Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000519-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000519-protein
Unique NameTCONS_00000519-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1197

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000519-protein ID=TCONS_00000519-protein|Name=TCONS_00000519-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1197bp
MEYHYVIIVLLSFHWSNVNGQNNQVNFLDLLKDDAKTFQQELTKLVNENL
GHETLQQNLNDMSEDDATSFDDQATLDNFVKDLAGKTTIAENVLNEMSSH
ILDDYKTNNGDQRPIESCCQFDDSKLGFVSVFGENVSMSDICEQTPPSNS
KVCPSLGSPPSESIHYLKKEDLVTKCKDVYKEAKGEARNIQYDSLDGYSF
TYPAYQDPSPMECTCAQRDPRFSSRLLETLPGSEGRHFVIILDYSEEIKD
TISIVKKVAKTLLNLVTFKDEISVKFYHEDNLVPSDNKADCLKISSKATP
YLKDKILQQIENKQPKGEAASYKKIFEETFQILYNDKNNQTEKHFIFVTS
GYYKDGSWSEVEKGFKDGRKSLECGVSFSLLLIYDGKLAGATYSNNKNLA
GVGCDIEGRDNFMEFELGKDNNHFTINSKISAILSSAKNFNDFDDKVHYI
MPISDRFGRGTTIDACKAVVDKSSSSQNPMKGAVCLSFLTNEFIREEWSQ
TENSYWFLIKRNGQTFIHPKFGQPLGSDELSRTVNILQIESSQSFKDEVY
NDMISGVPGSKILSDVMMPISRGPFGATSQNKTLTYTWKAVPKSDFILTI
VTSSDYEKSELKITNQGGAEDYHRLDLWNSTYLDDHICKYSETQVAVKDL
AVIKFPADAFLRPSIYFKLETNETVQELKDLFMPGETATPRGLFKSIDVF
KNIRLSAQATKSMDQYWKNDTSEKAISIIARYIGMENGFFRIYPGLLMNP
SYDPRARPWYRLMIAQKGMTLTTPYLDAFTGETVMTLGQVLHMGKTSTEK
AGNIAMDFKLPYFKVLLDKSINECETDGACVVIDRNGFVVYQSSFMEKNE
NSTLENQHIIKMHSRVAKSMIEEGVMIKNYCLEFRNNITIKEWFYSLDHV
TEAKKYESNRNCLDYRVVPIVDSNLLLLYINDACTLPENCNCEEPINNER
FGYCSNDISETNCECPCIQPVTCLSDLRITPGRLECNPEDKRKTDFSEKW
FKGNISELTLCFDPECKKRDTWDNCESFKPACNWCFKFPNGTHVADEKKH
CDYSDEECFPTPSPPIITPAPPTTPDSQETEDLSDGAIAVIILFSIIFVC
SILGGIYWWFNKKAKRRQRNNNNNGNNSNTTLTPRANSGFDDDQYQPGYQ
PSGHAPNDRLGSVPSPTDTKDAAVEITMPAVYEERPADENGSVSTTA
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000321XLOC_000321Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000519TCONS_00000519Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR029151Sensor-like
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 28..48
NoneNo IPR availableGENE3D3.30.450.20coord: 664..785
e-value: 5.5E-14
score: 52.3
NoneNo IPR availableGENE3D3.30.450.20coord: 452..605
e-value: 6.5E-6
score: 25.6
coord: 786..905
e-value: 0.014
score: 14.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1118..1197
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1062..1081
IPR029151Periplasmic sensor domain-likeSUPERFAMILY103190Sensory domain-likecoord: 711..812

Blast
BLAST of TCONS_00000519-protein vs. Swiss-Prot (Human)
Match: CAHD1 (VWFA and cache domain-containing protein 1 OS=Homo sapiens GN=CACHD1 PE=2 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 5.375e-48
Identity = 247/1078 (22.91%), Postives = 430/1078 (39.89%), Query Frame = 0
Query:   33 DDAKTFQQELTKLVNENLGHETLQQNLNDMSEDDATSFDDQATLDNFVKDLAGKTTIAENVLNEMSSHILDDYKTN-NGDQRPIESCCQFDDSKLGFVSVFGENVSMSDICEQTPPSNSKVCPSLGSPPSESIHYLKKEDLVTKCKDVYKEAKGEARNIQYDSLDGYSFTYPAYQDPSPMECTCAQRDPRFSSRLLETLPGSEGRHFVIILDYSEEIKDT-ISIVKKVAKTLLNLVTFKDEISVKFYHEDNLVPSDNKADCLK-ISSKATPYLKDKILQQIENKQPKGEAASYKKIFEETFQILYNDKNN-----QTEKHFIFVTSGYYKDGSWSEVEKG----FKDGRKSLECGVS-FSLLLIYDGKLAGATYSNNKNLAGVGCDIEGRDNFMEFELGKDNNHFTINSKISAILSSAKNF-----NDFDDKVHYIMPISDRFGRGTTIDACKAVVDKSSSSQNPMKGAVCLSFLTNEFIREE---WSQTENSYWFLIKRNGQTFIHPKFGQPLGSDELSRTVNILQIESSQSFKDEVYNDMISGVPGSKILSDVMMPISRG---------PFGATSQNKTLTYTWKAVPKSDFILTIVT-SSDYEKSELKITNQGGAED--YHRLDLWNSTYLDDHICKYSETQVAVKDLAVIKFPADAFLRPSIYFKLETNETVQELKDLFMPGETATPRGLFKSIDVFKNIRLSAQATKSMDQYWKNDTSEKAIS--IIARYIGMENGFFRIYPGLLMNPSYDPRARPWYRLMIAQKGM-TLTTPYLDAFTGETVMTLGQVLHMGKTSTEKAGNIA---MDFKLPYF-KVLLDKSINECETDGA----CVVIDRNGFVVYQSSFMEKNENSTLENQHIIKMHSRVAKSMIEEGVMI-KNYCLEFRNNITIKEWFYSLDHVTEAKKYESNRNCLDYRVVPIVDSNLLLLYINDACTLPENCNCEEPINNERFGYCSNDISETNCECPCIQPV---TCLSDLRITPGRLECNP--EDKRKTDFSEKWFKGNISELTLCFDPECKKRDTWDNCESFKPACNWCFKFPNG-THVADEKKHCDYSDEECF 1059
            D+A+    ++ +L  E LG  T+Q+  N     +  S + ++ +    K +  K     +V+N     +   Y  +       I+ CC    S + F   F  NVS +  C++             S    S  +    DL +   D  K   G  +   + S +G    +PA++        C       S  +  +    + +H V+ILD+   + DT + I K  A+ +L+ +   D+ISV    +   V + +   C K   S AT   K K+   + + +       +   F++ FQ++ +  NN      T+   I++++G     S  E +K       +    L   V   +  L+ DG       +  ++LA       G  + M   + K +    + +++S + ++   F     N   D+  + +P SD  G G  +      V K     N + G V +  +   +I E+   +  +  SY FLI   G T +HP   +P    E     +I+  E+   F + V  +++S   GS+I++   +P++             G  + N  ++Y WK V  + FIL IV    +    +LK  N   +    YHRLDL        H       Q+A  +   I   A +F  P  +      + + E    ++   T     L  +  +  ++R    AT  +   W       +++  I+ RYI   NG  RIYPG LM+ ++DP  R WY   +A  G+ +LT PYLD      V+T+   +H   T       +A   +DF L YF KVL+D  +  C  DG     C +++  G++V   + ++   ++ +E QHI      VA  ++     + KN C  F +    + + ++     +        +C  YR+  I  +N  +  +N+ C     C C      +R     + + +  CECPC  P+    C  +L     R   NP  E  ++         G    L  C +  C +R    +C      C WC    +G TH+  +K +C    +ECF
Sbjct:   43 DEAQVLASQMRRLAAEELGVVTMQRIFNSFVYTEKIS-NGESEVQQLAKKIREKFNRYLDVVNRNKQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTISCDRL------------STTVNSRAFNPGRDLNSVLADNLKSNPG-IKWQYFSSEEGIFTVFPAHK------FRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADT--VRTCSLDQCYKTFLSPATSETKRKMSTFVSSVKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKATLQVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVPDRMALPVIKGS--MMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIM-----TVSKPCYFGNLLLGIVGVD-VNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKF-ELVRQNILSLPLGSQIIA---VPVNSSLSWHINKLRETGKEAYN--VSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHF-----KQLATLESPTIMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTR----LIANPGLKFSVRNEVMATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDL-LPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQRFYKFNTSLAGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCACSMV---DRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENR---NPSCEVHQEPVTYTAIDPGLQDALHQCVNSRCSQRLESGDCFGVLD-CEWCMVDSDGKTHL--DKPYCA-PQKECF 1064          
The following BLAST results are available for this feature:
BLAST of TCONS_00000519-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CAHD15.375e-4822.91VWFA and cache domain-containing protein 1 OS=Homo... [more]
back to top