AAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAA TGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGCGA GGCTTACTTTAAAATCCTCTGCTTTGACAATAAATACTCATAGTAGTTTG TATTTTTACAGGACTGGTGCATACATTAGTTTCAGGCCCCTTATTTTCAT ACAGTCTCCATACACGCATGTGCATTTGATTCGTGTAAACTCTAAAGACG TTAATCTCACTTAAGAGATGTAAAAAGCAGTTAATGCACACAGAACTGGA AAACCAGGATTATTCCCCAGAAATTTCCCTACATTAATTTAATTGTTATC GAAATAAAATTGAAGCATCTAATATATTTATCACAGGTCAAACATTTATT CATCCGAAATTCGGACAACCGCTTGGATCAGATGAACTTTCTCGGACAGT TAATATTTTACAAATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACA ATGATATGATAAGGTAATGTAATTCTAGAATCAAATTATCTATACTCCTG GTTTCAGCGGTATACATTTCATGGAATAAATAGCTTTCACTCGAACTAAA TAAGAAACTGTTGCAAGATGTAAACCTTGTGGAACCTTGCTCAAAACTTT TAAGAAAATAAGGGCTTCGATATTTAATTGTTTTGATCGTTTATAAAGGG TTATCTATGATGAATCTTCCAAACCAATATTTTCAATCACATTTAGCGGT GTTCCTGGATCAAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGG GCCTTTTGGAGCCACTTCACAAAATAAAACATTGACTTATACTTGGAAAG CTGTTCCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTGATTAC GAAAAATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCA TCGCCTTGATCTATGGAATTCCACATATTTAGATGATCATATTTGCAAAT ACAGTGAAACACAGGTAGCAGTCAAAGGTACGTAATGTTTCCAATGTAAA TATATAAAGAACAAGAAGCCGGAGCGGCGTGAAGGTCCAACTGACGTGGC AATAACCGAATGTCGCTCGTGCCGGGTTCCTTAAGTGACGCAAAAAAATT TCCTTCCCATCCTCCACTCTGAGCTTCTATTCTTTAACACTTTCTTTGTA TAGCTAATTTATGAGAAATTTGATACATTTCTCGAAATTTCGAAACTTTT GCCGCTGATGGGATTCGAACCCATTAGCACAAAGCACTTTTGATTAGAAC GCCAGCGCCTTAACCACTCGGCCATCGAGTCACAACTACATTAAGGAGTT CAAAGTTCCTTATAAACATGGTATTTACTCCAAACTTTACCCGGGGGCTA AAACCCTAACCAGGGGTTAACTCCCATCCCAACCCTAGCCCTAACCCTAC CTGAAACAACCCTTTAATCTAACCAGGAAATTTGACTCTACTACCAATTC AATCCAAAACATAGGTCAAACATCGCGCGGGTATGCGGGGCAAAAATTCT AGATCAGCGGTTGGTTTAGCCTGGACTTNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGACTTGT TAATTTATTGCGCGCACAGGCCCCGACAAAGACAAAATCTTTTCGATCAG TTGCTTTTTAAAGGTCCATTCTGCTGCACGCTGGACCAATTACATATTGT ACAAGTCGCTGTATCTGTTGAGCGATCGTCGCACATCGAATTCTGTAATT CCAAAGGACTCTTTTGATGAGGACTTTTGTTCCTTGAGCTCAAACTTTGA CCCTAACTGATGATAACCCGTGACCTTTAAACGATCCGCCAATGAGAAAC AAATAAGATAACTTTTTGTGATCCCATATAGTAGAAGAGTTTTATGGCTT TTATTAACACTGTAATAATTTCCATAATGCACCCCTGTCTCACAGCCCCG GTGGAACTTTTTTCCTTAGTGAAGATAAAGATTCCAATTGAAATGCTGGG GTCCCAGGGTCTGTGATACAGGGTTGGCATAATATAATAAAGACACTCTC GCGTTACTTTCTTATTAACTCATTTACATCTTCTTAAATGTTATGCTTAA GTCTGTTTATTGAAGATAATTTATATAGCTACTACAGAGCCTTTACATAG TTATTTCTTAATCTTTTCAGACTTGGCAGTAATCAAATTTCCAGCAGATG CTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAATGAGACGGTT CAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTGG CCTCTTCAAGGTATTCTTAAAGTTTTGGATTCAGCTAGACTAGAGTCCAA CCTCGTGTTCATGTATCCCAGGCTTTATTTACACTACTGATGGACGCCAG ATTATTCTGGGAACGAGGTTGACAAGAGTCTACATCTGACTGAACTTTAC TTTCTTATGATTTTGATGGTCTAAGTCTAGTGAAGTAGACTAGGGAAAAT TGCCATATTGGAATGTCGGAATGTTCATTTATATAAAAAACTCAGGTAAG TTATGCTATGTCTCAAAAACATGAAAAAATTAGCATAATTTTTGGAAAGC ATTCCACCGGGAAAAATGAGCAAACCAATGATTTAATACGAAACAATTAG GTAACACTCTTACAGGGAAACTTCATCATGGTGAGAACCCAAAAATAATC AGATAATTTATTCTATTCATTTTCTTTATAGAGTATCGATGTTTTTAAAA ATATACGGTTATCGGCACAAGCTACAAAATCTATGGATCAATATTGGAAA AATGATACATCAGAGAAAGCAATCAGTATCATCGCAAGGTAAACTCTCTT AATTTCCCATTGGAATTGGAAGTATTTATACCTTGTCCACAAGAATTTCT ACATGCCTTATTAGCACACCCCCTTCTCACAGACCCACTGGGACCCCTTT CGACTGGAAAAACTTGCCAAAATATCTTCCCCAGTGGAAAATTATACTCC ATTTGTGTCCCCACTGAAGGTAATAAAATAAACCAATCCCCACTGTAAAT TATCACGCTATTTTTACCCAACCCAACTGAATTTTCTGACTTTAAAACAA TGGAATTTGAATTCCAAGCATTGAAAACGTGGGGATATCAATCTTCATCG AGATTAAGTCTGTTAATTTTACCCCCACTGGCTGAAAAAATCCTACCGGG TCTGTGAGAAGGGGGTGTATTAGCGGACTACCTACCTTATAATTTACCTT ATTCACGTATTGCGTTCTGGACGAGATGTCACTTAATCTAAGTTAGTTAA GTTTGTTACCCCTCGTAATTGATTACAAACAAAAGGAACAATCTTTGGAT CAAACCAACCTCGCTCCCTGCGTATTATCAGCTTTTTAGGGCTTACTGAT AGCACCAGATAACACCCTGACATTGACTGAAAACAAACTGTTTATTTTGT AGGTACATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACT GATGAATCCTTCATACGACCCAAGAGCTCGACCATGGTAATCTCTCCCGG CATACCCATTTACATTTACGAGATTGCTAAATCCTTTGAAAGGCCTTGTT GTATGTTGGGTCGCACTGATGCTATACTTTAATCTTTTGATCCTGCCCGG ATAAAAAAATCAATGACATTTCTTTTAATCTTTAGAATTTTGAAGCTATG TTGGAATGACATTTAAAAGGATAAATGCTCTCATAAAAATATTTGATATT ATTCTTATCTTCCAAGGTACCGCCTCATGATTGCTCAAAAAGGGATGACA TTAACCACGCCCTACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCT TGGACAAGTCCTACACATGTAGGTATAGTTAGTCGGATAGTATTATATGT GACTAATATTATATAATAATTATGGGTTCTATAGAAGCCACCAGACCTGC AGTCAATTAGAAATATTTATTTAGTCAAGCTAAATTTCAAAAACAATGAT TTAAAAGAAAGGCTTTAAGACCAATATAGAATCGGGTGGTCTTGCAACAT TGAGTCAACACATAATCTCTTTTCCAATTATCAGGGGCAAGACTTCGACA GAGAAAGCAGGGAATATAGCGATGGATTTCAAACTACCCTACTTTAAAGT GTTACTGGATAAGTCAATCAATGAATGCGAAACTGATGGGTAGGTTGTTC TCTAATTTTCCTATATCCAAACATACATTATTTCACAAGTTTTCTATGCA GTTAAAATTAAATTTTGACTATTCCAGAAAAAGGTTCCCATGTTAAAGGA CATTGGCTGCCCTTAAAACACAAGCAAGAAAACTTATTTAAGGAGAGTCA CTGTATTCTCAGGGCGTTTATGACAAAAATCTAGGAATGTCTCCAAATTT TGAAAGGAAATCCAAAACGGATAACTTTTCTTAGACCAGCCAACCATTAG AGCTTATCAGATTTGAGAACTACGTTTTTACTACAGAGCATGTGTTGTGA TTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAAT GAAAATTCAACCCTCGAAAATCAACACATCATTAAGATGGTAGGTCATAG AAAGATTTCTTGTTCAACCTAACAATACTTTTTTTGGCTCTCGCCTAAAT TCTCACTCCAAATATTTTCGATTTTTAAACGACGGTTGGCTTTTACCTGT CAGAGATAGAGACCAGGTTGAGAAATTTTAAAACCTAAGACACCCCTGTG TCACAGACCCGGTGGGACGTCCGTCCTATTGGAAGATTTGTCTGACATCT CTCCCAGGTGGGAAGATTACCCTAAAATTTCAGCCGACTGCAGAATCGAC TTTGATTTCATCCCCATTTGAAATTAAAAAAAATCAAAAAATTGTATTTC ATTTTTTTGAAATGGGAGCAAGAGAATTTCTATCCCCATTAGGATTTCGA AAAAATATCATCCCCAGTGTGGAAAGAAGTTCCACCGGAACTGTGAGGCA GGGGTGTCCTAAGGTGTCGGTGATGATGTCACTAATTTCGCCGTTTTTTG ATTTTTAGCATAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATG ATAAAAAATTATTGTTTGGAATTCCGAAACAATATAACCATCAAGGAATG GTTTTACTCTGTAAGTAATGAGTATTTTACTGTTTGATAAAAATTCTAAA AATTTATCGAGGTTCCACTGCATTATGCATTATTTGAAATTAAACTAATC TTAATGGCAATAGGCCTTTTCATAAATTACGTCACGAACATCACTTGCCT CGTATTCAAACAATTACCATGGTGATTATGTCCCCTGAGACATTAAATCG TTTTTTTATGAATAGGAAGTAGTTTTAAGAAGATCCGTTGGGATTTAATC ACCATGGCAATAATTTCAAAACGAGGCAAGTGATGTTCGTGACGTAATTT ATGAAAAGGTCTATTTGACTTGTTTCGCTCTCAGGGTTTGCTCCATTTCA AGCCATTAAAGGCCTTCGTCAAGTTTATTAGGAAATTTTAATTTTTATTG ACAGGTTTTTATTAACACTAAACTTTATTAGTGATAAAAACATGTTCAAC CTCGTCCCCTAGCCTGTACCAAACTCTTCTTCGCTGACTGAAAGGATAAC TGGAAATTCGACACACGATAAGTTTTTTCAAAATATCAAAAAACGCCTAT AGGAGGGATGGTACAGGCTACCTCTCCCCTTGCCTAATCTTTTTTTTTTT TTCAGCTTGATCACGTGACCGAAGCGAAGAAATATGAATCGAATCGAAAT TGTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATT GTATATTAATGACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAAC CAATCAACAACGTAAAGAAAATTCTCAAACTTGCACGTTTTTTTTGAGAA ACTAGTTTTATACCAATCAGCCTCAATGTTTTTTAAGAAATCGGCCTTTT GAGCCTTAAATGTTTCTTACATGTTTCTAAACTTTTTGACATGATCAGCC TCGTGGAAGGCTGGATTGGAAGGTTCTTAAAAAAAAACGAATTAAAAATT TTTATTTTCTCATTCTCAGCCTCAGCATATTTCTGAGATGTTTCTTAGTT TTTAGGCATTCTGAGCCTCGTGTTTCTTAAAAGTGTGTTTCTTAAAAAAA AAAAAGTGTATTTCAAAATAAAGTGGAGGCTTTTCAACTATATAACTCGA ATGTTTCTTTAACTCGAACAAAATTTGTGTTCCCCGTGCATGCTCGAGTT ATGGAGACTCCACTGTATATTCCAAAAGTTTTGACCTTCAAAACATATCA TTACGTATGGTTAAAAATGCAAAAAGCGCACCTGAGAAACTAATTTCGTT GGTTTCGTTGTACGGAATACAGGTGGTCGAAATCATTTAAAAGCGAATTC TACTATTTTCAATTTTTCAGGAAAGATTTGGGTATTGTTCGAACGATATC AGCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTCAG TGATCTTCGAATTACGTAAGTCTTTAAAGTTTTGGAGAAAGTTTTTGCCA AGCTTCGTTAGATTTCTTGGATGGTTTCTTTGTATCAAAAATACATCTTC ATTGTACCTCCTAGAATTTTTTACTATTTTTCATAGCCCAGGCAGACTTG AATGCAACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTC AAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAA ACGGTGAGTGTCGACGTGTCGACCAGATTCGTGGTTGGTGTAGAAAAAGT ACTGAGAAGTAGGAAGAATCATCCTAATTCTATCTTTTTTTTTTTATTCT TAATTTTCAATTGTCATTTTTGAATTTTTAAACAATGCTTTAAAGTTCAA GTCAATTCACTAATGAAATCTGACGTTTTGTTTTTGTATTGCGTAATTTT ACGTAGAAATCAGACATTACATGTCAGGGTATTATCTGGCGCTCTGGAGC ATCGAAAAGCTGATAACATGCAAGGAATACGAGGTTGCCCCTGGTGTTCA AGGTGGTCTGGATAATAAATCTTATAATAGAGTAAAGTCTCAGTAAAATG AGGTTGAAAATCTAGGATGATCAGTAAATTGAGGTCAAAAATCTAGGGTG GTCCAAAAAATGAGGGGTTCTGAACAATTGAAATAAAACCCAGGGGGGGG GTAAACTTTCCAAAAAAAAGACCTCCTCAAAAAGGGTACAATTTTCTTTC TAGAATAGCCCTATTCTCTTTATAATGAGGTATAACATTTGATAATATGT TTTCATATAAAGAACAAGTTTCAATTTTTTTGATACTGATCTTGAGCATT ATTTTACTAACACTTTCACCTACCTCATAAACTTAGGAATAGCTTAAGAA TCACACAAACATAAAAGCAAGGGCTACAACGAGTGGAAGCTTTTAACCAG AATAAGAACATTTTTTTATGCTTTGACATTTCTCAAACAAAACCTGTGGT AGTGAAAGACCAATACAAAAAACGTTAGAGAATATAAAACAAGTTTGGCC CCCTACTATTTACAGTTGAAGAGAAAGAAAGTCAGGGGAAAGTAAACAAA ACTTATATTCCCGACAGTCAAGATTTTTAACGCTGTATGCTATAATTACT TCTTGCTGATCAATGGTACATCCCCTTCTCACAGACCCGGTAGAATCTTT CAGCCAGTGGGGTGAAAATAACGGACCAAAACGTGATGGAGATTGATATT TCCATGTTTTGAAAGGCTGGGGATTTGACGAAATCAATTGTTTTTGAACC ATAAAATTCAGCGGAGATTGAAAAAAATAGCACAGCTTTTTGTAGTGAGA ATCGGATTATATGGTGACAAAAAATGATTTATAATTTTTCAATGGAGCCG ATATTTTGGTCAATTTTTCCAGTGGGAAGGATTCACAGNTCTTAGTGGTG ACAAAAATTGATTTATAATTTTTCAATGGAGCCGATATTTTGGTCAATTT TTCCAGTGGGAAGGGTTCACAGTGTTTCGTGTGATTTTTCTGTTTACCCT TAAAAATGATAATCATGCATTACAGGGTAGTCATTCAAGACTACATTTTG TTGATATACCATTTACTTTTCAGCGACACATGGGATAATTGTGAAAGTTT CAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTG CCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGACG CCATCACCACCCATCATAACGCCTGCACCACCCACAACACCTGACTCGCA AGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGATTATACTATTTA GTATAATATTTGTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAAT AAAAAAGCTAAACGAAGACAACGTAATAACAATAACAACGGGAATAATTC TAACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAAT ATCAACCAGGATATCAACCATCAGGCCACGCACCAAACGATCGACTAGGA TCAGTACCATCACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAAT GCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTA CCACGGCTTAAACCATCGCATAGTATGTAAAAATTAATTTTTCTGAGTAC TATTCAATAAACAAAGACTTAAAAGATTTCATTACATTAAAAGGACATTT CACATCAGACACATATTTCATATCAGGACAGTGTCTCCCTATTGTTTTCT TATACTGATTTAAGCAAAAAGATGTTTTTCTTTTCCTTTTTTCTGACCAA TCTTGCTCCATATCCGTGTCAATCCGATGTGATAAAGCTTGTGAGTTGAA GTTGATGAGTAAGCAAACGATATCACTCTTATTTGAAAACAAAAGACTTT TTGAAATCTGAATAAGTTTACTACGAGTATTATTAGCAAAACGTTTTGCA GTTAGAAGTGTCCAAAAATATAATTTTATGGTGTTGCAAAACCGTAATCT GGAAACATTTTGGGATCCCTCTCCCTCCCTAGGCCCACTTAATGCAAGTC AAAGTGACTCATAAAAAAGAGCTTTTTTGAAGAACAAATTAGTGGGTTGC TTTGAAGGATCTTATATTACACGAAGCTGACATTTTGTACTTTCAAGATC CTGCAGATTCTAATTTATTTTTTCTCGACACATTGTAAATATCTAGCTAT TTTATTGTATACACACCTTTCATTGTATATTTGGGATAGAATTTTTCAAA GTC

Coding sequence (CDS) from alignment at sc0000002:268592..319544-

>TCONS_00000519 ID=TCONS_00000519|Name=TCONS_00000519|organism=Clytia hemisphaerica|type=CDS|length=86256bp|location=Sequence derived from alignment at sc0000002:268592..319544- (Clytia hemisphaerica)
CGACACATGGGATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTT
TCAAATTCCCAAATGGAACCCATGTTGCCGACGAGAAAAAGCATTGTGAT
TATTCTGACGAAGAATGTTTTCCGACGCCATCACCACCCATCATAACGCC
TGCACCACCCACAACACCTGACTCGCAAGAAACTGAGGACCTATCAGATG
GTGCTATTGCTGTGATTATACTATTTAGTATAATATTTGTATGCTCCATA
CTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGACAACG
TAATAACAATAACAACGGGAATAATTCTAACACAACACTTACTCCTCGAG
CCAACAGTGGTTTTGATGATGACCAATATCAACCAGGATATCAACCATCA
GGCCACGCACCAAACGATCGACTAGGATCAGTACCATCACCGACTGATAC
CAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAGAGAC
CTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAACCCAGGCAGACT
TGAATGCAACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGT
TCAAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAG
AAACGGAAAGATTTGGGTATTGTTCGAACGATATCAGCGAAACAAATTGT
GAATGTCCTTGCATACAACCCGTTACTTGTCTCAGTGATCTTCGAATTAC
CTTGATCACGTGACCGAAGCGAAGAAATATGAATCGAATCGAAATTGTTT
GGATTATCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATTGTATA
TTAATGACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAACCAATC
AACAACCATAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGAT
AAAAAATTATTGTTTGGAATTCCGAAACAATATAACCATCAAGGAATGGT
TTTACTCTAGCATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTACCA
ATCGAGTTTTATGGAAAAGAATGAAAATTCAACCCTCGAAAATCAACACA
TCATTAAGATGGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCGAT
GGATTTCAAACTACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAATG
AATGCGAAACTGATGGGTACCGCCTCATGATTGCTCAAAAAGGGATGACA
TTAACCACGCCCTACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCT
TGGACAAGTCCTACACATGTACATTGGTATGGAGAATGGTTTCTTCCGTA
TTTACCCTGGCTTACTGATGAATCCTTCATACGACCCAAGAGCTCGACCA
TGAGTATCGATGTTTTTAAAAATATACGGTTATCGGCACAAGCTACAAAA
TCTATGGATCAATATTGGAAAAATGATACATCAGAGAAAGCAATCAGTAT
CATCGCAAGACTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGG
CCAAGTATTTACTTCAAACTAGAGACAAATGAGACGGTTCAGGAATTAAA
AGACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGC
GGTGTTCCTGGATCAAAGATTCTATCAGACGTAATGATGCCAATATCTCG
AGGGCCTTTTGGAGCCACTTCACAAAATAAAACATTGACTTATACTTGGA
AAGCTGTTCCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTGAT
TACGAAAAATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTA
TCATCGCCTTGATCTATGGAATTCCACATATTTAGATGATCATATTTGCA
AATACAGTGAAACACAGGTAGCAGTCAAAGGTCAAACATTTATTCATCCG
AAATTCGGACAACCGCTTGGATCAGATGAACTTTCTCGGACAGTTAATAT
TTTACAAATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGATA
TGATAAGGCACAACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTC
ATCTTCACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCA
ATGAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTC
CTTATCAAAAGAAACGGGTCGTGACAACTTTATGGAATTTGAACTTGGAA
AGGATAATAATCATTTTACCATCAATTCCAAGATATCTGCCATTTTATCC
TCCGCTAAGAATTTCAACGACTTCGACGACAAAGTTCATTACATCATGCC
TATATCTGATCGATTTGGAAGAGATGGAAAACTAGCGGGAGCAACGTACA
GCAACAACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGAAAAACATT
TCATCTTTGTGACAAGTGGATACTACAAGGATGGCAGTTGGTCTGAAGTT
GAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTT
TTCTCTTCTACTAATATATGGTGAAGCAGCTAGCTATAAGAAGATCTTTG
AAGAAACTTTTCAGATACTATACAATGATAAGAATAATCAAACAGATTTC
AGTAAAATTTTATCATGAGGATAATTTGGTACCATCGGACAATAAAGCAG
ATTGTTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAATT
CTCCAACAAATTGAAAACAAACAGCCAAAAGTTCGCGACTATTGGAAACG
TTACCGGGAAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATTCCGA
AGAAATTAAAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGC
TCAACCTTGTCACATTTAAAGATGAGGTTTCGATGAGCGACATTTGTGAG
CAAACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCC
ATCAGAATCCATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCA
AGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGAC
TCTTTAGATGGTTATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACC
AATGGAATGCACATGCGCACAAAGGGATCCCAGATTCAGTTTGTCAAAGA
CCTTGCGGGAAAGACGACCATAGCCGAAAACGTATTGAACGAAATGTCGA
GTCACATTTTGGACGATTATAAAACGAACAACGGTGATCAAAGACCCATC
GAAAGTTGTTGTCAATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTT
TGGTGAAAACCAAAACCTTAATGATATGTCTGAAGATGATGCAACTAGCT
TTGATGACCAGGCCACCCTCGATAATATGGAGTATCATTATGTCATCATT
GTGTTACTTTCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAAGT
TAATTTCCTAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGAAT
TGACAAAACTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCGACAC
ATGGGATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAAT
TCCCAAATGGAACCCATGTTGCCGACGAGAAAAAGCATTGTGATTATTCT
GACGAAGAATGTTTTCCGACGCCATCACCACCCATCATAACGCCTGCACC
ACCCACAACACCTGACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTA
TTGCTGTGATTATACTATTTAGTATAATATTTGTATGCTCCATACTGGGT
GGTATCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTAATAA
CAATAACAACGGGAATAATTCTAACACAACACTTACTCCTCGAGCCAACA
GTGGTTTTGATGATGACCAATATCAACCAGGATATCAACCATCAGGCCAC
GCACCAAACGATCGACTAGGATCAGTACCATCACCGACTGATACCAAAGA
TGCTGCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAG
ATGAAAATGGTTCAGTTAGTACCACGGCTTAACCCAGGCAGACTTGAATG
CAACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAG
GAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGG
AAAGATTTGGGTATTGTTCGAACGATATCAGCGAAACAAATTGTGAATGT
CCTTGCATACAACCCGTTACTTGTCTCAGTGATCTTCGAATTACCTTGAT
CACGTGACCGAAGCGAAGAAATATGAATCGAATCGAAATTGTTTGGATTA
TCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATTGTATATTAATG
ACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAACCAATCAACAAC
CATAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAA
TTATTGTTTGGAATTCCGAAACAATATAACCATCAAGGAATGGTTTTACT
CTAGCATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTACCAATCGAG
TTTTATGGAAAAGAATGAAAATTCAACCCTCGAAAATCAACACATCATTA
AGATGGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCGATGGATTT
CAAACTACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAATGAATGCG
AAACTGATGGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACC
ACGCCCTACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACA
AGTCCTACACATGTACATTGGTATGGAGAATGGTTTCTTCCGTATTTACC
CTGGCTTACTGATGAATCCTTCATACGACCCAAGAGCTCGACCATGAGTA
TCGATGTTTTTAAAAATATACGGTTATCGGCACAAGCTACAAAATCTATG
GATCAATATTGGAAAAATGATACATCAGAGAAAGCAATCAGTATCATCGC
AAGACTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGT
ATTTACTTCAAACTAGAGACAAATGAGACGGTTCAGGAATTAAAAGACTT
GTTCATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTT
CCTGGATCAAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCC
TTTTGGAGCCACTTCACAAAATAAAACATTGACTTATACTTGGAAAGCTG
TTCCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTGATTACGAA
AAATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCG
CCTTGATCTATGGAATTCCACATATTTAGATGATCATATTTGCAAATACA
GTGAAACACAGGTAGCAGTCAAAGGTCAAACATTTATTCATCCGAAATTC
GGACAACCGCTTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTACA
AATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGATATGATAA
GGCACAACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTC
ACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAAT
TTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATC
AAAAGAAACGGGTCGTGACAACTTTATGGAATTTGAACTTGGAAAGGATA
ATAATCATTTTACCATCAATTCCAAGATATCTGCCATTTTATCCTCCGCT
AAGAATTTCAACGACTTCGACGACAAAGTTCATTACATCATGCCTATATC
TGATCGATTTGGAAGAGATGGAAAACTAGCGGGAGCAACGTACAGCAACA
ACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGAAAAACATTTCATCT
TTGTGACAAGTGGATACTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAA
GGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCT
TCTACTAATATATGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAA
CTTTTCAGATACTATACAATGATAAGAATAATCAAACAGATTTCAGTAAA
ATTTTATCATGAGGATAATTTGGTACCATCGGACAATAAAGCAGATTGTT
TGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCCAA
CAAATTGAAAACAAACAGCCAAAAGTTCGCGACTATTGGAAACGTTACCG
GGAAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATTCCGAAGAAAT
TAAAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACC
TTGTCACATTTAAAGATGAGGTTTCGATGAGCGACATTTGTGAGCAAACA
CCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGA
ATCCATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATG
TTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTCTTTA
GATGGTTATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAATGGA
ATGCACATGCGCACAAAGGGATCCCAGATTCAGTTTGTCAAAGACCTTGC
GGGAAAGACGACCATAGCCGAAAACGTATTGAACGAAATGTCGAGTCACA
TTTTGGACGATTATAAAACGAACAACGGTGATCAAAGACCCATCGAAAGT
TGTTGTCAATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGA
AAACCAAAACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGATG
ACCAGGCCACCCTCGATAATATGGAGTATCATTATGTCATCATTGTGTTA
CTTTCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAAGTTAATTT
CCTAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGAATTGACAA
AACTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCGACACATGGGA
TAATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAA
ATGGAACCCATGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGACGAA
GAATGTTTTCCGACGCCATCACCACCCATCATAACGCCTGCACCACCCAC
AACACCTGACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTATTGCTG
TGATTATACTATTTAGTATAATATTTGTATGCTCCATACTGGGTGGTATC
TACTGGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTAATAACAATAA
CAACGGGAATAATTCTAACACAACACTTACTCCTCGAGCCAACAGTGGTT
TTGATGATGACCAATATCAACCAGGATATCAACCATCAGGCCACGCACCA
AACGATCGACTAGGATCAGTACCATCACCGACTGATACCAAAGATGCTGC
AGTAGAGATAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAA
ATGGTTCAGTTAGTACCACGGCTTAACCCAGGCAGACTTGAATGCAACCC
AGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACA
TTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGGAAAGAT
TTGGGTATTGTTCGAACGATATCAGCGAAACAAATTGTGAATGTCCTTGC
ATACAACCCGTTACTTGTCTCAGTGATCTTCGAATTACCTTGATCACGTG
ACCGAAGCGAAGAAATATGAATCGAATCGAAATTGTTTGGATTATCGAGT
TGTTCCGATTGTTGATTCCAATCTTTTATTATTGTATATTAATGACGCTT
GCACTTTACCAGAAAATTGTAACTGTGAAGAACCAATCAACAACCATAGT
CGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAATTATTG
TTTGGAATTCCGAAACAATATAACCATCAAGGAATGGTTTTACTCTAGCA
TGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTAT
GGAAAAGAATGAAAATTCAACCCTCGAAAATCAACACATCATTAAGATGG
GGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCGATGGATTTCAAACT
ACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAATGAATGCGAAACTG
ATGGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACCACGCCC
TACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCCT
ACACATGTACATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCT
TACTGATGAATCCTTCATACGACCCAAGAGCTCGACCATGAGTATCGATG
TTTTTAAAAATATACGGTTATCGGCACAAGCTACAAAATCTATGGATCAA
TATTGGAAAAATGATACATCAGAGAAAGCAATCAGTATCATCGCAAGACT
TGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTTAC
TTCAAACTAGAGACAAATGAGACGGTTCAGGAATTAAAAGACTTGTTCAT
GCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGA
TCAAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCCTTTTGG
AGCCACTTCACAAAATAAAACATTGACTTATACTTGGAAAGCTGTTCCAA
AGTCTGACTTCATTTTGACTATTGTGACGTCATCTGATTACGAAAAATCC
GAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGA
TCTATGGAATTCCACATATTTAGATGATCATATTTGCAAATACAGTGAAA
CACAGGTAGCAGTCAAAGGTCAAACATTTATTCATCCGAAATTCGGACAA
CCGCTTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTACAAATCGA
ATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGATATGATAAGGCACA
ACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAA
TCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTC
GCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGA
AACGGGTCGTGACAACTTTATGGAATTTGAACTTGGAAAGGATAATAATC
ATTTTACCATCAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAAT
TTCAACGACTTCGACGACAAAGTTCATTACATCATGCCTATATCTGATCG
ATTTGGAAGAGATGGAAAACTAGCGGGAGCAACGTACAGCAACAACAAAA
ATCTTGCAGGAGTCGGATGTGATATAGAGAAAAACATTTCATCTTTGTGA
CAAGTGGATACTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTC
AAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACT
AATATATGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTC
AGATACTATACAATGATAAGAATAATCAAACAGATTTCAGTAAAATTTTA
TCATGAGGATAATTTGGTACCATCGGACAATAAAGCAGATTGTTTGAAGA
TTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCCAACAAATT
GAAAACAAACAGCCAAAAGTTCGCGACTATTGGAAACGTTACCGGGAAGT
GAAGGGAGACATTTTGTTATTATTCTGGATTATTCCGAAGAAATTAAAGA
TACAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCTTGTCA
CATTTAAAGATGAGGTTTCGATGAGCGACATTTGTGAGCAAACACCTCCA
AGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCAT
TCACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTATA
AAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTCTTTAGATGGT
TATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAATGGAATGCAC
ATGCGCACAAAGGGATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAA
GACGACCATAGCCGAAAACGTATTGAACGAAATGTCGAGTCACATTTTGG
ACGATTATAAAACGAACAACGGTGATCAAAGACCCATCGAAAGTTGTTGT
CAATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAAACCA
AAACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGATGACCAGG
CCACCCTCGATAATATGGAGTATCATTATGTCATCATTGTGTTACTTTCA
TTTCATTGGTCAAACGTGAATGGACAAAATAACCAAGTTAATTTCCTAGA
TTTATTGAAAGATGATGCCAAAACTTTTCAACAAGAATTGACAAAACTCG
TCAATGAGAACCTTGGTCATGAAACTTTGCAGCGACACATGGGATAATTG
TGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAA
CCCATGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAATGT
TTTCCGACGCCATCACCACCCATCATAACGCCTGCACCACCCACAACACC
TGACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGATTA
TACTATTTAGTATAATATTTGTATGCTCCATACTGGGTGGTATCTACTGG
TGGTTCAATAAAAAAGCTAAACGAAGACAACGTAATAACAATAACAACGG
GAATAATTCTAACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGATG
ATGACCAATATCAACCAGGATATCAACCATCAGGCCACGCACCAAACGAT
CGACTAGGATCAGTACCATCACCGACTGATACCAAAGATGCTGCAGTAGA
GATAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTT
CAGTTAGTACCACGGCTTAACCCAGGCAGACTTGAATGCAACCCAGAGGA
CAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAG
AGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGGAAAGATTTGGGT
ATTGTTCGAACGATATCAGCGAAACAAATTGTGAATGTCCTTGCATACAA
CCCGTTACTTGTCTCAGTGATCTTCGAATTACCTTGATCACGTGACCGAA
GCGAAGAAATATGAATCGAATCGAAATTGTTTGGATTATCGAGTTGTTCC
GATTGTTGATTCCAATCTTTTATTATTGTATATTAATGACGCTTGCACTT
TACCAGAAAATTGTAACTGTGAAGAACCAATCAACAACCATAGTCGAGTT
GCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAATTATTGTTTGGA
ATTCCGAAACAATATAACCATCAAGGAATGGTTTTACTCTAGCATGTGTT
GTGATTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAA
GAATGAAAATTCAACCCTCGAAAATCAACACATCATTAAGATGGGGCAAG
ACTTCGACAGAGAAAGCAGGGAATATAGCGATGGATTTCAAACTACCCTA
CTTTAAAGTGTTACTGGATAAGTCAATCAATGAATGCGAAACTGATGGGT
ACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACCACGCCCTACTTG
GATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCCTACACAT
GTACATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGA
TGAATCCTTCATACGACCCAAGAGCTCGACCATGAGTATCGATGTTTTTA
AAAATATACGGTTATCGGCACAAGCTACAAAATCTATGGATCAATATTGG
AAAAATGATACATCAGAGAAAGCAATCAGTATCATCGCAAGACTTGGCAG
TAATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTTACTTCAAA
CTAGAGACAAATGAGACGGTTCAGGAATTAAAAGACTTGTTCATGCCTGG
GGAGACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAG
ATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAGCCAC
TTCACAAAATAAAACATTGACTTATACTTGGAAAGCTGTTCCAAAGTCTG
ACTTCATTTTGACTATTGTGACGTCATCTGATTACGAAAAATCCGAACTC
AAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATCTATG
GAATTCCACATATTTAGATGATCATATTTGCAAATACAGTGAAACACAGG
TAGCAGTCAAAGGTCAAACATTTATTCATCCGAAATTCGGACAACCGCTT
GGATCAGATGAACTTTCTCGGACAGTTAATATTTTACAAATCGAATCTTC
ACAAAGTTTCAAAGATGAAGTGTACAATGATATGATAAGGCACAACCATT
GACGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAAT
GAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAG
AATGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGG
TCGTGACAACTTTATGGAATTTGAACTTGGAAAGGATAATAATCATTTTA
CCATCAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAAC
GACTTCGACGACAAAGTTCATTACATCATGCCTATATCTGATCGATTTGG
AAGAGATGGAAAACTAGCGGGAGCAACGTACAGCAACAACAAAAATCTTG
CAGGAGTCGGATGTGATATAGAGAAAAACATTTCATCTTTGTGACAAGTG
GATACTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGAT
GGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATA
TGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGATAC
TATACAATGATAAGAATAATCAAACAGATTTCAGTAAAATTTTATCATGA
GGATAATTTGGTACCATCGGACAATAAAGCAGATTGTTTGAAGATTTCAT
CAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCCAACAAATTGAAAAC
AAACAGCCAAAAGTTCGCGACTATTGGAAACGTTACCGGGAAGTGAAGGG
AGACATTTTGTTATTATTCTGGATTATTCCGAAGAAATTAAAGATACAAT
CTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCTTGTCACATTTA
AAGATGAGGTTTCGATGAGCGACATTTGTGAGCAAACACCTCCAAGCAAT
TCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTA
CCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTATAAAGAAG
CCAAAGGCGAAGCAAGGAACATTCAATACGACTCTTTAGATGGTTATTCG
TTCACTTATCCTGCTTATCAAGATCCTTCACCAATGGAATGCACATGCGC
ACAAAGGGATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGACGAC
CATAGCCGAAAACGTATTGAACGAAATGTCGAGTCACATTTTGGACGATT
ATAAAACGAACAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTT
GATGATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAAACCT
TAATGATATGTCTGAAGATGATGCAACTAGCTTTGATGACCAGGCCACCC
TCGATAATATGGAGTATCATTATGTCATCATTGTGTTACTTTCATTTCAT
TGGTCAAACGTGAATGGACAAAATAACCAAGTTAATTTCCTAGATTTATT
GAAAGATGATGCCAAAACTTTTCAACAAGAATTGACAAAACTCGTCAATG
AGAACCTTGGTCATGAAACTTTGCAGCGACACATGGGATAATTGTGAAAG
TTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCATG
TTGCCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAATGTTTTCCG
ACGCCATCACCACCCATCATAACGCCTGCACCACCCACAACACCTGACTC
GCAAGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGATTATACTAT
TTAGTATAATATTTGTATGCTCCATACTGGGTGGTATCTACTGGTGGTTC
AATAAAAAAGCTAAACGAAGACAACGTAATAACAATAACAACGGGAATAA
TTCTAACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGACC
AATATCAACCAGGATATCAACCATCAGGCCACGCACCAAACGATCGACTA
GGATCAGTACCATCACCGACTGATACCAAAGATGCTGCAGTAGAGATAAC
AATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTA
GTACCACGGCTTAACCCAGGCAGACTTGAATGCAACCCAGAGGACAAACG
AAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGCTTA
CTCTCTGTTTTGACCCTGAATGCAAGAAACGGAAAGATTTGGGTATTGTT
CGAACGATATCAGCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTT
ACTTGTCTCAGTGATCTTCGAATTACCTTGATCACGTGACCGAAGCGAAG
AAATATGAATCGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGT
TGATTCCAATCTTTTATTATTGTATATTAATGACGCTTGCACTTTACCAG
AAAATTGTAACTGTGAAGAACCAATCAACAACCATAGTCGAGTTGCAAAG
AGCATGATCGAAGAGGGAGTTATGATAAAAAATTATTGTTTGGAATTCCG
AAACAATATAACCATCAAGGAATGGTTTTACTCTAGCATGTGTTGTGATT
GATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGA
AAATTCAACCCTCGAAAATCAACACATCATTAAGATGGGGCAAGACTTCG
ACAGAGAAAGCAGGGAATATAGCGATGGATTTCAAACTACCCTACTTTAA
AGTGTTACTGGATAAGTCAATCAATGAATGCGAAACTGATGGGTACCGCC
TCATGATTGCTCAAAAAGGGATGACATTAACCACGCCCTACTTGGATGCC
TTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCCTACACATGTACAT
TGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAATC
CTTCATACGACCCAAGAGCTCGACCATGAGTATCGATGTTTTTAAAAATA
TACGGTTATCGGCACAAGCTACAAAATCTATGGATCAATATTGGAAAAAT
GATACATCAGAGAAAGCAATCAGTATCATCGCAAGACTTGGCAGTAATCA
AATTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAG
ACAAATGAGACGGTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGAC
AGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTA
TCAGACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAGCCACTTCACA
AAATAAAACATTGACTTATACTTGGAAAGCTGTTCCAAAGTCTGACTTCA
TTTTGACTATTGTGACGTCATCTGATTACGAAAAATCCGAACTCAAAATC
ACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATCTATGGAATTC
CACATATTTAGATGATCATATTTGCAAATACAGTGAAACACAGGTAGCAG
TCAAAGGTCAAACATTTATTCATCCGAAATTCGGACAACCGCTTGGATCA
GATGAACTTTCTCGGACAGTTAATATTTTACAAATCGAATCTTCACAAAG
TTTCAAAGATGAAGTGTACAATGATATGATAAGGCACAACCATTGACGCA
TGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGAAAGG
AGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAATGGA
GTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGGTCGTGA
CAACTTTATGGAATTTGAACTTGGAAAGGATAATAATCATTTTACCATCA
ATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACTTC
GACGACAAAGTTCATTACATCATGCCTATATCTGATCGATTTGGAAGAGA
TGGAAAACTAGCGGGAGCAACGTACAGCAACAACAAAAATCTTGCAGGAG
TCGGATGTGATATAGAGAAAAACATTTCATCTTTGTGACAAGTGGATACT
ACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGG
AAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGTGA
AGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGATACTATACA
ATGATAAGAATAATCAAACAGATTTCAGTAAAATTTTATCATGAGGATAA
TTTGGTACCATCGGACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAG
CAACTCCTTATCTCAAAGATAAAATTCTCCAACAAATTGAAAACAAACAG
CCAAAAGTTCGCGACTATTGGAAACGTTACCGGGAAGTGAAGGGAGACAT
TTTGTTATTATTCTGGATTATTCCGAAGAAATTAAAGATACAATCTCAAT
TGTGAAGAAAGTTGCAAAGACATTGCTCAACCTTGTCACATTTAAAGATG
AGGTTTCGATGAGCGACATTTGTGAGCAAACACCTCCAAGCAATTCGAAA
GTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAAA
GAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTATAAAGAAGCCAAAG
GCGAAGCAAGGAACATTCAATACGACTCTTTAGATGGTTATTCGTTCACT
TATCCTGCTTATCAAGATCCTTCACCAATGGAATGCACATGCGCACAAAG
GGATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGC
CGAAAACGTATTGAACGAAATGTCGAGTCACATTTTGGACGATTATAAAA
CGAACAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATGAT
TCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTAATGA
TATGTCTGAAGATGATGCAACTAGCTTTGATGACCAGGCCACCCTCGATA
ATATGGAGTATCATTATGTCATCATTGTGTTACTTTCATTTCATTGGTCA
AACGTGAATGGACAAAATAACCAAGTTAATTTCCTAGATTTATTGAAAGA
TGATGCCAAAACTTTTCAACAAGAATTGACAAAACTCGTCAATGAGAACC
TTGGTCATGAAACTTTGCAGCGACACATGGGATAATTGTGAAAGTTTCAA
ACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGCCG
ACGAGAAAAAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGACGCCA
TCACCACCCATCATAACGCCTGCACCACCCACAACACCTGACTCGCAAGA
AACTGAGGACCTATCAGATGGTGCTATTGCTGTGATTATACTATTTAGTA
TAATATTTGTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAATAAA
AAAGCTAAACGAAGACAACGTAATAACAATAACAACGGGAATAATTCTAA
CACAACACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAATATC
AACCAGGATATCAACCATCAGGCCACGCACCAAACGATCGACTAGGATCA
GTACCATCACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAATGCC
AGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTACCA
CGGCTTAACCCAGGCAGACTTGAATGCAACCCAGAGGACAAACGAAAAAC
AGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGCTTACTCTCT
GTTTTGACCCTGAATGCAAGAAACGGAAAGATTTGGGTATTGTTCGAACG
ATATCAGCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGT
CTCAGTGATCTTCGAATTACCTTGATCACGTGACCGAAGCGAAGAAATAT
GAATCGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTGATTC
CAATCTTTTATTATTGTATATTAATGACGCTTGCACTTTACCAGAAAATT
GTAACTGTGAAGAACCAATCAACAACCATAGTCGAGTTGCAAAGAGCATG
ATCGAAGAGGGAGTTATGATAAAAAATTATTGTTTGGAATTCCGAAACAA
TATAACCATCAAGGAATGGTTTTACTCTAGCATGTGTTGTGATTGATCGA
AATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAAATTC
AACCCTCGAAAATCAACACATCATTAAGATGGGGCAAGACTTCGACAGAG
AAAGCAGGGAATATAGCGATGGATTTCAAACTACCCTACTTTAAAGTGTT
ACTGGATAAGTCAATCAATGAATGCGAAACTGATGGGTACCGCCTCATGA
TTGCTCAAAAAGGGATGACATTAACCACGCCCTACTTGGATGCCTTTACT
GGTGAAACTGTTATGACTCTTGGACAAGTCCTACACATGTACATTGGTAT
GGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAATCCTTCAT
ACGACCCAAGAGCTCGACCATGAGTATCGATGTTTTTAAAAATATACGGT
TATCGGCACAAGCTACAAAATCTATGGATCAATATTGGAAAAATGATACA
TCAGAGAAAGCAATCAGTATCATCGCAAGACTTGGCAGTAATCAAATTTC
CAGCAGATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAAT
GAGACGGTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAAC
ACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTATCAGAC
GTAATGATGCCAATATCTCGAGGGCCTTTTGGAGCCACTTCACAAAATAA
AACATTGACTTATACTTGGAAAGCTGTTCCAAAGTCTGACTTCATTTTGA
CTATTGTGACGTCATCTGATTACGAAAAATCCGAACTCAAAATCACCAAT
CAAGGAGGGGCGGAAGATTATCATCGCCTTGATCTATGGAATTCCACATA
TTTAGATGATCATATTTGCAAATACAGTGAAACACAGGTAGCAGTCAAAG
GTCAAACATTTATTCATCCGAAATTCGGACAACCGCTTGGATCAGATGAA
CTTTCTCGGACAGTTAATATTTTACAAATCGAATCTTCACAAAGTTTCAA
AGATGAAGTGTACAATGATATGATAAGGCACAACCATTGACGCATGTAAA
GCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCCGT
TTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAA
CGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGGTCGTGACAACTT
TATGGAATTTGAACTTGGAAAGGATAATAATCATTTTACCATCAATTCCA
AGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACTTCGACGAC
AAAGTTCATTACATCATGCCTATATCTGATCGATTTGGAAGAGATGGAAA
ACTAGCGGGAGCAACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGAT
GTGATATAGAGAAAAACATTTCATCTTTGTGACAAGTGGATACTACAAGG
ATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGT
TTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGTGAAGCAGC
TAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGATACTATACAATGATA
AGAATAATCAAACAGATTTCAGTAAAATTTTATCATGAGGATAATTTGGT
ACCATCGGACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAACTC
CTTATCTCAAAGATAAAATTCTCCAACAAATTGAAAACAAACAGCCAAAA
GTTCGCGACTATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTGTT
ATTATTCTGGATTATTCCGAAGAAATTAAAGATACAATCTCAATTGTGAA
GAAAGTTGCAAAGACATTGCTCAACCTTGTCACATTTAAAGATGAGGTTT
CGATGAGCGACATTTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCTGT
CCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGA
GGATTTGGTCACGAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAG
CAAGGAACATTCAATACGACTCTTTAGATGGTTATTCGTTCACTTATCCT
GCTTATCAAGATCCTTCACCAATGGAATGCACATGCGCACAAAGGGATCC
CAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAAAA
CGTATTGAACGAAATGTCGAGTCACATTTTGGACGATTATAAAACGAACA
ACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATGATTCAAAA
CTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTAATGATATGTC
TGAAGATGATGCAACTAGCTTTGATGACCAGGCCACCCTCGATAATATGG
AGTATCATTATGTCATCATTGTGTTACTTTCATTTCATTGGTCAAACGTG
AATGGACAAAATAACCAAGTTAATTTCCTAGATTTATTGAAAGATGATGC
CAAAACTTTTCAACAAGAATTGACAAAACTCGTCAATGAGAACCTTGGTC
ATGAAACTTTGCAGCGACACATGGGATAATTGTGAAAGTTTCAAACCTGC
TTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGCCGACGAGA
AAAAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGACGCCATCACCA
CCCATCATAACGCCTGCACCACCCACAACACCTGACTCGCAAGAAACTGA
GGACCTATCAGATGGTGCTATTGCTGTGATTATACTATTTAGTATAATAT
TTGTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCT
AAACGAAGACAACGTAATAACAATAACAACGGGAATAATTCTAACACAAC
ACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAATATCAACCAG
GATATCAACCATCAGGCCACGCACCAAACGATCGACTAGGATCAGTACCA
TCACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGT
GTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTT
AACCCAGGCAGACTTGAATGCAACCCAGAGGACAAACGAAAAACAGATTT
CTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGCTTACTCTCTGTTTTG
ACCCTGAATGCAAGAAACGGAAAGATTTGGGTATTGTTCGAACGATATCA
GCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTCAGT
GATCTTCGAATTACCTTGATCACGTGACCGAAGCGAAGAAATATGAATCG
AATCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCAATCT
TTTATTATTGTATATTAATGACGCTTGCACTTTACCAGAAAATTGTAACT
GTGAAGAACCAATCAACAACCATAGTCGAGTTGCAAAGAGCATGATCGAA
GAGGGAGTTATGATAAAAAATTATTGTTTGGAATTCCGAAACAATATAAC
CATCAAGGAATGGTTTTACTCTAGCATGTGTTGTGATTGATCGAAATGGC
TTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAAATTCAACCCT
CGAAAATCAACACATCATTAAGATGGGGCAAGACTTCGACAGAGAAAGCA
GGGAATATAGCGATGGATTTCAAACTACCCTACTTTAAAGTGTTACTGGA
TAAGTCAATCAATGAATGCGAAACTGATGGGTACCGCCTCATGATTGCTC
AAAAAGGGATGACATTAACCACGCCCTACTTGGATGCCTTTACTGGTGAA
ACTGTTATGACTCTTGGACAAGTCCTACACATGTACATTGGTATGGAGAA
TGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAATCCTTCATACGACC
CAAGAGCTCGACCATGAGTATCGATGTTTTTAAAAATATACGGTTATCGG
CACAAGCTACAAAATCTATGGATCAATATTGGAAAAATGATACATCAGAG
AAAGCAATCAGTATCATCGCAAGACTTGGCAGTAATCAAATTTCCAGCAG
ATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAATGAGACG
GTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAACACCTCG
TGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTATCAGACGTAATG
ATGCCAATATCTCGAGGGCCTTTTGGAGCCACTTCACAAAATAAAACATT
GACTTATACTTGGAAAGCTGTTCCAAAGTCTGACTTCATTTTGACTATTG
TGACGTCATCTGATTACGAAAAATCCGAACTCAAAATCACCAATCAAGGA
GGGGCGGAAGATTATCATCGCCTTGATCTATGGAATTCCACATATTTAGA
TGATCATATTTGCAAATACAGTGAAACACAGGTAGCAGTCAAAGGTCAAA
CATTTATTCATCCGAAATTCGGACAACCGCTTGGATCAGATGAACTTTCT
CGGACAGTTAATATTTTACAAATCGAATCTTCACAAAGTTTCAAAGATGA
AGTGTACAATGATATGATAAGGCACAACCATTGACGCATGTAAAGCAGTG
GTGGATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCCGTTTGTCT
TTCTTTTCTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAACGGAAA
ATTCTTATTGGTTCCTTATCAAAAGAAACGGGTCGTGACAACTTTATGGA
ATTTGAACTTGGAAAGGATAATAATCATTTTACCATCAATTCCAAGATAT
CTGCCATTTTATCCTCCGCTAAGAATTTCAACGACTTCGACGACAAAGTT
CATTACATCATGCCTATATCTGATCGATTTGGAAGAGATGGAAAACTAGC
GGGAGCAACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATA
TAGAGAAAAACATTTCATCTTTGTGACAAGTGGATACTACAAGGATGGCA
GTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAA
TGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGTGAAGCAGCTAGCTA
TAAGAAGATCTTTGAAGAAACTTTTCAGATACTATACAATGATAAGAATA
ATCAAACAGATTTCAGTAAAATTTTATCATGAGGATAATTTGGTACCATC
GGACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTATC
TCAAAGATAAAATTCTCCAACAAATTGAAAACAAACAGCCAAAAGTTCGC
GACTATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTATT
CTGGATTATTCCGAAGAAATTAAAGATACAATCTCAATTGTGAAGAAAGT
TGCAAAGACATTGCTCAACCTTGTCACATTTAAAGATGAGGTTTCGATGA
GCGACATTTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCTCT
CTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGAGGATTT
GGTCACGAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGA
ACATTCAATACGACTCTTTAGATGGTTATTCGTTCACTTATCCTGCTTAT
CAAGATCCTTCACCAATGGAATGCACATGCGCACAAAGGGATCCCAGATT
CAGTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAAAACGTATT
GAACGAAATGTCGAGTCACATTTTGGACGATTATAAAACGAACAACGGTG
ATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATGATTCAAAACTGGGA
TTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTAATGATATGTCTGAAGA
TGATGCAACTAGCTTTGATGACCAGGCCACCCTCGATAATATGGAGTATC
ATTATGTCATCATTGTGTTACTTTCATTTCATTGGTCAAACGTGAATGGA
CAAAATAACCAAGTTAATTTCCTAGATTTATTGAAAGATGATGCCAAAAC
TTTTCAACAAGAATTGACAAAACTCGTCAATGAGAACCTTGGTCATGAAA
CTTTGCAGCGACACATGGGATAATTGTGAAAGTTTCAAACCTGCTTGCAA
CTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGCCGACGAGAAAAAGC
ATTGTGATTATTCTGACGAAGAATGTTTTCCGACGCCATCACCACCCATC
ATAACGCCTGCACCACCCACAACACCTGACTCGCAAGAAACTGAGGACCT
ATCAGATGGTGCTATTGCTGTGATTATACTATTTAGTATAATATTTGTAT
GCTCCATACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAAACGA
AGACAACGTAATAACAATAACAACGGGAATAATTCTAACACAACACTTAC
TCCTCGAGCCAACAGTGGTTTTGATGATGACCAATATCAACCAGGATATC
AACCATCAGGCCACGCACCAAACGATCGACTAGGATCAGTACCATCACCG
ACTGATACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGTACGA
GGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAACCCA
GGCAGACTTGAATGCAACCCAGAGGACAAACGAAAAACAGATTTCTCAGA
AAAATGGTTCAAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTG
AATGCAAGAAACGGAAAGATTTGGGTATTGTTCGAACGATATCAGCGAAA
CAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTCAGTGATCTT
CGAATTACCTTGATCACGTGACCGAAGCGAAGAAATATGAATCGAATCGA
AATTGTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATT
ATTGTATATTAATGACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAG
AACCAATCAACAACCATAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGA
GTTATGATAAAAAATTATTGTTTGGAATTCCGAAACAATATAACCATCAA
GGAATGGTTTTACTCTAGCATGTGTTGTGATTGATCGAAATGGCTTCGTG
GTTTACCAATCGAGTTTTATGGAAAAGAATGAAAATTCAACCCTCGAAAA
TCAACACATCATTAAGATGGGGCAAGACTTCGACAGAGAAAGCAGGGAAT
ATAGCGATGGATTTCAAACTACCCTACTTTAAAGTGTTACTGGATAAGTC
AATCAATGAATGCGAAACTGATGGGTACCGCCTCATGATTGCTCAAAAAG
GGATGACATTAACCACGCCCTACTTGGATGCCTTTACTGGTGAAACTGTT
ATGACTCTTGGACAAGTCCTACACATGTACATTGGTATGGAGAATGGTTT
CTTCCGTATTTACCCTGGCTTACTGATGAATCCTTCATACGACCCAAGAG
CTCGACCATGAGTATCGATGTTTTTAAAAATATACGGTTATCGGCACAAG
CTACAAAATCTATGGATCAATATTGGAAAAATGATACATCAGAGAAAGCA
ATCAGTATCATCGCAAGACTTGGCAGTAATCAAATTTCCAGCAGATGCTT
TTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAATGAGACGGTTCAG
GAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTGGCCT
CTTCAAGCGGTGTTCCTGGATCAAAGATTCTATCAGACGTAATGATGCCA
ATATCTCGAGGGCCTTTTGGAGCCACTTCACAAAATAAAACATTGACTTA
TACTTGGAAAGCTGTTCCAAAGTCTGACTTCATTTTGACTATTGTGACGT
CATCTGATTACGAAAAATCCGAACTCAAAATCACCAATCAAGGAGGGGCG
GAAGATTATCATCGCCTTGATCTATGGAATTCCACATATTTAGATGATCA
TATTTGCAAATACAGTGAAACACAGGTAGCAGTCAAAGGTCAAACATTTA
TTCATCCGAAATTCGGACAACCGCTTGGATCAGATGAACTTTCTCGGACA
GTTAATATTTTACAAATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTA
CAATGATATGATAAGGCACAACCATTGACGCATGTAAAGCAGTGGTGGAT
AAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTT
TCTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTT
ATTGGTTCCTTATCAAAAGAAACGGGTCGTGACAACTTTATGGAATTTGA
ACTTGGAAAGGATAATAATCATTTTACCATCAATTCCAAGATATCTGCCA
TTTTATCCTCCGCTAAGAATTTCAACGACTTCGACGACAAAGTTCATTAC
ATCATGCCTATATCTGATCGATTTGGAAGAGATGGAAAACTAGCGGGAGC
AACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGA
AAAACATTTCATCTTTGTGACAAGTGGATACTACAAGGATGGCAGTTGGT
CTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGC
GTTTCTTTTTCTCTTCTACTAATATATGGTGAAGCAGCTAGCTATAAGAA
GATCTTTGAAGAAACTTTTCAGATACTATACAATGATAAGAATAATCAAA
CAGATTTCAGTAAAATTTTATCATGAGGATAATTTGGTACCATCGGACAA
TAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAG
ATAAAATTCTCCAACAAATTGAAAACAAACAGCCAAAAGTTCGCGACTAT
TGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTATTCTGGAT
TATTCCGAAGAAATTAAAGATACAATCTCAATTGTGAAGAAAGTTGCAAA
GACATTGCTCAACCTTGTCACATTTAAAGATGAGGTTTCGATGAGCGACA
TTTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGA
AGTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGAGGATTTGGTCAC
GAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTC
AATACGACTCTTTAGATGGTTATTCGTTCACTTATCCTGCTTATCAAGAT
CCTTCACCAATGGAATGCACATGCGCACAAAGGGATCCCAGATTCAGTTT
GTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAAAACGTATTGAACGA
AATGTCGAGTCACATTTTGGACGATTATAAAACGAACAACGGTGATCAAA
GACCCATCGAAAGTTGTTGTCAATTTGATGATTCAAAACTGGGATTTGTT
TCAGTCTTTGGTGAAAACCAAAACCTTAATGATATGTCTGAAGATGATGC
AACTAGCTTTGATGACCAGGCCACCCTCGATAATATGGAGTATCATTATG
TCATCATTGTGTTACTTTCATTTCATTGGTCAAACGTGAATGGACAAAAT
AACCAAGTTAATTTCCTAGATTTATTGAAAGATGATGCCAAAACTTTTCA
ACAAGAATTGACAAAACTCGTCAATGAGAACCTTGGTCATGAAACTTTGC
AGCGACACATGGGATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTG
TTTCAAATTCCCAAATGGAACCCATGTTGCCGACGAGAAAAAGCATTGTG
ATTATTCTGACGAAGAATGTTTTCCGACGCCATCACCACCCATCATAACG
CCTGCACCACCCACAACACCTGACTCGCAAGAAACTGAGGACCTATCAGA
TGGTGCTATTGCTGTGATTATACTATTTAGTATAATATTTGTATGCTCCA
TACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGACAA
CGTAATAACAATAACAACGGGAATAATTCTAACACAACACTTACTCCTCG
AGCCAACAGTGGTTTTGATGATGACCAATATCAACCAGGATATCAACCAT
CAGGCCACGCACCAAACGATCGACTAGGATCAGTACCATCACCGACTGAT
ACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAGAG
ACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAACCCAGGCAGA
CTTGAATGCAACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATG
GTTCAAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCA
AGAAACGGAAAGATTTGGGTATTGTTCGAACGATATCAGCGAAACAAATT
GTGAATGTCCTTGCATACAACCCGTTACTTGTCTCAGTGATCTTCGAATT
ACCTTGATCACGTGACCGAAGCGAAGAAATATGAATCGAATCGAAATTGT
TTGGATTATCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATTGTA
TATTAATGACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAACCAA
TCAACAACCATAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATG
ATAAAAAATTATTGTTTGGAATTCCGAAACAATATAACCATCAAGGAATG
GTTTTACTCTAGCATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTAC
CAATCGAGTTTTATGGAAAAGAATGAAAATTCAACCCTCGAAAATCAACA
CATCATTAAGATGGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCG
ATGGATTTCAAACTACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAA
TGAATGCGAAACTGATGGGTACCGCCTCATGATTGCTCAAAAAGGGATGA
CATTAACCACGCCCTACTTGGATGCCTTTACTGGTGAAACTGTTATGACT
CTTGGACAAGTCCTACACATGTACATTGGTATGGAGAATGGTTTCTTCCG
TATTTACCCTGGCTTACTGATGAATCCTTCATACGACCCAAGAGCTCGAC
CATGAGTATCGATGTTTTTAAAAATATACGGTTATCGGCACAAGCTACAA
AATCTATGGATCAATATTGGAAAAATGATACATCAGAGAAAGCAATCAGT
ATCATCGCAAGACTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCA
GGCCAAGTATTTACTTCAAACTAGAGACAAATGAGACGGTTCAGGAATTA
AAAGACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAA
GCGGTGTTCCTGGATCAAAGATTCTATCAGACGTAATGATGCCAATATCT
CGAGGGCCTTTTGGAGCCACTTCACAAAATAAAACATTGACTTATACTTG
GAAAGCTGTTCCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTG
ATTACGAAAAATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGAT
TATCATCGCCTTGATCTATGGAATTCCACATATTTAGATGATCATATTTG
CAAATACAGTGAAACACAGGTAGCAGTCAAAGGTCAAACATTTATTCATC
CGAAATTCGGACAACCGCTTGGATCAGATGAACTTTCTCGGACAGTTAAT
ATTTTACAAATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGA
TATGATAAGGCACAACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGT
TCATCTTCACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGAC
CAATGAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGT
TCCTTATCAAAAGAAACGGGTCGTGACAACTTTATGGAATTTGAACTTGG
AAAGGATAATAATCATTTTACCATCAATTCCAAGATATCTGCCATTTTAT
CCTCCGCTAAGAATTTCAACGACTTCGACGACAAAGTTCATTACATCATG
CCTATATCTGATCGATTTGGAAGAGATGGAAAACTAGCGGGAGCAACGTA
CAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGAAAAACA
TTTCATCTTTGTGACAAGTGGATACTACAAGGATGGCAGTTGGTCTGAAG
TTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCT
TTTTCTCTTCTACTAATATATGGTGAAGCAGCTAGCTATAAGAAGATCTT
TGAAGAAACTTTTCAGATACTATACAATGATAAGAATAATCAAACAGATT
TCAGTAAAATTTTATCATGAGGATAATTTGGTACCATCGGACAATAAAGC
AGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAA
TTCTCCAACAAATTGAAAACAAACAGCCAAAAGTTCGCGACTATTGGAAA
CGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATTCC
GAAGAAATTAAAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACATT
GCTCAACCTTGTCACATTTAAAGATGAGGTTTCGATGAGCGACATTTGTG
AGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCT
CCATCAGAATCCATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAATG
CAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACG
ACTCTTTAGATGGTTATTCGTTCACTTATCCTGCTTATCAAGATCCTTCA
CCAATGGAATGCACATGCGCACAAAGGGATCCCAGATTCAGTTTGTCAAA
GACCTTGCGGGAAAGACGACCATAGCCGAAAACGTATTGAACGAAATGTC
GAGTCACATTTTGGACGATTATAAAACGAACAACGGTGATCAAAGACCCA
TCGAAAGTTGTTGTCAATTTGATGATTCAAAACTGGGATTTGTTTCAGTC
TTTGGTGAAAACCAAAACCTTAATGATATGTCTGAAGATGATGCAACTAG
CTTTGATGACCAGGCCACCCTCGATAATATGGAGTATCATTATGTCATCA
TTGTGTTACTTTCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAA
GTTAATTTCCTAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGA
ATTGACAAAACTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCGAC
ACATGGGATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAA
ATTCCCAAATGGAACCCATGTTGCCGACGAGAAAAAGCATTGTGATTATT
CTGACGAAGAATGTTTTCCGACGCCATCACCACCCATCATAACGCCTGCA
CCACCCACAACACCTGACTCGCAAGAAACTGAGGACCTATCAGATGGTGC
TATTGCTGTGATTATACTATTTAGTATAATATTTGTATGCTCCATACTGG
GTGGTATCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTAAT
AACAATAACAACGGGAATAATTCTAACACAACACTTACTCCTCGAGCCAA
CAGTGGTTTTGATGATGACCAATATCAACCAGGATATCAACCATCAGGCC
ACGCACCAAACGATCGACTAGGATCAGTACCATCACCGACTGATACCAAA
GATGCTGCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAGAGACCTGC
AGATGAAAATGGTTCAGTTAGTACCACGGCTTAACCCAGGCAGACTTGAA
TGCAACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAA
AGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAAC
GGAAAGATTTGGGTATTGTTCGAACGATATCAGCGAAACAAATTGTGAAT
GTCCTTGCATACAACCCGTTACTTGTCTCAGTGATCTTCGAATTACCTTG
ATCACGTGACCGAAGCGAAGAAATATGAATCGAATCGAAATTGTTTGGAT
TATCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATTGTATATTAA
TGACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAACCAATCAACA
ACCATAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAA
AATTATTGTTTGGAATTCCGAAACAATATAACCATCAAGGAATGGTTTTA
CTCTAGCATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTACCAATCG
AGTTTTATGGAAAAGAATGAAAATTCAACCCTCGAAAATCAACACATCAT
TAAGATGGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCGATGGAT
TTCAAACTACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAATGAATG
CGAAACTGATGGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAA
CCACGCCCTACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGA
CAAGTCCTACACATGTACATTGGTATGGAGAATGGTTTCTTCCGTATTTA
CCCTGGCTTACTGATGAATCCTTCATACGACCCAAGAGCTCGACCATGAG
TATCGATGTTTTTAAAAATATACGGTTATCGGCACAAGCTACAAAATCTA
TGGATCAATATTGGAAAAATGATACATCAGAGAAAGCAATCAGTATCATC
GCAAGACTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAA
GTATTTACTTCAAACTAGAGACAAATGAGACGGTTCAGGAATTAAAAGAC
TTGTTCATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGCGGTG
TTCCTGGATCAAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGGG
CCTTTTGGAGCCACTTCACAAAATAAAACATTGACTTATACTTGGAAAGC
TGTTCCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTGATTACG
AAAAATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCAT
CGCCTTGATCTATGGAATTCCACATATTTAGATGATCATATTTGCAAATA
CAGTGAAACACAGGTAGCAGTCAAAGGTCAAACATTTATTCATCCGAAAT
TCGGACAACCGCTTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTA
CAAATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGATATGAT
AAGGCACAACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCATCT
TCACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGA
ATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCTTA
TCAAAAGAAACGGGTCGTGACAACTTTATGGAATTTGAACTTGGAAAGGA
TAATAATCATTTTACCATCAATTCCAAGATATCTGCCATTTTATCCTCCG
CTAAGAATTTCAACGACTTCGACGACAAAGTTCATTACATCATGCCTATA
TCTGATCGATTTGGAAGAGATGGAAAACTAGCGGGAGCAACGTACAGCAA
CAACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGAAAAACATTTCAT
CTTTGTGACAAGTGGATACTACAAGGATGGCAGTTGGTCTGAAGTTGAGA
AAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCT
CTTCTACTAATATATGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGA
AACTTTTCAGATACTATACAATGATAAGAATAATCAAACAGATTTCAGTA
AAATTTTATCATGAGGATAATTTGGTACCATCGGACAATAAAGCAGATTG
TTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCC
AACAAATTGAAAACAAACAGCCAAAAGTTCGCGACTATTGGAAACGTTAC
CGGGAAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATTCCGAAGAA
ATTAAAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAA
CCTTGTCACATTTAAAGATGAGGTTTCGATGAGCGACATTTGTGAGCAAA
CACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCA
GAATCCATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGA
TGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTCTT
TAGATGGTTATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAATG
GAATGCACATGCGCACAAAGGGATCCCAGATTCAGTTTGTCAAAGACCTT
GCGGGAAAGACGACCATAGCCGAAAACGTATTGAACGAAATGTCGAGTCA
CATTTTGGACGATTATAAAACGAACAACGGTGATCAAAGACCCATCGAAA
GTTGTTGTCAATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTGGT
GAAAACCAAAACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGA
TGACCAGGCCACCCTCGATAATATGGAGTATCATTATGTCATCATTGTGT
TACTTTCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAAGTTAAT
TTCCTAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGAATTGAC
AAAACTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCGACACATGG
GATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCC
AAATGGAACCCATGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGACG
AAGAATGTTTTCCGACGCCATCACCACCCATCATAACGCCTGCACCACCC
ACAACACCTGACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTATTGC
TGTGATTATACTATTTAGTATAATATTTGTATGCTCCATACTGGGTGGTA
TCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTAATAACAAT
AACAACGGGAATAATTCTAACACAACACTTACTCCTCGAGCCAACAGTGG
TTTTGATGATGACCAATATCAACCAGGATATCAACCATCAGGCCACGCAC
CAAACGATCGACTAGGATCAGTACCATCACCGACTGATACCAAAGATGCT
GCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGA
AAATGGTTCAGTTAGTACCACGGCTTAACCCAGGCAGACTTGAATGCAAC
CCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAA
CATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGGAAAG
ATTTGGGTATTGTTCGAACGATATCAGCGAAACAAATTGTGAATGTCCTT
GCATACAACCCGTTACTTGTCTCAGTGATCTTCGAATTACCTTGATCACG
TGACCGAAGCGAAGAAATATGAATCGAATCGAAATTGTTTGGATTATCGA
GTTGTTCCGATTGTTGATTCCAATCTTTTATTATTGTATATTAATGACGC
TTGCACTTTACCAGAAAATTGTAACTGTGAAGAACCAATCAACAACCATA
GTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAATTAT
TGTTTGGAATTCCGAAACAATATAACCATCAAGGAATGGTTTTACTCTAG
CATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTT
ATGGAAAAGAATGAAAATTCAACCCTCGAAAATCAACACATCATTAAGAT
GGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCGATGGATTTCAAA
CTACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAATGAATGCGAAAC
TGATGGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACCACGC
CCTACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTC
CTACACATGTACATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGG
CTTACTGATGAATCCTTCATACGACCCAAGAGCTCGACCATGAGTATCGA
TGTTTTTAAAAATATACGGTTATCGGCACAAGCTACAAAATCTATGGATC
AATATTGGAAAAATGATACATCAGAGAAAGCAATCAGTATCATCGCAAGA
CTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTT
ACTTCAAACTAGAGACAAATGAGACGGTTCAGGAATTAAAAGACTTGTTC
ATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTG
GATCAAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCCTTTT
GGAGCCACTTCACAAAATAAAACATTGACTTATACTTGGAAAGCTGTTCC
AAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTGATTACGAAAAAT
CCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTT
GATCTATGGAATTCCACATATTTAGATGATCATATTTGCAAATACAGTGA
AACACAGGTAGCAGTCAAAGGTCAAACATTTATTCATCCGAAATTCGGAC
AACCGCTTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTACAAATC
GAATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGATATGATAAGGCA
CAACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAA
AATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTAT
TCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAA
GAAACGGGTCGTGACAACTTTATGGAATTTGAACTTGGAAAGGATAATAA
TCATTTTACCATCAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGA
ATTTCAACGACTTCGACGACAAAGTTCATTACATCATGCCTATATCTGAT
CGATTTGGAAGAGATGGAAAACTAGCGGGAGCAACGTACAGCAACAACAA
AAATCTTGCAGGAGTCGGATGTGATATAGAGAAAAACATTTCATCTTTGT
GACAAGTGGATACTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGT
TCAAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTA
CTAATATATGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTT
TCAGATACTATACAATGATAAGAATAATCAAACAGATTTCAGTAAAATTT
TATCATGAGGATAATTTGGTACCATCGGACAATAAAGCAGATTGTTTGAA
GATTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCCAACAAA
TTGAAAACAAACAGCCAAAAGTTCGCGACTATTGGAAACGTTACCGGGAA
GTGAAGGGAGACATTTTGTTATTATTCTGGATTATTCCGAAGAAATTAAA
GATACAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCTTGT
CACATTTAAAGATGAGGTTTCGATGAGCGACATTTGTGAGCAAACACCTC
CAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCC
ATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTA
TAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTCTTTAGATG
GTTATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAATGGAATGC
ACATGCGCACAAAGGGATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGA
AAGACGACCATAGCCGAAAACGTATTGAACGAAATGTCGAGTCACATTTT
GGACGATTATAAAACGAACAACGGTGATCAAAGACCCATCGAAAGTTGTT
GTCAATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAAAC
CAAAACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGATGACCA
GGCCACCCTCGATAATATGGAGTATCATTATGTCATCATTGTGTTACTTT
CATTTCATTGGTCAAACGTGAATGGACAAAATAACCAAGTTAATTTCCTA
GATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGAATTGACAAAACT
CGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCGACACATGGGATAAT
TGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGG
AACCCATGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAAT
GTTTTCCGACGCCATCACCACCCATCATAACGCCTGCACCACCCACAACA
CCTGACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGAT
TATACTATTTAGTATAATATTTGTATGCTCCATACTGGGTGGTATCTACT
GGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTAATAACAATAACAAC
GGGAATAATTCTAACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGA
TGATGACCAATATCAACCAGGATATCAACCATCAGGCCACGCACCAAACG
ATCGACTAGGATCAGTACCATCACCGACTGATACCAAAGATGCTGCAGTA
GAGATAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGG
TTCAGTTAGTACCACGGCTTAACCCAGGCAGACTTGAATGCAACCCAGAG
GACAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTC
AGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGGAAAGATTTGG
GTATTGTTCGAACGATATCAGCGAAACAAATTGTGAATGTCCTTGCATAC
AACCCGTTACTTGTCTCAGTGATCTTCGAATTACCTTGATCACGTGACCG
AAGCGAAGAAATATGAATCGAATCGAAATTGTTTGGATTATCGAGTTGTT
CCGATTGTTGATTCCAATCTTTTATTATTGTATATTAATGACGCTTGCAC
TTTACCAGAAAATTGTAACTGTGAAGAACCAATCAACAACCATAGTCGAG
TTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAATTATTGTTTG
GAATTCCGAAACAATATAACCATCAAGGAATGGTTTTACTCTAGCATGTG
TTGTGATTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAA
AAGAATGAAAATTCAACCCTCGAAAATCAACACATCATTAAGATGGGGCA
AGACTTCGACAGAGAAAGCAGGGAATATAGCGATGGATTTCAAACTACCC
TACTTTAAAGTGTTACTGGATAAGTCAATCAATGAATGCGAAACTGATGG
GTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACCACGCCCTACT
TGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCCTACAC
ATGTACATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACT
GATGAATCCTTCATACGACCCAAGAGCTCGACCATGAGTATCGATGTTTT
TAAAAATATACGGTTATCGGCACAAGCTACAAAATCTATGGATCAATATT
GGAAAAATGATACATCAGAGAAAGCAATCAGTATCATCGCAAGACTTGGC
AGTAATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTTACTTCA
AACTAGAGACAAATGAGACGGTTCAGGAATTAAAAGACTTGTTCATGCCT
GGGGAGACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAA
AGATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAGCC
ACTTCACAAAATAAAACATTGACTTATACTTGGAAAGCTGTTCCAAAGTC
TGACTTCATTTTGACTATTGTGACGTCATCTGATTACGAAAAATCCGAAC
TCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATCTA
TGGAATTCCACATATTTAGATGATCATATTTGCAAATACAGTGAAACACA
GGTAGCAGTCAAAGGTCAAACATTTATTCATCCGAAATTCGGACAACCGC
TTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTACAAATCGAATCT
TCACAAAGTTTCAAAGATGAAGTGTACAATGATATGATAAGGCACAACCA
TTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCA
ATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGA
AGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACG
GGTCGTGACAACTTTATGGAATTTGAACTTGGAAAGGATAATAATCATTT
TACCATCAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCA
ACGACTTCGACGACAAAGTTCATTACATCATGCCTATATCTGATCGATTT
GGAAGAGATGGAAAACTAGCGGGAGCAACGTACAGCAACAACAAAAATCT
TGCAGGAGTCGGATGTGATATAGAGAAAAACATTTCATCTTTGTGACAAG
TGGATACTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAG
ATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATA
TATGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGAT
ACTATACAATGATAAGAATAATCAAACAGATTTCAGTAAAATTTTATCAT
GAGGATAATTTGGTACCATCGGACAATAAAGCAGATTGTTTGAAGATTTC
ATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCCAACAAATTGAAA
ACAAACAGCCAAAAGTTCGCGACTATTGGAAACGTTACCGGGAAGTGAAG
GGAGACATTTTGTTATTATTCTGGATTATTCCGAAGAAATTAAAGATACA
ATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCTTGTCACATT
TAAAGATGAGGTTTCGATGAGCGACATTTGTGAGCAAACACCTCCAAGCA
ATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCAC
TACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTATAAAGA
AGCCAAAGGCGAAGCAAGGAACATTCAATACGACTCTTTAGATGGTTATT
CGTTCACTTATCCTGCTTATCAAGATCCTTCACCAATGGAATGCACATGC
GCACAAAGGGATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGACG
ACCATAGCCGAAAACGTATTGAACGAAATGTCGAGTCACATTTTGGACGA
TTATAAAACGAACAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAAT
TTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAAAC
CTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGATGACCAGGCCAC
CCTCGATAATATGGAGTATCATTATGTCATCATTGTGTTACTTTCATTTC
ATTGGTCAAACGTGAATGGACAAAATAACCAAGTTAATTTCCTAGATTTA
TTGAAAGATGATGCCAAAACTTTTCAACAAGAATTGACAAAACTCGTCAA
TGAGAACCTTGGTCATGAAACTTTGCAGCGACACATGGGATAATTGTGAA
AGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCA
TGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAATGTTTTC
CGACGCCATCACCACCCATCATAACGCCTGCACCACCCACAACACCTGAC
TCGCAAGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGATTATACT
ATTTAGTATAATATTTGTATGCTCCATACTGGGTGGTATCTACTGGTGGT
TCAATAAAAAAGCTAAACGAAGACAACGTAATAACAATAACAACGGGAAT
AATTCTAACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGA
CCAATATCAACCAGGATATCAACCATCAGGCCACGCACCAAACGATCGAC
TAGGATCAGTACCATCACCGACTGATACCAAAGATGCTGCAGTAGAGATA
ACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGT
TAGTACCACGGCTTAACCCAGGCAGACTTGAATGCAACCCAGAGGACAAA
CGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGCT
TACTCTCTGTTTTGACCCTGAATGCAAGAAACGGAAAGATTTGGGTATTG
TTCGAACGATATCAGCGAAACAAATTGTGAATGTCCTTGCATACAACCCG
TTACTTGTCTCAGTGATCTTCGAATTACCTTGATCACGTGACCGAAGCGA
AGAAATATGAATCGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGATT
GTTGATTCCAATCTTTTATTATTGTATATTAATGACGCTTGCACTTTACC
AGAAAATTGTAACTGTGAAGAACCAATCAACAACCATAGTCGAGTTGCAA
AGAGCATGATCGAAGAGGGAGTTATGATAAAAAATTATTGTTTGGAATTC
CGAAACAATATAACCATCAAGGAATGGTTTTACTCTAGCATGTGTTGTGA
TTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAAT
GAAAATTCAACCCTCGAAAATCAACACATCATTAAGATGGGGCAAGACTT
CGACAGAGAAAGCAGGGAATATAGCGATGGATTTCAAACTACCCTACTTT
AAAGTGTTACTGGATAAGTCAATCAATGAATGCGAAACTGATGGGTACCG
CCTCATGATTGCTCAAAAAGGGATGACATTAACCACGCCCTACTTGGATG
CCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCCTACACATGTAC
ATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAA
TCCTTCATACGACCCAAGAGCTCGACCATGAGTATCGATGTTTTTAAAAA
TATACGGTTATCGGCACAAGCTACAAAATCTATGGATCAATATTGGAAAA
ATGATACATCAGAGAAAGCAATCAGTATCATCGCAAGACTTGGCAGTAAT
CAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAG
AGACAAATGAGACGGTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAG
ACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTC
TATCAGACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAGCCACTTCA
CAAAATAAAACATTGACTTATACTTGGAAAGCTGTTCCAAAGTCTGACTT
CATTTTGACTATTGTGACGTCATCTGATTACGAAAAATCCGAACTCAAAA
TCACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATCTATGGAAT
TCCACATATTTAGATGATCATATTTGCAAATACAGTGAAACACAGGTAGC
AGTCAAAGGTCAAACATTTATTCATCCGAAATTCGGACAACCGCTTGGAT
CAGATGAACTTTCTCGGACAGTTAATATTTTACAAATCGAATCTTCACAA
AGTTTCAAAGATGAAGTGTACAATGATATGATAAGGCACAACCATTGACG
CATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGAAA
GGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAATG
GAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGGTCGT
GACAACTTTATGGAATTTGAACTTGGAAAGGATAATAATCATTTTACCAT
CAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACT
TCGACGACAAAGTTCATTACATCATGCCTATATCTGATCGATTTGGAAGA
GATGGAAAACTAGCGGGAGCAACGTACAGCAACAACAAAAATCTTGCAGG
AGTCGGATGTGATATAGAGAAAAACATTTCATCTTTGTGACAAGTGGATA
CTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGC
GGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGT
GAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGATACTATA
CAATGATAAGAATAATCAAACAGATTTCAGTAAAATTTTATCATGAGGAT
AATTTGGTACCATCGGACAATAAAGCAGATTGTTTGAAGATTTCATCAAA
AGCAACTCCTTATCTCAAAGATAAAATTCTCCAACAAATTGAAAACAAAC
AGCCAAAAGTTCGCGACTATTGGAAACGTTACCGGGAAGTGAAGGGAGAC
ATTTTGTTATTATTCTGGATTATTCCGAAGAAATTAAAGATACAATCTCA
ATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCTTGTCACATTTAAAGA
TGAGGTTTCGATGAGCGACATTTGTGAGCAAACACCTCCAAGCAATTCGA
AAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTA
AAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTATAAAGAAGCCAA
AGGCGAAGCAAGGAACATTCAATACGACTCTTTAGATGGTTATTCGTTCA
CTTATCCTGCTTATCAAGATCCTTCACCAATGGAATGCACATGCGCACAA
AGGGATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGACGACCATA
GCCGAAAACGTATTGAACGAAATGTCGAGTCACATTTTGGACGATTATAA
AACGAACAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATG
ATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTAAT
GATATGTCTGAAGATGATGCAACTAGCTTTGATGACCAGGCCACCCTCGA
TAATATGGAGTATCATTATGTCATCATTGTGTTACTTTCATTTCATTGGT
CAAACGTGAATGGACAAAATAACCAAGTTAATTTCCTAGATTTATTGAAA
GATGATGCCAAAACTTTTCAACAAGAATTGACAAAACTCGTCAATGAGAA
CCTTGGTCATGAAACTTTGCAGCGACACATGGGATAATTGTGAAAGTTTC
AAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGC
CGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGACGC
CATCACCACCCATCATAACGCCTGCACCACCCACAACACCTGACTCGCAA
GAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGATTATACTATTTAG
TATAATATTTGTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAATA
AAAAAGCTAAACGAAGACAACGTAATAACAATAACAACGGGAATAATTCT
AACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAATA
TCAACCAGGATATCAACCATCAGGCCACGCACCAAACGATCGACTAGGAT
CAGTACCATCACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAATG
CCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTAC
CACGGCTTAACCCAGGCAGACTTGAATGCAACCCAGAGGACAAACGAAAA
ACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGCTTACTCT
CTGTTTTGACCCTGAATGCAAGAAACGGAAAGATTTGGGTATTGTTCGAA
CGATATCAGCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTTACTT
GTCTCAGTGATCTTCGAATTACCTTGATCACGTGACCGAAGCGAAGAAAT
ATGAATCGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTGAT
TCCAATCTTTTATTATTGTATATTAATGACGCTTGCACTTTACCAGAAAA
TTGTAACTGTGAAGAACCAATCAACAACCATAGTCGAGTTGCAAAGAGCA
TGATCGAAGAGGGAGTTATGATAAAAAATTATTGTTTGGAATTCCGAAAC
AATATAACCATCAAGGAATGGTTTTACTCTAGCATGTGTTGTGATTGATC
GAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAAAT
TCAACCCTCGAAAATCAACACATCATTAAGATGGGGCAAGACTTCGACAG
AGAAAGCAGGGAATATAGCGATGGATTTCAAACTACCCTACTTTAAAGTG
TTACTGGATAAGTCAATCAATGAATGCGAAACTGATGGGTACCGCCTCAT
GATTGCTCAAAAAGGGATGACATTAACCACGCCCTACTTGGATGCCTTTA
CTGGTGAAACTGTTATGACTCTTGGACAAGTCCTACACATGTACATTGGT
ATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAATCCTTC
ATACGACCCAAGAGCTCGACCATGAGTATCGATGTTTTTAAAAATATACG
GTTATCGGCACAAGCTACAAAATCTATGGATCAATATTGGAAAAATGATA
CATCAGAGAAAGCAATCAGTATCATCGCAAGACTTGGCAGTAATCAAATT
TCCAGCAGATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAA
ATGAGACGGTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCA
ACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTATCAG
ACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAGCCACTTCACAAAAT
AAAACATTGACTTATACTTGGAAAGCTGTTCCAAAGTCTGACTTCATTTT
GACTATTGTGACGTCATCTGATTACGAAAAATCCGAACTCAAAATCACCA
ATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATCTATGGAATTCCACA
TATTTAGATGATCATATTTGCAAATACAGTGAAACACAGGTAGCAGTCAA
AGGTCAAACATTTATTCATCCGAAATTCGGACAACCGCTTGGATCAGATG
AACTTTCTCGGACAGTTAATATTTTACAAATCGAATCTTCACAAAGTTTC
AAAGATGAAGTGTACAATGATATGATAAGGCACAACCATTGACGCATGTA
AAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCC
GTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAATGGAGTCA
AACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGGTCGTGACAAC
TTTATGGAATTTGAACTTGGAAAGGATAATAATCATTTTACCATCAATTC
CAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACTTCGACG
ACAAAGTTCATTACATCATGCCTATATCTGATCGATTTGGAAGAGATGGA
AAACTAGCGGGAGCAACGTACAGCAACAACAAAAATCTTGCAGGAGTCGG
ATGTGATATAGAGAAAAACATTTCATCTTTGTGACAAGTGGATACTACAA
GGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAA
GTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGTGAAGCA
GCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGATACTATACAATGA
TAAGAATAATCAAACAGATTTCAGTAAAATTTTATCATGAGGATAATTTG
GTACCATCGGACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAAC
TCCTTATCTCAAAGATAAAATTCTCCAACAAATTGAAAACAAACAGCCAA
AAGTTCGCGACTATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTG
TTATTATTCTGGATTATTCCGAAGAAATTAAAGATACAATCTCAATTGTG
AAGAAAGTTGCAAAGACATTGCTCAACCTTGTCACATTTAAAGATGAGGT
TTCGATGAGCGACATTTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCT
GTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAAAGAAA
GAGGATTTGGTCACGAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGA
AGCAAGGAACATTCAATACGACTCTTTAGATGGTTATTCGTTCACTTATC
CTGCTTATCAAGATCCTTCACCAATGGAATGCACATGCGCACAAAGGGAT
CCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAA
AACGTATTGAACGAAATGTCGAGTCACATTTTGGACGATTATAAAACGAA
CAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATGATTCAA
AACTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTAATGATATG
TCTGAAGATGATGCAACTAGCTTTGATGACCAGGCCACCCTCGATAATAT
GGAGTATCATTATGTCATCATTGTGTTACTTTCATTTCATTGGTCAAACG
TGAATGGACAAAATAACCAAGTTAATTTCCTAGATTTATTGAAAGATGAT
GCCAAAACTTTTCAACAAGAATTGACAAAACTCGTCAATGAGAACCTTGG
TCATGAAACTTTGCAGCGACACATGGGATAATTGTGAAAGTTTCAAACCT
GCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGCCGACGA
GAAAAAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGACGCCATCAC
CACCCATCATAACGCCTGCACCACCCACAACACCTGACTCGCAAGAAACT
GAGGACCTATCAGATGGTGCTATTGCTGTGATTATACTATTTAGTATAAT
ATTTGTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAG
CTAAACGAAGACAACGTAATAACAATAACAACGGGAATAATTCTAACACA
ACACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAATATCAACC
AGGATATCAACCATCAGGCCACGCACCAAACGATCGACTAGGATCAGTAC
CATCACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCA
GTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGC
TTAACCCAGGCAGACTTGAATGCAACCCAGAGGACAAACGAAAAACAGAT
TTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGCTTACTCTCTGTTT
TGACCCTGAATGCAAGAAACGGAAAGATTTGGGTATTGTTCGAACGATAT
CAGCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTCA
GTGATCTTCGAATTACCTTGATCACGTGACCGAAGCGAAGAAATATGAAT
CGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCAAT
CTTTTATTATTGTATATTAATGACGCTTGCACTTTACCAGAAAATTGTAA
CTGTGAAGAACCAATCAACAACCATAGTCGAGTTGCAAAGAGCATGATCG
AAGAGGGAGTTATGATAAAAAATTATTGTTTGGAATTCCGAAACAATATA
ACCATCAAGGAATGGTTTTACTCTAGCATGTGTTGTGATTGATCGAAATG
GCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAAATTCAACC
CTCGAAAATCAACACATCATTAAGATGGGGCAAGACTTCGACAGAGAAAG
CAGGGAATATAGCGATGGATTTCAAACTACCCTACTTTAAAGTGTTACTG
GATAAGTCAATCAATGAATGCGAAACTGATGGGTACCGCCTCATGATTGC
TCAAAAAGGGATGACATTAACCACGCCCTACTTGGATGCCTTTACTGGTG
AAACTGTTATGACTCTTGGACAAGTCCTACACATGTACATTGGTATGGAG
AATGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAATCCTTCATACGA
CCCAAGAGCTCGACCATGAGTATCGATGTTTTTAAAAATATACGGTTATC
GGCACAAGCTACAAAATCTATGGATCAATATTGGAAAAATGATACATCAG
AGAAAGCAATCAGTATCATCGCAAGACTTGGCAGTAATCAAATTTCCAGC
AGATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAATGAGA
CGGTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAACACCT
CGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTATCAGACGTAA
TGATGCCAATATCTCGAGGGCCTTTTGGAGCCACTTCACAAAATAAAACA
TTGACTTATACTTGGAAAGCTGTTCCAAAGTCTGACTTCATTTTGACTAT
TGTGACGTCATCTGATTACGAAAAATCCGAACTCAAAATCACCAATCAAG
GAGGGGCGGAAGATTATCATCGCCTTGATCTATGGAATTCCACATATTTA
GATGATCATATTTGCAAATACAGTGAAACACAGGTAGCAGTCAAAGGTCA
AACATTTATTCATCCGAAATTCGGACAACCGCTTGGATCAGATGAACTTT
CTCGGACAGTTAATATTTTACAAATCGAATCTTCACAAAGTTTCAAAGAT
GAAGTGTACAATGATATGATAAGGCACAACCATTGACGCATGTAAAGCAG
TGGTGGATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCCGTTTGT
CTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAACGGA
AAATTCTTATTGGTTCCTTATCAAAAGAAACGGGTCGTGACAACTTTATG
GAATTTGAACTTGGAAAGGATAATAATCATTTTACCATCAATTCCAAGAT
ATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACTTCGACGACAAAG
TTCATTACATCATGCCTATATCTGATCGATTTGGAAGAGATGGAAAACTA
GCGGGAGCAACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGA
TATAGAGAAAAACATTTCATCTTTGTGACAAGTGGATACTACAAGGATGG
CAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGG
AATGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGTGAAGCAGCTAGC
TATAAGAAGATCTTTGAAGAAACTTTTCAGATACTATACAATGATAAGAA
TAATCAAACAGATTTCAGTAAAATTTTATCATGAGGATAATTTGGTACCA
TCGGACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTA
TCTCAAAGATAAAATTCTCCAACAAATTGAAAACAAACAGCCAAAAGTTC
GCGACTATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTA
TTCTGGATTATTCCGAAGAAATTAAAGATACAATCTCAATTGTGAAGAAA
GTTGCAAAGACATTGCTCAACCTTGTCACATTTAAAGATGAGGTTTCGAT
GAGCGACATTTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCT
CTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGAGGAT
TTGGTCACGAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAG
GAACATTCAATACGACTCTTTAGATGGTTATTCGTTCACTTATCCTGCTT
ATCAAGATCCTTCACCAATGGAATGCACATGCGCACAAAGGGATCCCAGA
TTCAGTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAAAACGTA
TTGAACGAAATGTCGAGTCACATTTTGGACGATTATAAAACGAACAACGG
TGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATGATTCAAAACTGG
GATTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTAATGATATGTCTGAA
GATGATGCAACTAGCTTTGATGACCAGGCCACCCTCGATAATATGGAGTA
TCATTATGTCATCATTGTGTTACTTTCATTTCATTGGTCAAACGTGAATG
GACAAAATAACCAAGTTAATTTCCTAGATTTATTGAAAGATGATGCCAAA
ACTTTTCAACAAGAATTGACAAAACTCGTCAATGAGAACCTTGGTCATGA
AACTTTGCAGCGACACATGGGATAATTGTGAAAGTTTCAAACCTGCTTGC
AACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGCCGACGAGAAAAA
GCATTGTGATTATTCTGACGAAGAATGTTTTCCGACGCCATCACCACCCA
TCATAACGCCTGCACCACCCACAACACCTGACTCGCAAGAAACTGAGGAC
CTATCAGATGGTGCTATTGCTGTGATTATACTATTTAGTATAATATTTGT
ATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAAAC
GAAGACAACGTAATAACAATAACAACGGGAATAATTCTAACACAACACTT
ACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAATATCAACCAGGATA
TCAACCATCAGGCCACGCACCAAACGATCGACTAGGATCAGTACCATCAC
CGACTGATACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGTAC
GAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAACC
CAGGCAGACTTGAATGCAACCCAGAGGACAAACGAAAAACAGATTTCTCA
GAAAAATGGTTCAAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCC
TGAATGCAAGAAACGGAAAGATTTGGGTATTGTTCGAACGATATCAGCGA
AACAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTCAGTGATC
TTCGAATTACCTTGATCACGTGACCGAAGCGAAGAAATATGAATCGAATC
GAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCAATCTTTTA
TTATTGTATATTAATGACGCTTGCACTTTACCAGAAAATTGTAACTGTGA
AGAACCAATCAACAACCATAGTCGAGTTGCAAAGAGCATGATCGAAGAGG
GAGTTATGATAAAAAATTATTGTTTGGAATTCCGAAACAATATAACCATC
AAGGAATGGTTTTACTCTAGCATGTGTTGTGATTGATCGAAATGGCTTCG
TGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAAATTCAACCCTCGAA
AATCAACACATCATTAAGATGGGGCAAGACTTCGACAGAGAAAGCAGGGA
ATATAGCGATGGATTTCAAACTACCCTACTTTAAAGTGTTACTGGATAAG
TCAATCAATGAATGCGAAACTGATGGGTACCGCCTCATGATTGCTCAAAA
AGGGATGACATTAACCACGCCCTACTTGGATGCCTTTACTGGTGAAACTG
TTATGACTCTTGGACAAGTCCTACACATGTACATTGGTATGGAGAATGGT
TTCTTCCGTATTTACCCTGGCTTACTGATGAATCCTTCATACGACCCAAG
AGCTCGACCATGAGTATCGATGTTTTTAAAAATATACGGTTATCGGCACA
AGCTACAAAATCTATGGATCAATATTGGAAAAATGATACATCAGAGAAAG
CAATCAGTATCATCGCAAGACTTGGCAGTAATCAAATTTCCAGCAGATGC
TTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAATGAGACGGTTC
AGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTGGC
CTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTATCAGACGTAATGATGC
CAATATCTCGAGGGCCTTTTGGAGCCACTTCACAAAATAAAACATTGACT
TATACTTGGAAAGCTGTTCCAAAGTCTGACTTCATTTTGACTATTGTGAC
GTCATCTGATTACGAAAAATCCGAACTCAAAATCACCAATCAAGGAGGGG
CGGAAGATTATCATCGCCTTGATCTATGGAATTCCACATATTTAGATGAT
CATATTTGCAAATACAGTGAAACACAGGTAGCAGTCAAAGGTCAAACATT
TATTCATCCGAAATTCGGACAACCGCTTGGATCAGATGAACTTTCTCGGA
CAGTTAATATTTTACAAATCGAATCTTCACAAAGTTTCAAAGATGAAGTG
TACAATGATATGATAAGGCACAACCATTGACGCATGTAAAGCAGTGGTGG
ATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCT
TTTCTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTC
TTATTGGTTCCTTATCAAAAGAAACGGGTCGTGACAACTTTATGGAATTT
GAACTTGGAAAGGATAATAATCATTTTACCATCAATTCCAAGATATCTGC
CATTTTATCCTCCGCTAAGAATTTCAACGACTTCGACGACAAAGTTCATT
ACATCATGCCTATATCTGATCGATTTGGAAGAGATGGAAAACTAGCGGGA
GCAACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATATAGA
GAAAAACATTTCATCTTTGTGACAAGTGGATACTACAAGGATGGCAGTTG
GTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTG
GCGTTTCTTTTTCTCTTCTACTAATATATGGTGAAGCAGCTAGCTATAAG
AAGATCTTTGAAGAAACTTTTCAGATACTATACAATGATAAGAATAATCA
AACAGATTTCAGTAAAATTTTATCATGAGGATAATTTGGTACCATCGGAC
AATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAA
AGATAAAATTCTCCAACAAATTGAAAACAAACAGCCAAAAGTTCGCGACT
ATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTATTCTGG
ATTATTCCGAAGAAATTAAAGATACAATCTCAATTGTGAAGAAAGTTGCA
AAGACATTGCTCAACCTTGTCACATTTAAAGATGAGGTTTCGATGAGCGA
CATTTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTG
GAAGTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGAGGATTTGGTC
ACGAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACAT
TCAATACGACTCTTTAGATGGTTATTCGTTCACTTATCCTGCTTATCAAG
ATCCTTCACCAATGGAATGCACATGCGCACAAAGGGATCCCAGATTCAGT
TTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAAAACGTATTGAAC
GAAATGTCGAGTCACATTTTGGACGATTATAAAACGAACAACGGTGATCA
AAGACCCATCGAAAGTTGTTGTCAATTTGATGATTCAAAACTGGGATTTG
TTTCAGTCTTTGGTGAAAACCAAAACCTTAATGATATGTCTGAAGATGAT
GCAACTAGCTTTGATGACCAGGCCACCCTCGATAATATGGAGTATCATTA
TGTCATCATTGTGTTACTTTCATTTCATTGGTCAAACGTGAATGGACAAA
ATAACCAAGTTAATTTCCTAGATTTATTGAAAGATGATGCCAAAACTTTT
CAACAAGAATTGACAAAACTCGTCAATGAGAACCTTGGTCATGAAACTTT
GCAGCGACACATGGGATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGG
TGTTTCAAATTCCCAAATGGAACCCATGTTGCCGACGAGAAAAAGCATTG
TGATTATTCTGACGAAGAATGTTTTCCGACGCCATCACCACCCATCATAA
CGCCTGCACCACCCACAACACCTGACTCGCAAGAAACTGAGGACCTATCA
GATGGTGCTATTGCTGTGATTATACTATTTAGTATAATATTTGTATGCTC
CATACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGAC
AACGTAATAACAATAACAACGGGAATAATTCTAACACAACACTTACTCCT
CGAGCCAACAGTGGTTTTGATGATGACCAATATCAACCAGGATATCAACC
ATCAGGCCACGCACCAAACGATCGACTAGGATCAGTACCATCACCGACTG
ATACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAG
AGACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAACCCAGGCA
GACTTGAATGCAACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAA
TGGTTCAAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATG
CAAGAAACGGAAAGATTTGGGTATTGTTCGAACGATATCAGCGAAACAAA
TTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTCAGTGATCTTCGAA
TTACCTTGATCACGTGACCGAAGCGAAGAAATATGAATCGAATCGAAATT
GTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATTG
TATATTAATGACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAACC
AATCAACAACCATAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTA
TGATAAAAAATTATTGTTTGGAATTCCGAAACAATATAACCATCAAGGAA
TGGTTTTACTCTAGCATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTT
ACCAATCGAGTTTTATGGAAAAGAATGAAAATTCAACCCTCGAAAATCAA
CACATCATTAAGATGGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAG
CGATGGATTTCAAACTACCCTACTTTAAAGTGTTACTGGATAAGTCAATC
AATGAATGCGAAACTGATGGGTACCGCCTCATGATTGCTCAAAAAGGGAT
GACATTAACCACGCCCTACTTGGATGCCTTTACTGGTGAAACTGTTATGA
CTCTTGGACAAGTCCTACACATGTACATTGGTATGGAGAATGGTTTCTTC
CGTATTTACCCTGGCTTACTGATGAATCCTTCATACGACCCAAGAGCTCG
ACCATGAGTATCGATGTTTTTAAAAATATACGGTTATCGGCACAAGCTAC
AAAATCTATGGATCAATATTGGAAAAATGATACATCAGAGAAAGCAATCA
GTATCATCGCAAGACTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCT
CAGGCCAAGTATTTACTTCAAACTAGAGACAAATGAGACGGTTCAGGAAT
TAAAAGACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTC
AAGCGGTGTTCCTGGATCAAAGATTCTATCAGACGTAATGATGCCAATAT
CTCGAGGGCCTTTTGGAGCCACTTCACAAAATAAAACATTGACTTATACT
TGGAAAGCTGTTCCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATC
TGATTACGAAAAATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAG
ATTATCATCGCCTTGATCTATGGAATTCCACATATTTAGATGATCATATT
TGCAAATACAGTGAAACACAGGTAGCAGTCAAAGGTCAAACATTTATTCA
TCCGAAATTCGGACAACCGCTTGGATCAGATGAACTTTCTCGGACAGTTA
ATATTTTACAAATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACAAT
GATATGATAAGGCACAACCATTGACGCATGTAAAGCAGTGGTGGATAAAA
GTTCATCTTCACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTG
ACCAATGAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTG
GTTCCTTATCAAAAGAAACGGGTCGTGACAACTTTATGGAATTTGAACTT
GGAAAGGATAATAATCATTTTACCATCAATTCCAAGATATCTGCCATTTT
ATCCTCCGCTAAGAATTTCAACGACTTCGACGACAAAGTTCATTACATCA
TGCCTATATCTGATCGATTTGGAAGAGATGGAAAACTAGCGGGAGCAACG
TACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGAAAAA
CATTTCATCTTTGTGACAAGTGGATACTACAAGGATGGCAGTTGGTCTGA
AGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTT
CTTTTTCTCTTCTACTAATATATGGTGAAGCAGCTAGCTATAAGAAGATC
TTTGAAGAAACTTTTCAGATACTATACAATGATAAGAATAATCAAACAGA
TTTCAGTAAAATTTTATCATGAGGATAATTTGGTACCATCGGACAATAAA
GCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAA
AATTCTCCAACAAATTGAAAACAAACAGCCAAAAGTTCGCGACTATTGGA
AACGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATT
CCGAAGAAATTAAAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACA
TTGCTCAACCTTGTCACATTTAAAGATGAGGTTTCGATGAGCGACATTTG
TGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTC
CTCCATCAGAATCCATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAA
TGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATA
CGACTCTTTAGATGGTTATTCGTTCACTTATCCTGCTTATCAAGATCCTT
CACCAATGGAATGCACATGCGCACAAAGGGATCCCAGATTCAGTTTGTCA
AAGACCTTGCGGGAAAGACGACCATAGCCGAAAACGTATTGAACGAAATG
TCGAGTCACATTTTGGACGATTATAAAACGAACAACGGTGATCAAAGACC
CATCGAAAGTTGTTGTCAATTTGATGATTCAAAACTGGGATTTGTTTCAG
TCTTTGGTGAAAACCAAAACCTTAATGATATGTCTGAAGATGATGCAACT
AGCTTTGATGACCAGGCCACCCTCGATAATATGGAGTATCATTATGTCAT
CATTGTGTTACTTTCATTTCATTGGTCAAACGTGAATGGACAAAATAACC
AAGTTAATTTCCTAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAA
GAATTGACAAAACTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCG
ACACATGGGATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTC
AAATTCCCAAATGGAACCCATGTTGCCGACGAGAAAAAGCATTGTGATTA
TTCTGACGAAGAATGTTTTCCGACGCCATCACCACCCATCATAACGCCTG
CACCACCCACAACACCTGACTCGCAAGAAACTGAGGACCTATCAGATGGT
GCTATTGCTGTGATTATACTATTTAGTATAATATTTGTATGCTCCATACT
GGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTA
ATAACAATAACAACGGGAATAATTCTAACACAACACTTACTCCTCGAGCC
AACAGTGGTTTTGATGATGACCAATATCAACCAGGATATCAACCATCAGG
CCACGCACCAAACGATCGACTAGGATCAGTACCATCACCGACTGATACCA
AAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAGAGACCT
GCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAACCCAGGCAGACTTG
AATGCAACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTC
AAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAA
ACGGAAAGATTTGGGTATTGTTCGAACGATATCAGCGAAACAAATTGTGA
ATGTCCTTGCATACAACCCGTTACTTGTCTCAGTGATCTTCGAATTACCT
TGATCACGTGACCGAAGCGAAGAAATATGAATCGAATCGAAATTGTTTGG
ATTATCGAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATTGTATATT
AATGACGCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAACCAATCAA
CAACCATAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAA
AAAATTATTGTTTGGAATTCCGAAACAATATAACCATCAAGGAATGGTTT
TACTCTAGCATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTACCAAT
CGAGTTTTATGGAAAAGAATGAAAATTCAACCCTCGAAAATCAACACATC
ATTAAGATGGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCGATGG
ATTTCAAACTACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAATGAA
TGCGAAACTGATGGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATT
AACCACGCCCTACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTG
GACAAGTCCTACACATGTACATTGGTATGGAGAATGGTTTCTTCCGTATT
TACCCTGGCTTACTGATGAATCCTTCATACGACCCAAGAGCTCGACCATG
AGTATCGATGTTTTTAAAAATATACGGTTATCGGCACAAGCTACAAAATC
TATGGATCAATATTGGAAAAATGATACATCAGAGAAAGCAATCAGTATCA
TCGCAAGACTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGGCC
AAGTATTTACTTCAAACTAGAGACAAATGAGACGGTTCAGGAATTAAAAG
ACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGCGG
TGTTCCTGGATCAAAGATTCTATCAGACGTAATGATGCCAATATCTCGAG
GGCCTTTTGGAGCCACTTCACAAAATAAAACATTGACTTATACTTGGAAA
GCTGTTCCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTGATTA
CGAAAAATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATC
ATCGCCTTGATCTATGGAATTCCACATATTTAGATGATCATATTTGCAAA
TACAGTGAAACACAGGTAGCAGTCAAAGGTCAAACATTTATTCATCCGAA
ATTCGGACAACCGCTTGGATCAGATGAACTTTCTCGGACAGTTAATATTT
TACAAATCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGATATG
ATAAGGCACAACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCAT
CTTCACAAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAAT
GAATTTATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCT
TATCAAAAGAAACGGGTCGTGACAACTTTATGGAATTTGAACTTGGAAAG
GATAATAATCATTTTACCATCAATTCCAAGATATCTGCCATTTTATCCTC
CGCTAAGAATTTCAACGACTTCGACGACAAAGTTCATTACATCATGCCTA
TATCTGATCGATTTGGAAGAGATGGAAAACTAGCGGGAGCAACGTACAGC
AACAACAAAAATCTTGCAGGAGTCGGATGTGATATAGAGAAAAACATTTC
ATCTTTGTGACAAGTGGATACTACAAGGATGGCAGTTGGTCTGAAGTTGA
GAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTT
CTCTTCTACTAATATATGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAA
GAAACTTTTCAGATACTATACAATGATAAGAATAATCAAACAGATTTCAG
TAAAATTTTATCATGAGGATAATTTGGTACCATCGGACAATAAAGCAGAT
TGTTTGAAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCT
CCAACAAATTGAAAACAAACAGCCAAAAGTTCGCGACTATTGGAAACGTT
ACCGGGAAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATTCCGAAG
AAATTAAAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTC
AACCTTGTCACATTTAAAGATGAGGTTTCGATGAGCGACATTTGTGAGCA
AACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCAT
CAGAATCCATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAG
GATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTC
TTTAGATGGTTATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAA
TGGAATGCACATGCGCACAAAGGGATCCCAGATTCAGTTTGTCAAAGACC
TTGCGGGAAAGACGACCATAGCCGAAAACGTATTGAACGAAATGTCGAGT
CACATTTTGGACGATTATAAAACGAACAACGGTGATCAAAGACCCATCGA
AAGTTGTTGTCAATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTG
GTGAAAACCAAAACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTT
GATGACCAGGCCACCCTCGATAATATGGAGTATCATTATGTCATCATTGT
GTTACTTTCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAAGTTA
ATTTCCTAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGAATTG
ACAAAACTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCGACACAT
GGGATAATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTC
CCAAATGGAACCCATGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGA
CGAAGAATGTTTTCCGACGCCATCACCACCCATCATAACGCCTGCACCAC
CCACAACACCTGACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTATT
GCTGTGATTATACTATTTAGTATAATATTTGTATGCTCCATACTGGGTGG
TATCTACTGGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTAATAACA
ATAACAACGGGAATAATTCTAACACAACACTTACTCCTCGAGCCAACAGT
GGTTTTGATGATGACCAATATCAACCAGGATATCAACCATCAGGCCACGC
ACCAAACGATCGACTAGGATCAGTACCATCACCGACTGATACCAAAGATG
CTGCAGTAGAGATAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGAT
GAAAATGGTTCAGTTAGTACCACGGCTTAACCCAGGCAGACTTGAATGCA
ACCCAGAGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGA
AACATTTCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGGAA
AGATTTGGGTATTGTTCGAACGATATCAGCGAAACAAATTGTGAATGTCC
TTGCATACAACCCGTTACTTGTCTCAGTGATCTTCGAATTACCTTGATCA
CGTGACCGAAGCGAAGAAATATGAATCGAATCGAAATTGTTTGGATTATC
GAGTTGTTCCGATTGTTGATTCCAATCTTTTATTATTGTATATTAATGAC
GCTTGCACTTTACCAGAAAATTGTAACTGTGAAGAACCAATCAACAACCA
TAGTCGAGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAATT
ATTGTTTGGAATTCCGAAACAATATAACCATCAAGGAATGGTTTTACTCT
AGCATGTGTTGTGATTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTT
TTATGGAAAAGAATGAAAATTCAACCCTCGAAAATCAACACATCATTAAG
ATGGGGCAAGACTTCGACAGAGAAAGCAGGGAATATAGCGATGGATTTCA
AACTACCCTACTTTAAAGTGTTACTGGATAAGTCAATCAATGAATGCGAA
ACTGATGGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACCAC
GCCCTACTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAG
TCCTACACATGTACATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCT
GGCTTACTGATGAATCCTTCATACGACCCAAGAGCTCGACCATGAGTATC
GATGTTTTTAAAAATATACGGTTATCGGCACAAGCTACAAAATCTATGGA
TCAATATTGGAAAAATGATACATCAGAGAAAGCAATCAGTATCATCGCAA
GACTTGGCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGTAT
TTACTTCAAACTAGAGACAAATGAGACGGTTCAGGAATTAAAAGACTTGT
TCATGCCTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCC
TGGATCAAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCCTT
TTGGAGCCACTTCACAAAATAAAACATTGACTTATACTTGGAAAGCTGTT
CCAAAGTCTGACTTCATTTTGACTATTGTGACGTCATCTGATTACGAAAA
ATCCGAACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCGCC
TTGATCTATGGAATTCCACATATTTAGATGATCATATTTGCAAATACAGT
GAAACACAGGTAGCAGTCAAAGGTCAAACATTTATTCATCCGAAATTCGG
ACAACCGCTTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTACAAA
TCGAATCTTCACAAAGTTTCAAAGATGAAGTGTACAATGATATGATAAGG
CACAACCATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCAC
AAAATCCAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTT
ATTCGCGAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAA
AAGAAACGGGTCGTGACAACTTTATGGAATTTGAACTTGGAAAGGATAAT
AATCATTTTACCATCAATTCCAAGATATCTGCCATTTTATCCTCCGCTAA
GAATTTCAACGACTTCGACGACAAAGTTCATTACATCATGCCTATATCTG
ATCGATTTGGAAGAGATGGAAAACTAGCGGGAGCAACGTACAGCAACAAC
AAAAATCTTGCAGGAGTCGGATGTGATATAGAGAAAAACATTTCATCTTT
GTGACAAGTGGATACTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGG
GTTCAAAGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTC
TACTAATATATGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACT
TTTCAGATACTATACAATGATAAGAATAATCAAACAGATTTCAGTAAAAT
TTTATCATGAGGATAATTTGGTACCATCGGACAATAAAGCAGATTGTTTG
AAGATTTCATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCCAACA
AATTGAAAACAAACAGCCAAAAGTTCGCGACTATTGGAAACGTTACCGGG
AAGTGAAGGGAGACATTTTGTTATTATTCTGGATTATTCCGAAGAAATTA
AAGATACAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCTT
GTCACATTTAAAGATGAGGTTTCGATGAGCGACATTTGTGAGCAAACACC
TCCAAGCAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAAT
CCATTCACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTT
TATAAAGAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTCTTTAGA
TGGTTATTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAATGGAAT
GCACATGCGCACAAAGGGATCCCAGATTCAGTTTGTCAAAGACCTTGCGG
GAAAGACGACCATAGCCGAAAACGTATTGAACGAAATGTCGAGTCACATT
TTGGACGATTATAAAACGAACAACGGTGATCAAAGACCCATCGAAAGTTG
TTGTCAATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAA
ACCAAAACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGATGAC
CAGGCCACCCTCGATAATATGGAGTATCATTATGTCATCATTGTGTTACT
TTCATTTCATTGGTCAAACGTGAATGGACAAAATAACCAAGTTAATTTCC
TAGATTTATTGAAAGATGATGCCAAAACTTTTCAACAAGAATTGACAAAA
CTCGTCAATGAGAACCTTGGTCATGAAACTTTGCAGCGACACATGGGATA
ATTGTGAAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAAT
GGAACCCATGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGA
ATGTTTTCCGACGCCATCACCACCCATCATAACGCCTGCACCACCCACAA
CACCTGACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTG
ATTATACTATTTAGTATAATATTTGTATGCTCCATACTGGGTGGTATCTA
CTGGTGGTTCAATAAAAAAGCTAAACGAAGACAACGTAATAACAATAACA
ACGGGAATAATTCTAACACAACACTTACTCCTCGAGCCAACAGTGGTTTT
GATGATGACCAATATCAACCAGGATATCAACCATCAGGCCACGCACCAAA
CGATCGACTAGGATCAGTACCATCACCGACTGATACCAAAGATGCTGCAG
TAGAGATAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAAT
GGTTCAGTTAGTACCACGGCTTAACCCAGGCAGACTTGAATGCAACCCAG
AGGACAAACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATT
TCAGAGCTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGGAAAGATTT
GGGTATTGTTCGAACGATATCAGCGAAACAAATTGTGAATGTCCTTGCAT
ACAACCCGTTACTTGTCTCAGTGATCTTCGAATTACCTTGATCACGTGAC
CGAAGCGAAGAAATATGAATCGAATCGAAATTGTTTGGATTATCGAGTTG
TTCCGATTGTTGATTCCAATCTTTTATTATTGTATATTAATGACGCTTGC
ACTTTACCAGAAAATTGTAACTGTGAAGAACCAATCAACAACCATAGTCG
AGTTGCAAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAATTATTGTT
TGGAATTCCGAAACAATATAACCATCAAGGAATGGTTTTACTCTAGCATG
TGTTGTGATTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGG
AAAAGAATGAAAATTCAACCCTCGAAAATCAACACATCATTAAGATGGGG
CAAGACTTCGACAGAGAAAGCAGGGAATATAGCGATGGATTTCAAACTAC
CCTACTTTAAAGTGTTACTGGATAAGTCAATCAATGAATGCGAAACTGAT
GGGTACCGCCTCATGATTGCTCAAAAAGGGATGACATTAACCACGCCCTA
CTTGGATGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCCTAC
ACATGTACATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTA
CTGATGAATCCTTCATACGACCCAAGAGCTCGACCATGAGTATCGATGTT
TTTAAAAATATACGGTTATCGGCACAAGCTACAAAATCTATGGATCAATA
TTGGAAAAATGATACATCAGAGAAAGCAATCAGTATCATCGCAAGACTTG
GCAGTAATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTTACTT
CAAACTAGAGACAAATGAGACGGTTCAGGAATTAAAAGACTTGTTCATGC
CTGGGGAGACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATC
AAAGATTCTATCAGACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAG
CCACTTCACAAAATAAAACATTGACTTATACTTGGAAAGCTGTTCCAAAG
TCTGACTTCATTTTGACTATTGTGACGTCATCTGATTACGAAAAATCCGA
ACTCAAAATCACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATC
TATGGAATTCCACATATTTAGATGATCATATTTGCAAATACAGTGAAACA
CAGGTAGCAGTCAAAGGTCAAACATTTATTCATCCGAAATTCGGACAACC
GCTTGGATCAGATGAACTTTCTCGGACAGTTAATATTTTACAAATCGAAT
CTTCACAAAGTTTCAAAGATGAAGTGTACAATGATATGATAAGGCACAAC
CATTGACGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATC
CAATGAAAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGC
GAAGAATGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAA
CGGGTCGTGACAACTTTATGGAATTTGAACTTGGAAAGGATAATAATCAT
TTTACCATCAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTT
CAACGACTTCGACGACAAAGTTCATTACATCATGCCTATATCTGATCGAT
TTGGAAGAGATGGAAAACTAGCGGGAGCAACGTACAGCAACAACAAAAAT
CTTGCAGGAGTCGGATGTGATATAGAGAAAAACATTTCATCTTTGTGACA
AGTGGATACTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAA
AGATGGGCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAA
TATATGGTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAG
ATACTATACAATGATAAGAATAATCAAACAGATTTCAGTAAAATTTTATC
ATGAGGATAATTTGGTACCATCGGACAATAAAGCAGATTGTTTGAAGATT
TCATCAAAAGCAACTCCTTATCTCAAAGATAAAATTCTCCAACAAATTGA
AAACAAACAGCCAAAAGTTCGCGACTATTGGAAACGTTACCGGGAAGTGA
AGGGAGACATTTTGTTATTATTCTGGATTATTCCGAAGAAATTAAAGATA
CAATCTCAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCTTGTCACA
TTTAAAGATGAGGTTTCGATGAGCGACATTTGTGAGCAAACACCTCCAAG
CAATTCGAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTC
ACTACCTAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTATAAA
GAAGCCAAAGGCGAAGCAAGGAACATTCAATACGACTCTTTAGATGGTTA
TTCGTTCACTTATCCTGCTTATCAAGATCCTTCACCAATGGAATGCACAT
GCGCACAAAGGGATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGA
CGACCATAGCCGAAAACGTATTGAACGAAATGTCGAGTCACATTTTGGAC
GATTATAAAACGAACAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCA
ATTTGATGATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAA
ACCTTAATGATATGTCTGAAGATGATGCAACTAGCTTTGATGACCAGGCC
ACCCTCGATAATATGGAGTATCATTATGTCATCATTGTGTTACTTTCATT
TCATTGGTCAAACGTGAATGGACAAAATAACCAAGTTAATTTCCTAGATT
TATTGAAAGATGATGCCAAAACTTTTCAACAAGAATTGACAAAACTCGTC
AATGAGAACCTTGGTCATGAAACTTTGCAGCGACACATGGGATAATTGTG
AAAGTTTCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACC
CATGTTGCCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAATGTTT
TCCGACGCCATCACCACCCATCATAACGCCTGCACCACCCACAACACCTG
ACTCGCAAGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGATTATA
CTATTTAGTATAATATTTGTATGCTCCATACTGGGTGGTATCTACTGGTG
GTTCAATAAAAAAGCTAAACGAAGACAACGTAATAACAATAACAACGGGA
ATAATTCTAACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGATGAT
GACCAATATCAACCAGGATATCAACCATCAGGCCACGCACCAAACGATCG
ACTAGGATCAGTACCATCACCGACTGATACCAAAGATGCTGCAGTAGAGA
TAACAATGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCA
GTTAGTACCACGGCTTAACCCAGGCAGACTTGAATGCAACCCAGAGGACA
AACGAAAAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAG
CTTACTCTCTGTTTTGACCCTGAATGCAAGAAACGGAAAGATTTGGGTAT
TGTTCGAACGATATCAGCGAAACAAATTGTGAATGTCCTTGCATACAACC
CGTTACTTGTCTCAGTGATCTTCGAATTACCTTGATCACGTGACCGAAGC
GAAGAAATATGAATCGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGA
TTGTTGATTCCAATCTTTTATTATTGTATATTAATGACGCTTGCACTTTA
CCAGAAAATTGTAACTGTGAAGAACCAATCAACAACCATAGTCGAGTTGC
AAAGAGCATGATCGAAGAGGGAGTTATGATAAAAAATTATTGTTTGGAAT
TCCGAAACAATATAACCATCAAGGAATGGTTTTACTCTAGCATGTGTTGT
GATTGATCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGA
ATGAAAATTCAACCCTCGAAAATCAACACATCATTAAGATGGGGCAAGAC
TTCGACAGAGAAAGCAGGGAATATAGCGATGGATTTCAAACTACCCTACT
TTAAAGTGTTACTGGATAAGTCAATCAATGAATGCGAAACTGATGGGTAC
CGCCTCATGATTGCTCAAAAAGGGATGACATTAACCACGCCCTACTTGGA
TGCCTTTACTGGTGAAACTGTTATGACTCTTGGACAAGTCCTACACATGT
ACATTGGTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGATG
AATCCTTCATACGACCCAAGAGCTCGACCATGAGTATCGATGTTTTTAAA
AATATACGGTTATCGGCACAAGCTACAAAATCTATGGATCAATATTGGAA
AAATGATACATCAGAGAAAGCAATCAGTATCATCGCAAGACTTGGCAGTA
ATCAAATTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTTACTTCAAACT
AGAGACAAATGAGACGGTTCAGGAATTAAAAGACTTGTTCATGCCTGGGG
AGACAGCAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGAT
TCTATCAGACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAGCCACTT
CACAAAATAAAACATTGACTTATACTTGGAAAGCTGTTCCAAAGTCTGAC
TTCATTTTGACTATTGTGACGTCATCTGATTACGAAAAATCCGAACTCAA
AATCACCAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATCTATGGA
ATTCCACATATTTAGATGATCATATTTGCAAATACAGTGAAACACAGGTA
GCAGTCAAAGGTCAAACATTTATTCATCCGAAATTCGGACAACCGCTTGG
ATCAGATGAACTTTCTCGGACAGTTAATATTTTACAAATCGAATCTTCAC
AAAGTTTCAAAGATGAAGTGTACAATGATATGATAAGGCACAACCATTGA
CGCATGTAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGA
AAGGAGCCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAA
TGGAGTCAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGGTC
GTGACAACTTTATGGAATTTGAACTTGGAAAGGATAATAATCATTTTACC
ATCAATTCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGA
CTTCGACGACAAAGTTCATTACATCATGCCTATATCTGATCGATTTGGAA
GAGATGGAAAACTAGCGGGAGCAACGTACAGCAACAACAAAAATCTTGCA
GGAGTCGGATGTGATATAGAGAAAAACATTTCATCTTTGTGACAAGTGGA
TACTACAAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGG
GCGGAAAAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATATG
GTGAAGCAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGATACTA
TACAATGATAAGAATAATCAAACAGATTTCAGTAAAATTTTATCATGAGG
ATAATTTGGTACCATCGGACAATAAAGCAGATTGTTTGAAGATTTCATCA
AAAGCAACTCCTTATCTCAAAGATAAAATTCTCCAACAAATTGAAAACAA
ACAGCCAAAAGTTCGCGACTATTGGAAACGTTACCGGGAAGTGAAGGGAG
ACATTTTGTTATTATTCTGGATTATTCCGAAGAAATTAAAGATACAATCT
CAATTGTGAAGAAAGTTGCAAAGACATTGCTCAACCTTGTCACATTTAAA
GATGAGGTTTCGATGAGCGACATTTGTGAGCAAACACCTCCAAGCAATTC
GAAAGTCTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTACC
TAAAGAAAGAGGATTTGGTCACGAAATGCAAGGATGTTTATAAAGAAGCC
AAAGGCGAAGCAAGGAACATTCAATACGACTCTTTAGATGGTTATTCGTT
CACTTATCCTGCTTATCAAGATCCTTCACCAATGGAATGCACATGCGCAC
AAAGGGATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGACGACCA
TAGCCGAAAACGTATTGAACGAAATGTCGAGTCACATTTTGGACGATTAT
AAAACGAACAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGA
TGATTCAAAACTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTA
ATGATATGTCTGAAGATGATGCAACTAGCTTTGATGACCAGGCCACCCTC
GATAATATGGAGTATCATTATGTCATCATTGTGTTACTTTCATTTCATTG
GTCAAACGTGAATGGACAAAATAACCAAGTTAATTTCCTAGATTTATTGA
AAGATGATGCCAAAACTTTTCAACAAGAATTGACAAAACTCGTCAATGAG
AACCTTGGTCATGAAACTTTGCAGCGACACATGGGATAATTGTGAAAGTT
TCAAACCTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTT
GCCGACGAGAAAAAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGAC
GCCATCACCACCCATCATAACGCCTGCACCACCCACAACACCTGACTCGC
AAGAAACTGAGGACCTATCAGATGGTGCTATTGCTGTGATTATACTATTT
AGTATAATATTTGTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAA
TAAAAAAGCTAAACGAAGACAACGTAATAACAATAACAACGGGAATAATT
CTAACACAACACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAA
TATCAACCAGGATATCAACCATCAGGCCACGCACCAAACGATCGACTAGG
ATCAGTACCATCACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAA
TGCCAGCAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGT
ACCACGGCTTAACCCAGGCAGACTTGAATGCAACCCAGAGGACAAACGAA
AAACAGATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGCTTACT
CTCTGTTTTGACCCTGAATGCAAGAAACGGAAAGATTTGGGTATTGTTCG
AACGATATCAGCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTTAC
TTGTCTCAGTGATCTTCGAATTACCTTGATCACGTGACCGAAGCGAAGAA
ATATGAATCGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTG
ATTCCAATCTTTTATTATTGTATATTAATGACGCTTGCACTTTACCAGAA
AATTGTAACTGTGAAGAACCAATCAACAACCATAGTCGAGTTGCAAAGAG
CATGATCGAAGAGGGAGTTATGATAAAAAATTATTGTTTGGAATTCCGAA
ACAATATAACCATCAAGGAATGGTTTTACTCTAGCATGTGTTGTGATTGA
TCGAAATGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAA
ATTCAACCCTCGAAAATCAACACATCATTAAGATGGGGCAAGACTTCGAC
AGAGAAAGCAGGGAATATAGCGATGGATTTCAAACTACCCTACTTTAAAG
TGTTACTGGATAAGTCAATCAATGAATGCGAAACTGATGGGTACCGCCTC
ATGATTGCTCAAAAAGGGATGACATTAACCACGCCCTACTTGGATGCCTT
TACTGGTGAAACTGTTATGACTCTTGGACAAGTCCTACACATGTACATTG
GTATGGAGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAATCCT
TCATACGACCCAAGAGCTCGACCATGAGTATCGATGTTTTTAAAAATATA
CGGTTATCGGCACAAGCTACAAAATCTATGGATCAATATTGGAAAAATGA
TACATCAGAGAAAGCAATCAGTATCATCGCAAGACTTGGCAGTAATCAAA
TTTCCAGCAGATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGAC
AAATGAGACGGTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAG
CAACACCTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTATC
AGACGTAATGATGCCAATATCTCGAGGGCCTTTTGGAGCCACTTCACAAA
ATAAAACATTGACTTATACTTGGAAAGCTGTTCCAAAGTCTGACTTCATT
TTGACTATTGTGACGTCATCTGATTACGAAAAATCCGAACTCAAAATCAC
CAATCAAGGAGGGGCGGAAGATTATCATCGCCTTGATCTATGGAATTCCA
CATATTTAGATGATCATATTTGCAAATACAGTGAAACACAGGTAGCAGTC
AAAGGTCAAACATTTATTCATCCGAAATTCGGACAACCGCTTGGATCAGA
TGAACTTTCTCGGACAGTTAATATTTTACAAATCGAATCTTCACAAAGTT
TCAAAGATGAAGTGTACAATGATATGATAAGGCACAACCATTGACGCATG
TAAAGCAGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAG
CCGTTTGTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAATGGAGT
CAAACGGAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGGTCGTGACA
ACTTTATGGAATTTGAACTTGGAAAGGATAATAATCATTTTACCATCAAT
TCCAAGATATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACTTCGA
CGACAAAGTTCATTACATCATGCCTATATCTGATCGATTTGGAAGAGATG
GAAAACTAGCGGGAGCAACGTACAGCAACAACAAAAATCTTGCAGGAGTC
GGATGTGATATAGAGAAAAACATTTCATCTTTGTGACAAGTGGATACTAC
AAGGATGGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAA
AAGTTTGGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGTGAAG
CAGCTAGCTATAAGAAGATCTTTGAAGAAACTTTTCAGATACTATACAAT
GATAAGAATAATCAAACAGATTTCAGTAAAATTTTATCATGAGGATAATT
TGGTACCATCGGACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCA
ACTCCTTATCTCAAAGATAAAATTCTCCAACAAATTGAAAACAAACAGCC
AAAAGTTCGCGACTATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTT
TGTTATTATTCTGGATTATTCCGAAGAAATTAAAGATACAATCTCAATTG
TGAAGAAAGTTGCAAAGACATTGCTCAACCTTGTCACATTTAAAGATGAG
GTTTCGATGAGCGACATTTGTGAGCAAACACCTCCAAGCAATTCGAAAGT
CTGTCCCTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAAAGA
AAGAGGATTTGGTCACGAAATGCAAGGATGTTTATAAAGAAGCCAAAGGC
GAAGCAAGGAACATTCAATACGACTCTTTAGATGGTTATTCGTTCACTTA
TCCTGCTTATCAAGATCCTTCACCAATGGAATGCACATGCGCACAAAGGG
ATCCCAGATTCAGTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCG
AAAACGTATTGAACGAAATGTCGAGTCACATTTTGGACGATTATAAAACG
AACAACGGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATGATTC
AAAACTGGGATTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTAATGATA
TGTCTGAAGATGATGCAACTAGCTTTGATGACCAGGCCACCCTCGATAAT
ATGGAGTATCATTATGTCATCATTGTGTTACTTTCATTTCATTGGTCAAA
CGTGAATGGACAAAATAACCAAGTTAATTTCCTAGATTTATTGAAAGATG
ATGCCAAAACTTTTCAACAAGAATTGACAAAACTCGTCAATGAGAACCTT
GGTCATGAAACTTTGCAGCGACACATGGGATAATTGTGAAAGTTTCAAAC
CTGCTTGCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGCCGAC
GAGAAAAAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGACGCCATC
ACCACCCATCATAACGCCTGCACCACCCACAACACCTGACTCGCAAGAAA
CTGAGGACCTATCAGATGGTGCTATTGCTGTGATTATACTATTTAGTATA
ATATTTGTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAATAAAAA
AGCTAAACGAAGACAACGTAATAACAATAACAACGGGAATAATTCTAACA
CAACACTTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAATATCAA
CCAGGATATCAACCATCAGGCCACGCACCAAACGATCGACTAGGATCAGT
ACCATCACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAATGCCAG
CAGTGTACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTACCACG
GCTTAACCCAGGCAGACTTGAATGCAACCCAGAGGACAAACGAAAAACAG
ATTTCTCAGAAAAATGGTTCAAAGGAAACATTTCAGAGCTTACTCTCTGT
TTTGACCCTGAATGCAAGAAACGGAAAGATTTGGGTATTGTTCGAACGAT
ATCAGCGAAACAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGTCT
CAGTGATCTTCGAATTACCTTGATCACGTGACCGAAGCGAAGAAATATGA
ATCGAATCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCA
ATCTTTTATTATTGTATATTAATGACGCTTGCACTTTACCAGAAAATTGT
AACTGTGAAGAACCAATCAACAACCATAGTCGAGTTGCAAAGAGCATGAT
CGAAGAGGGAGTTATGATAAAAAATTATTGTTTGGAATTCCGAAACAATA
TAACCATCAAGGAATGGTTTTACTCTAGCATGTGTTGTGATTGATCGAAA
TGGCTTCGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAAATTCAA
CCCTCGAAAATCAACACATCATTAAGATGGGGCAAGACTTCGACAGAGAA
AGCAGGGAATATAGCGATGGATTTCAAACTACCCTACTTTAAAGTGTTAC
TGGATAAGTCAATCAATGAATGCGAAACTGATGGGTACCGCCTCATGATT
GCTCAAAAAGGGATGACATTAACCACGCCCTACTTGGATGCCTTTACTGG
TGAAACTGTTATGACTCTTGGACAAGTCCTACACATGTACATTGGTATGG
AGAATGGTTTCTTCCGTATTTACCCTGGCTTACTGATGAATCCTTCATAC
GACCCAAGAGCTCGACCATGAGTATCGATGTTTTTAAAAATATACGGTTA
TCGGCACAAGCTACAAAATCTATGGATCAATATTGGAAAAATGATACATC
AGAGAAAGCAATCAGTATCATCGCAAGACTTGGCAGTAATCAAATTTCCA
GCAGATGCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAATGA
GACGGTTCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAACAC
CTCGTGGCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTATCAGACGT
AATGATGCCAATATCTCGAGGGCCTTTTGGAGCCACTTCACAAAATAAAA
CATTGACTTATACTTGGAAAGCTGTTCCAAAGTCTGACTTCATTTTGACT
ATTGTGACGTCATCTGATTACGAAAAATCCGAACTCAAAATCACCAATCA
AGGAGGGGCGGAAGATTATCATCGCCTTGATCTATGGAATTCCACATATT
TAGATGATCATATTTGCAAATACAGTGAAACACAGGTAGCAGTCAAAGGT
CAAACATTTATTCATCCGAAATTCGGACAACCGCTTGGATCAGATGAACT
TTCTCGGACAGTTAATATTTTACAAATCGAATCTTCACAAAGTTTCAAAG
ATGAAGTGTACAATGATATGATAAGGCACAACCATTGACGCATGTAAAGC
AGTGGTGGATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCCGTTT
GTCTTTCTTTTCTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAACG
GAAAATTCTTATTGGTTCCTTATCAAAAGAAACGGGTCGTGACAACTTTA
TGGAATTTGAACTTGGAAAGGATAATAATCATTTTACCATCAATTCCAAG
ATATCTGCCATTTTATCCTCCGCTAAGAATTTCAACGACTTCGACGACAA
AGTTCATTACATCATGCCTATATCTGATCGATTTGGAAGAGATGGAAAAC
TAGCGGGAGCAACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGATGT
GATATAGAGAAAAACATTTCATCTTTGTGACAAGTGGATACTACAAGGAT
GGCAGTTGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTT
GGAATGTGGCGTTTCTTTTTCTCTTCTACTAATATATGGTGAAGCAGCTA
GCTATAAGAAGATCTTTGAAGAAACTTTTCAGATACTATACAATGATAAG
AATAATCAAACAGATTTCAGTAAAATTTTATCATGAGGATAATTTGGTAC
CATCGGACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCT
TATCTCAAAGATAAAATTCTCCAACAAATTGAAAACAAACAGCCAAAAGT
TCGCGACTATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTGTTAT
TATTCTGGATTATTCCGAAGAAATTAAAGATACAATCTCAATTGTGAAGA
AAGTTGCAAAGACATTGCTCAACCTTGTCACATTTAAAGATGAGGTTTCG
ATGAGCGACATTTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCC
CTCTCTTGGAAGTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGAGG
ATTTGGTCACGAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCA
AGGAACATTCAATACGACTCTTTAGATGGTTATTCGTTCACTTATCCTGC
TTATCAAGATCCTTCACCAATGGAATGCACATGCGCACAAAGGGATCCCA
GATTCAGTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAAAACG
TATTGAACGAAATGTCGAGTCACATTTTGGACGATTATAAAACGAACAAC
GGTGATCAAAGACCCATCGAAAGTTGTTGTCAATTTGATGATTCAAAACT
GGGATTTGTTTCAGTCTTTGGTGAAAACCAAAACCTTAATGATATGTCTG
AAGATGATGCAACTAGCTTTGATGACCAGGCCACCCTCGATAATATGGAG
TATCATTATGTCATCATTGTGTTACTTTCATTTCATTGGTCAAACGTGAA
TGGACAAAATAACCAAGTTAATTTCCTAGATTTATTGAAAGATGATGCCA
AAACTTTTCAACAAGAATTGACAAAACTCGTCAATGAGAACCTTGGTCAT
GAAACTTTGCAGCGACACATGGGATAATTGTGAAAGTTTCAAACCTGCTT
GCAACTGGTGTTTCAAATTCCCAAATGGAACCCATGTTGCCGACGAGAAA
AAGCATTGTGATTATTCTGACGAAGAATGTTTTCCGACGCCATCACCACC
CATCATAACGCCTGCACCACCCACAACACCTGACTCGCAAGAAACTGAGG
ACCTATCAGATGGTGCTATTGCTGTGATTATACTATTTAGTATAATATTT
GTATGCTCCATACTGGGTGGTATCTACTGGTGGTTCAATAAAAAAGCTAA
ACGAAGACAACGTAATAACAATAACAACGGGAATAATTCTAACACAACAC
TTACTCCTCGAGCCAACAGTGGTTTTGATGATGACCAATATCAACCAGGA
TATCAACCATCAGGCCACGCACCAAACGATCGACTAGGATCAGTACCATC
ACCGACTGATACCAAAGATGCTGCAGTAGAGATAACAATGCCAGCAGTGT
ACGAGGAGAGACCTGCAGATGAAAATGGTTCAGTTAGTACCACGGCTTAA
CCCAGGCAGACTTGAATGCAACCCAGAGGACAAACGAAAAACAGATTTCT
CAGAAAAATGGTTCAAAGGAAACATTTCAGAGCTTACTCTCTGTTTTGAC
CCTGAATGCAAGAAACGGAAAGATTTGGGTATTGTTCGAACGATATCAGC
GAAACAAATTGTGAATGTCCTTGCATACAACCCGTTACTTGTCTCAGTGA
TCTTCGAATTACCTTGATCACGTGACCGAAGCGAAGAAATATGAATCGAA
TCGAAATTGTTTGGATTATCGAGTTGTTCCGATTGTTGATTCCAATCTTT
TATTATTGTATATTAATGACGCTTGCACTTTACCAGAAAATTGTAACTGT
GAAGAACCAATCAACAACCATAGTCGAGTTGCAAAGAGCATGATCGAAGA
GGGAGTTATGATAAAAAATTATTGTTTGGAATTCCGAAACAATATAACCA
TCAAGGAATGGTTTTACTCTAGCATGTGTTGTGATTGATCGAAATGGCTT
CGTGGTTTACCAATCGAGTTTTATGGAAAAGAATGAAAATTCAACCCTCG
AAAATCAACACATCATTAAGATGGGGCAAGACTTCGACAGAGAAAGCAGG
GAATATAGCGATGGATTTCAAACTACCCTACTTTAAAGTGTTACTGGATA
AGTCAATCAATGAATGCGAAACTGATGGGTACCGCCTCATGATTGCTCAA
AAAGGGATGACATTAACCACGCCCTACTTGGATGCCTTTACTGGTGAAAC
TGTTATGACTCTTGGACAAGTCCTACACATGTACATTGGTATGGAGAATG
GTTTCTTCCGTATTTACCCTGGCTTACTGATGAATCCTTCATACGACCCA
AGAGCTCGACCATGAGTATCGATGTTTTTAAAAATATACGGTTATCGGCA
CAAGCTACAAAATCTATGGATCAATATTGGAAAAATGATACATCAGAGAA
AGCAATCAGTATCATCGCAAGACTTGGCAGTAATCAAATTTCCAGCAGAT
GCTTTTCTCAGGCCAAGTATTTACTTCAAACTAGAGACAAATGAGACGGT
TCAGGAATTAAAAGACTTGTTCATGCCTGGGGAGACAGCAACACCTCGTG
GCCTCTTCAAGCGGTGTTCCTGGATCAAAGATTCTATCAGACGTAATGAT
GCCAATATCTCGAGGGCCTTTTGGAGCCACTTCACAAAATAAAACATTGA
CTTATACTTGGAAAGCTGTTCCAAAGTCTGACTTCATTTTGACTATTGTG
ACGTCATCTGATTACGAAAAATCCGAACTCAAAATCACCAATCAAGGAGG
GGCGGAAGATTATCATCGCCTTGATCTATGGAATTCCACATATTTAGATG
ATCATATTTGCAAATACAGTGAAACACAGGTAGCAGTCAAAGGTCAAACA
TTTATTCATCCGAAATTCGGACAACCGCTTGGATCAGATGAACTTTCTCG
GACAGTTAATATTTTACAAATCGAATCTTCACAAAGTTTCAAAGATGAAG
TGTACAATGATATGATAAGGCACAACCATTGACGCATGTAAAGCAGTGGT
GGATAAAAGTTCATCTTCACAAAATCCAATGAAAGGAGCCGTTTGTCTTT
CTTTTCTGACCAATGAATTTATTCGCGAAGAATGGAGTCAAACGGAAAAT
TCTTATTGGTTCCTTATCAAAAGAAACGGGTCGTGACAACTTTATGGAAT
TTGAACTTGGAAAGGATAATAATCATTTTACCATCAATTCCAAGATATCT
GCCATTTTATCCTCCGCTAAGAATTTCAACGACTTCGACGACAAAGTTCA
TTACATCATGCCTATATCTGATCGATTTGGAAGAGATGGAAAACTAGCGG
GAGCAACGTACAGCAACAACAAAAATCTTGCAGGAGTCGGATGTGATATA
GAGAAAAACATTTCATCTTTGTGACAAGTGGATACTACAAGGATGGCAGT
TGGTCTGAAGTTGAGAAAGGGTTCAAAGATGGGCGGAAAAGTTTGGAATG
TGGCGTTTCTTTTTCTCTTCTACTAATATATGGTGAAGCAGCTAGCTATA
AGAAGATCTTTGAAGAAACTTTTCAGATACTATACAATGATAAGAATAAT
CAAACAGATTTCAGTAAAATTTTATCATGAGGATAATTTGGTACCATCGG
ACAATAAAGCAGATTGTTTGAAGATTTCATCAAAAGCAACTCCTTATCTC
AAAGATAAAATTCTCCAACAAATTGAAAACAAACAGCCAAAAGTTCGCGA
CTATTGGAAACGTTACCGGGAAGTGAAGGGAGACATTTTGTTATTATTCT
GGATTATTCCGAAGAAATTAAAGATACAATCTCAATTGTGAAGAAAGTTG
CAAAGACATTGCTCAACCTTGTCACATTTAAAGATGAGGTTTCGATGAGC
GACATTTGTGAGCAAACACCTCCAAGCAATTCGAAAGTCTGTCCCTCTCT
TGGAAGTCCTCCATCAGAATCCATTCACTACCTAAAGAAAGAGGATTTGG
TCACGAAATGCAAGGATGTTTATAAAGAAGCCAAAGGCGAAGCAAGGAAC
ATTCAATACGACTCTTTAGATGGTTATTCGTTCACTTATCCTGCTTATCA
AGATCCTTCACCAATGGAATGCACATGCGCACAAAGGGATCCCAGATTCA
GTTTGTCAAAGACCTTGCGGGAAAGACGACCATAGCCGAAAACGTATTGA
ACGAAATGTCGAGTCACATTTTGGACGATTATAAAACGAACAACGGTGAT
CAAAGACCCATCGAAAGTTGTTGTCAATTTGATGATTCAAAACTGGGATT
TGTTTCAGTCTTTGGTGAAAACCAAAACCTTAATGATATGTCTGAAGATG
ATGCAACTAGCTTTGATGACCAGGCCACCCTCGATAATATGGAGTATCAT
TATGTCATCATTGTGTTACTTTCATTTCATTGGTCAAACGTGAATGGACA
AAATAACCAAGTTAATTTCCTAGATTTATTGAAAGATGATGCCAAAACTT
TTCAACAAGAATTGACAAAACTCGTCAATGAGAACCTTGGTCATGAAACT
TTGCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000321XLOC_000321Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000519-exon-sc0000002-1575043694:319249..319544TCONS_00000519-exon-sc0000002-1575043694:319249..319544Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:318462..318527TCONS_00000519-exon-sc0000002-1575043694:318462..318527Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:317827..317997TCONS_00000519-exon-sc0000002-1575043694:317827..317997Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:316958..317220TCONS_00000519-exon-sc0000002-1575043694:316958..317220Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:282765..282909TCONS_00000519-exon-sc0000002-1575043694:282765..282909Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:282049..282184TCONS_00000519-exon-sc0000002-1575043694:282049..282184Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:281754..281828TCONS_00000519-exon-sc0000002-1575043694:281754..281828Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:280956..281084TCONS_00000519-exon-sc0000002-1575043694:280956..281084Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:279740..279807TCONS_00000519-exon-sc0000002-1575043694:279740..279807Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:279294..279450TCONS_00000519-exon-sc0000002-1575043694:279294..279450Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:277899..278057TCONS_00000519-exon-sc0000002-1575043694:277899..278057Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:277482..277608TCONS_00000519-exon-sc0000002-1575043694:277482..277608Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:276968..277248TCONS_00000519-exon-sc0000002-1575043694:276968..277248Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:275635..275774TCONS_00000519-exon-sc0000002-1575043694:275635..275774Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:275107..275213TCONS_00000519-exon-sc0000002-1575043694:275107..275213Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:274409..274492TCONS_00000519-exon-sc0000002-1575043694:274409..274492Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:274077..274178TCONS_00000519-exon-sc0000002-1575043694:274077..274178Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:273756..273860TCONS_00000519-exon-sc0000002-1575043694:273756..273860Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:273356..273458TCONS_00000519-exon-sc0000002-1575043694:273356..273458Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:272785..272886TCONS_00000519-exon-sc0000002-1575043694:272785..272886Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:272034..272189TCONS_00000519-exon-sc0000002-1575043694:272034..272189Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:271380..271474TCONS_00000519-exon-sc0000002-1575043694:271380..271474Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:271142..271258TCONS_00000519-exon-sc0000002-1575043694:271142..271258Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1575043694:268592..269771TCONS_00000519-exon-sc0000002-1575043694:268592..269771Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:319249..319544TCONS_00000519-exon-sc0000002-1510915933:319249..319544Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:318462..318527TCONS_00000519-exon-sc0000002-1510915933:318462..318527Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:317827..317997TCONS_00000519-exon-sc0000002-1510915933:317827..317997Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:316958..317220TCONS_00000519-exon-sc0000002-1510915933:316958..317220Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:282765..282909TCONS_00000519-exon-sc0000002-1510915933:282765..282909Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:282049..282184TCONS_00000519-exon-sc0000002-1510915933:282049..282184Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:281754..281828TCONS_00000519-exon-sc0000002-1510915933:281754..281828Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:280956..281084TCONS_00000519-exon-sc0000002-1510915933:280956..281084Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:279740..279807TCONS_00000519-exon-sc0000002-1510915933:279740..279807Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:279294..279450TCONS_00000519-exon-sc0000002-1510915933:279294..279450Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:277899..278057TCONS_00000519-exon-sc0000002-1510915933:277899..278057Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:277482..277608TCONS_00000519-exon-sc0000002-1510915933:277482..277608Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:276968..277248TCONS_00000519-exon-sc0000002-1510915933:276968..277248Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:275635..275774TCONS_00000519-exon-sc0000002-1510915933:275635..275774Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:275107..275213TCONS_00000519-exon-sc0000002-1510915933:275107..275213Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:274409..274492TCONS_00000519-exon-sc0000002-1510915933:274409..274492Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:274077..274178TCONS_00000519-exon-sc0000002-1510915933:274077..274178Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:273756..273860TCONS_00000519-exon-sc0000002-1510915933:273756..273860Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:273356..273458TCONS_00000519-exon-sc0000002-1510915933:273356..273458Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:272785..272886TCONS_00000519-exon-sc0000002-1510915933:272785..272886Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:272034..272189TCONS_00000519-exon-sc0000002-1510915933:272034..272189Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:271380..271474TCONS_00000519-exon-sc0000002-1510915933:271380..271474Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:271142..271258TCONS_00000519-exon-sc0000002-1510915933:271142..271258Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1510915933:268592..269771TCONS_00000519-exon-sc0000002-1510915933:268592..269771Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:319249..319544TCONS_00000519-exon-sc0000002-1491911889:319249..319544Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:318462..318527TCONS_00000519-exon-sc0000002-1491911889:318462..318527Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:317827..317997TCONS_00000519-exon-sc0000002-1491911889:317827..317997Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:316958..317220TCONS_00000519-exon-sc0000002-1491911889:316958..317220Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:282765..282909TCONS_00000519-exon-sc0000002-1491911889:282765..282909Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:282049..282184TCONS_00000519-exon-sc0000002-1491911889:282049..282184Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:281754..281828TCONS_00000519-exon-sc0000002-1491911889:281754..281828Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:280956..281084TCONS_00000519-exon-sc0000002-1491911889:280956..281084Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:279740..279807TCONS_00000519-exon-sc0000002-1491911889:279740..279807Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:279294..279450TCONS_00000519-exon-sc0000002-1491911889:279294..279450Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:277899..278057TCONS_00000519-exon-sc0000002-1491911889:277899..278057Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:277482..277608TCONS_00000519-exon-sc0000002-1491911889:277482..277608Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:276968..277248TCONS_00000519-exon-sc0000002-1491911889:276968..277248Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:275635..275774TCONS_00000519-exon-sc0000002-1491911889:275635..275774Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:275107..275213TCONS_00000519-exon-sc0000002-1491911889:275107..275213Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:274409..274492TCONS_00000519-exon-sc0000002-1491911889:274409..274492Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:274077..274178TCONS_00000519-exon-sc0000002-1491911889:274077..274178Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:273756..273860TCONS_00000519-exon-sc0000002-1491911889:273756..273860Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:273356..273458TCONS_00000519-exon-sc0000002-1491911889:273356..273458Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:272785..272886TCONS_00000519-exon-sc0000002-1491911889:272785..272886Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:272034..272189TCONS_00000519-exon-sc0000002-1491911889:272034..272189Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:271380..271474TCONS_00000519-exon-sc0000002-1491911889:271380..271474Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:271142..271258TCONS_00000519-exon-sc0000002-1491911889:271142..271258Clytia hemisphaericaexon
TCONS_00000519-exon-sc0000002-1491911889:268592..269771TCONS_00000519-exon-sc0000002-1491911889:268592..269771Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000519-proteinTCONS_00000519-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:268592..319544 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.00532056 0.123829 0.162375 0 0 0 0 0.0377756 0 0.0215638 0 0 1.32808 0.816528 0.47809 0.542634 0 0 0.00976049 0.240736 0 0 0 0 0 0 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029151Sensor-like
Blast
BLAST of TCONS_00000519 vs. Swiss-Prot (Human)
Match: CAHD1 (VWFA and cache domain-containing protein 1 OS=Homo sapiens GN=CACHD1 PE=2 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 7.814e-41
Identity = 205/869 (23.59%), Postives = 355/869 (40.85%), Query Frame = 3
Query:  849 ILDYSEEIKDT-ISIVKKVAKTLLNLVTFKDEISVKFYHEDNLVPSDNKADCLK-ISSKATPYLKDKILQQIENKQPKGEAASYKKIFEETFQILYNDKNN-----QTEKHFIFVTSGYYKDGSWSEVEKG----FKDGRKSLECGVS-FSLLLIYDGKLAGATYSNNKNLAGVGCDIEGRDNFMEFELGKDNNHFTINSKISAILSSAKNF-----NDFDDKVHYIMPISDRFGRGTTIDACKAVVDKSSSSQNPMKGAVCLSFLTNEFIREE---WSQTENSYWFLIKRNGQTFIHPKFGQPLGSDELSRTVNILQIESSQSFKDEVYNDMISGVPGSKILSDVMMPISRG---------PFGATSQNKTLTYTWKAVPKSDFILTIVT-SSDYEKSELKITNQGGAED--YHRLDLWNSTYLDDHICKYSETQVAVKDLAVIKFPADAFLRPSIYFKLETNETVQELKDLFMPGETATPRGLFKSIDVFKNIRLSAQATKSMDQYWKNDTSEKAIS--IIARYIGMENGFFRIYPGLLMNPSYDPRARPWYRLMIAQKGM-TLTTPYLDAFTGETVMTLGQVLHMGKTSTEKAGNIA---MDFKLPYF-KVLLDKSINECETDGA----CVVIDRNGFVVYQSSFMEKNENSTLENQHIIKMHSRVAKSMIEEGVMI-KNYCLEFRNNITIKEWFYSLDHVTEAKKYESNRNCLDYRVVPIVDSNLLLLYINDACTLXXXXXXXXXXXXXRFGYCSNDISETNCECPCIQPV---TCLSDLRITPGRLECNP--EDKRKTDFSEKWFKGNISELTLCFDPECKKRDTWDNCESFKPACNWCFKFPNG-THVADEKKHCDYSDEECF 3305
            ILD+   + DT + I K  A+ +L+ +   D+ISV    +   V + +   C K   S AT   K K+   + + +       +   F++ FQ++ +  NN      T+   I++++G     S  E +K       +    L   V   +  L+ DG       +  ++LA       G  + M   + K +    + +++S + ++   F     N   D+  + +P SD  G G  +      V K     N + G V +  +   +I E+   +  +  SY FLI   G T +HP   +P    E     +I+  E+   F + V  +++S   GS+I++   +P++             G  + N  ++Y WK V  + FIL IV    +    +LK  N   +    YHRLDL        H       Q+A  +   I   A +F  P  +      + + E    ++   T     L  +  +  ++R    AT  +   W       +++  I+ RYI   NG  RIYPG LM+ ++DP  R WY   +A  G+ +LT PYLD      V+T+   +H   T       +A   +DF L YF KVL+D  +  C  DG     C +++  G++V   + ++   ++ +E QHI      VA  ++     + KN C  F +    + + ++     +        +C  YR+  I  +N  +  +N+ C   ++         +R     + + +  CECPC  P+    C  +L     R   NP  E  ++         G    L  C +  C +R    +C      C WC    +G TH+  +K +C    +ECF
Sbjct:  232 ILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADT--VRTCSLDQCYKTFLSPATSETKRKMSTFVSSVKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKATLQVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVPDRMALPVIKGS--MMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIM-----TVSKPCYFGNLLLGIVGVD-VNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKF-ELVRQNILSLPLGSQIIA---VPVNSSLSWHINKLRETGKEAYN--VSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHF-----KQLATLESPTIMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTR----LIANPGLKFSVRNEVMATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDL-LPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQRFYKFNTSLAGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETC---DSLAFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENR---NPSCEVHQEPVTYTAIDPGLQDALHQCVNSRCSQRLESGDCFGVL-DCEWCMVDSDGKTHL--DKPYCA-PQKECF 1064          
The following BLAST results are available for this feature:
BLAST of TCONS_00000519 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CAHD17.814e-4123.59VWFA and cache domain-containing protein 1 OS=Homo... [more]
back to top