Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000486 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000486
Unique NameTCONS_00000486
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3686

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000486 ID=TCONS_00000486|Name=TCONS_00000486|organism=Clytia hemisphaerica|type=transcript|length=3686bp
CGAAATTGTACTGCTCCCTTTTTTTACTTCCAAAACacacaaaataaaga
aaatattcttattttctagTGCGTCTTATGggaataacaaaataaattgt
tattatttttcataCTGAATTATTAAAGAAGGCTTGGTTAGCCCCTTAAA
ACATTTACACTACTGTAGTGTCAAAGATTACAAATTATTGAAATTggtgc
aaaaatattttttattggtttgtttGTTGGTTGGAAGGGCAAAAACCTTC
ATTGTTATTTTAAACAGGAAAAAAGTGTGAAGAAAGTTTTAACTCGTTAT
TTCCTTGATAAAGGTGAAAAAGAGGtggagagagagagaaaaaaagactT
GAACCAAATATCGATACATTTGATTTTGGGGTTCATTATCAAAACGCTAT
AATGATGACTTTTTGTTCGACGACCAACAATCGAAAGAAGAACGCACAAT
TCACAATCTCGACTAGTGCTAAAGAAAAGACTGTACCGAATAGTTACGAT
AATAGATCGTTTTTACGCGATTCTTTTACGAACATTTCTGATTACGACAA
TCAGCAACATCGTCAACAACGCTCGCCGATCCTTTCCAAAAATAACCGAA
GTTGTCAATCTGTGTACAACGAAAACATGAGAAATTTGACAAACCTGTCA
CTATCACCGTCACCGTCGGTAAACAGTAAAGACAAAACAATCATCTCAAA
TAATGATGTTACTTTTTCGATCGATGCAACTTCTTCATCAAATACTAAAC
TACCTCCAATTATGGATGATTTATGCCTTAGTAACAATAAAcggaatttt
gattggttgaactGTAAATCTACAAATAACATTGTTGTAAACCCATTATC
AACTTCATCCACACTATCATTAACCGCAGCAACAAATCATCATTCTCCTC
TTaaacaacaatcgaacaatTTAATTAAAACTTTCAGTAACAGTAACAAC
AAGATAGACACTAAAGCGCATTTCTCATCGTCGTCAACTATAACACAATC
ACAGATTGGGACAAAATGGAATAAAACTTTCATCAAATCCTCATCACAGT
CTGCTATCTCAACACCAAGAACAATTAATTTAATGTCACCATCAAACAGC
GTGCCTTCTTTTAATTATCGAGGAGGTTTATCGAGCATGTCGATTTCTGA
ACGTGGTGGAGATTCGGGTCACAAAGAAGAGACCAGCCGAGGGGGATCGG
ACAGAAAGGTGTCTTCTAGCAAAGGAACACTGGACAAATATTTCTCCTCT
GATGATATCANTATTTCCTTGATAAAGGTGAAAAAGAGGtggagagagag
agaaaaaaagactTGAACCAAATATCGATACATTTGATTTTGGGGTTCAT
TATCAAAACGCTATAATGATGACTTTTTGTTCGACGACCAACAATCGAAA
GAAGAACGCACAATTCACAATCTCGACTAGTGCTAAAGAAAAGACTGTAC
CGAATAGTTACGATAATAGATCGTTTTTACGCGATTCTTTTACGAACATT
TCTGATTACGACAATCAGCAACATCGTCAACAACGCTCGCCGATCCTTTC
CAAAAATAACCGAAGTTGTCAATCTGTGTACAACGAAAACATGAGAAATT
TGACAAACCTGTCACTATCACCGTCACCGTCGGTAAACAGTAAAGACAAA
ACAATCATCTCAAATAATGATGTTACTTTTTCGATCGATGCAACTTCTTC
ATCAAATACTAAACTACCTCCAATTATGGATGATTTATGCCTTAGTAACA
ATAAAcggaattttgattggttgaactGTAAATCTACAAATAACATTGTT
GTAAACCCATTATCAACTTCATCCACACTATCATTAACCGCAGCAACAAA
TCATCATTCTCCTCTTaaacaacaatcgaacaatTTAATTAAAACTTTCA
GTAACAGTAACAACAAGATAGACACTAAAGCGCATTTCTCATCGTCGTCA
ACTATAACACAATCACAGATTGGGACAAAATGGAATAAAACTTTCATCAA
ATCCTCATCACAGTCTGCTATCTCAACACCAAGAACAATTAATTTAATGT
CACCATCAAACAGCGTGCCTTCTTTTAATTATCGAGGAGGTTTATCGAGC
ATGTCGATTACTGAGCGTGGTGGAGATTCGGCTCACAAAGAAGAGACCAG
CCGAGGGGGATCGGACAGAAAGGTGTCTTCTAGCAAAGGAACACTGGACA
AATATTTCTCCTCTGATGATATCATTCACGAATACCCTGATGAAAATATA
CAAAACGGATCATTCTTAGAAATCGGGCAAGTCTCCGAGGGGGATCGGAC
AGAAAGGTGTCTTCTAGCAAAGGAACACTGGACAAATATTTCTCCTCTGA
TGATATCATTCACGAATACCCTGATGAAAATATACAAAACGGATCATTCT
TAGAAATCGGGCAAGTCTGCGAGGAGGAGAGCTCCACCGATAATGACTTT
ATAGCGCCGCTTGAACGGCCTATCGGTGGTTTAAAACGCTCATGTACGAA
TGATGAACGTATGATGACCTTGAGAGAGATCCCGTTACAACGCTGCCAAA
GTATTGATAGCACAAAAGGTCTTCAAAAACAAATAGATGAACAGGCTCGC
TTCTTTTCAGAGCAGACAAGCCTTCGACCTCGTCAACGCAAAACATCATC
TAATGAGAAACCTCAACAAACAAACACTAATACAGCGGTAACAAAAAGCC
GTAAAAAATTACTAAGACGTTCTATGTCGActggtttttcgaaaataaaa
ctCATCAAATCAAGCATTTCATTCACAAAAAGTCATCAGCGTTTTACGGA
TGAGGAACTAAACAGCGTCGATATTAAAGACTCTGACCATCAGACGTCGC
GTCGTAAAAACACGTCGTGCTCGTCTCCTCTTGACGAATATATTGAAGAA
ATGAGTAAGGGAGAGAATCCTGATCGGGATGTTGACTCGAACCCGGCTGC
TGTACCGTTCTTAAGAAGCATTAGTGCTCCTGAACAAATCGATAAACTTG
ATGGCGATGTTTATGATGAAGATTTATCGGAGCTCTATTTACCGAGGCGT
CGTGCAATTTGTCCAAATCTGCCAGTCCCGGCAATGAAGCAACTGAAAAC
ATACCTGATTTTAACGAGACTTAAACAATACTGTTTTGTATGATGTTGAG
GGTAAAGAAGATGAAGAATGTGTAAGGAGGTAAACTTTTCGAAGCCACAC
CTATATTCCTGGAGCttgattttatttgatttgcGATAAATGGCTCCAAC
TATAAAATACAATTATTAAGATCTGGGAGAAGACCGTGAGGCAGAAATAT
CAATAAGCATAGATATGATGTGTTTTTAACTGTTACAATTTTCTTATCAT
ATGATAAaggaaagattttttgatttgttttaaacaaaagagGAGACAGT
TCTATGATATGAGGCTGGTTCTGGAAAATAGTGCGATGAAAAATACACTA
TtataaaattttgttgaaaatgtgTATCAATCTTGAAAGACTTGAAGtaa
gagaagtaaaaaaatctGTTGTAAAAGCTAACCCAACCCCAAGTATCAAA
GTATGAACTGTaatataagatttttttatcaGATCGAGGTTTTGGTTTAG
ATATATATTACAAGACGGAGTTATCTTGATTATAGCTTTCTTATCTCTTG
TAAAGCTTGGTTTCCACTGTGTGATAACATGTGATA
Run BLAST on NCBI

protein sequence of TCONS_00000486-protein

>TCONS_00000486-protein ID=TCONS_00000486-protein|Name=TCONS_00000486-protein|organism=Clytia hemisphaerica|type=polypeptide|length=345bp
MMTFCSTTNNRKKNAQFTISTSAKEKTVPNSYDNRSFLRDSFTNISDYDN
QQHRQQRSPILSKNNRSCQSVYNENMRNLTNLSLSPSPSVNSKDKTIISN
NDVTFSIDATSSSNTKLPPIMDDLCLSNNKRNFDWLNCKSTNNIVVNPLS
TSSTLSLTAATNHHSPLKQQSNNLIKTFSNSNNKIDTKAHFSSSSTITQS
QIGTKWNKTFIKSSSQSAISTPRTINLMSPSNSVPSFNYRGGLSSMSITE
RGGDSAHKEETSRGGSDRKVSSSKGTLDKYFSSDDIIHEYPDENIQNGSF
LEIGQVSEGDRTERCLLAKEHWTNISPLMISFTNTLMKIYKTDHS
Run BLAST on NCBI

transcript from alignment at sc0000002:1485497..1490028+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000486 ID=TCONS_00000486|Name=TCONS_00000486|organism=Clytia hemisphaerica|type=transcript|length=4532bp|location=Sequence derived from alignment at sc0000002:1485497..1490028+ (Clytia hemisphaerica)
CGAAATTGTACTGCTCCCTTTTTTTACTTCCAAAACacacaaaataaaga aaatattcttattttctagTGCGTCTTATGggaataacaaaataaattgt tattatttttcataCTGAATTATTAAAGAAGGCTTGGTTAGCCCCTTAAA ACATTTACACTACTGTAGTGTCAAAGATTACAAATTATTGAAATTggtgc aaaaatattttttattggtttgtttGTTGGTTGGAAGGGCAAAAACCTTC ATTGTTATTTTAAACAGGAAAAAAGTGTGAAGAAAGTTTTAACTCGTTAT TTCCTTGATAAAGGTGAAAAAGAGGtggagagagagagaaaaaaagactT GAACCAAATATCGATACATTTGATTTTGGGGTTCATTATCAAAACGCTAT AATGATGACTTTTTGTTCGACGACCAACAATCGAAAGAAGAACGCACAAT TCACAATCTCGACTAGTGCTAAAGAAAAGACTGTACCGAATAGTTACGAT AATAGATCGTTTTTACGCGATTCTTTTACGAACATTTCTGATTACGACAA TCAGCAACATCGTCAACAACGCTCGCCGATCCTTTCCAAAAATAACCGAA GTTGTCAATCTGTGTACAACGAAAACATGAGAAATTTGACAAACCTGTCA CTATCACCGTCACCGTCGGTAAACAGTAAAGACAAAACAATCATCTCAAA TAATGATGTTACTTTTTCGATCGATGCAACTTCTTCATCAAATACTAAAC TACCTCCAATTATGGATGATTTATGCCTTAGTAACAATAAAcggaatttt gattggttgaactGTAAATCTACAAATAACATTGTTGTAAACCCATTATC AACTTCATCCACACTATCATTAACCGCAGCAACAAATCATCATTCTCCTC TTaaacaacaatcgaacaatTTAATTAAAACTTTCAGTAACAGTAACAAC AAGATAGACACTAAAGCGCATTTCTCATCGTCGTCAACTATAACACAATC ACAGATTGGGACAAAATGGAATAAAACTTTCATCAAATCCTCATCACAGT CTGCTATCTCAACACCAAGAACAATTAATTTAATGTCACCATCAAACAGC GTGCCTTCTTTTAATTATCGAGGAGGTTTATCGAGCATGTCGATTTCTGA ACGTGGTGGAGATTCGGGTCACAAAGAAGAGACCAGCCGAGGGGGATCGG ACAGAAAGGTGTCTTCTAGCAAAGGAACACTGGACAAATATTTCTCCTCT GATGATATCANTATTTCCTTGATAAAGGTGAAAAAGAGGtggagagagag agaaaaaaagactTGAACCAAATATCGATACATTTGATTTTGGGGTTCAT TATCAAAACGCTATAATGATGACTTTTTGTTCGACGACCAACAATCGAAA GAAGAACGCACAATTCACAATCTCGACTAGTGCTAAAGAAAAGACTGTAC CGAATAGTTACGATAATAGATCGTTTTTACGCGATTCTTTTACGAACATT TCTGATTACGACAATCAGCAACATCGTCAACAACGCTCGCCGATCCTTTC CAAAAATAACCGAAGTTGTCAATCTGTGTACAACGAAAACATGAGAAATT TGACAAACCTGTCACTATCACCGTCACCGTCGGTAAACAGTAAAGACAAA ACAATCATCTCAAATAATGATGTTACTTTTTCGATCGATGCAACTTCTTC ATCAAATACTAAACTACCTCCAATTATGGATGATTTATGCCTTAGTAACA ATAAAcggaattttgattggttgaactGTAAATCTACAAATAACATTGTT GTAAACCCATTATCAACTTCATCCACACTATCATTAACCGCAGCAACAAA TCATCATTCTCCTCTTaaacaacaatcgaacaatTTAATTAAAACTTTCA GTAACAGTAACAACAAGATAGACACTAAAGCGCATTTCTCATCGTCGTCA ACTATAACACAATCACAGATTGGGACAAAATGGAATAAAACTTTCATCAA ATCCTCATCACAGTCTGCTATCTCAACACCAAGAACAATTAATTTAATGT CACCATCAAACAGCGTGCCTTCTTTTAATTATCGAGGAGGTTTATCGAGC ATGTCGATTACTGAGCGTGGTGGAGATTCGGCTCACAAAGAAGAGACCAG CCGAGGGGGATCGGACAGAAAGGTGTCTTCTAGCAAAGGAACACTGGACA AATATTTCTCCTCTGATGATATCATTCACGAATACCCTGATGAAAATATA CAAAACGGATCATTCTTAGAAATCGGGCAAGTCTGCGAGGAGGAGAGCTC CACCGATAATGACTTTATAGCGCCGCTTGAACGGCCTATCGGTGGTTTAA AACGCTCATGTACGAATGATGAACGTATGATGACCTTGAGAGAGATCCCG TTACAACGCTGCCAAAGTATTGATAGCACAAAAGGTCTTCAAAAACAAAT AGATGAACAGGCTCGCTTCTTTTCAGAGCAGACAAGCCTTCGACCTCGTC AACGCAAAACATCATCTAATGAGAAACCTCAACAAACAAACACTAATACA GCGNTGTGTACAACGAAAACATGAGAAATTTGACAAACCTGTCACTATCA CCGTCACCGTCGGTAAACAGTAAAGACAAAACAATCATCTCAAATAATGA TGTTACTTTTTCGATCGATGCAACTTCTTCATCAAATACTAAACTACCTC CAATTATGGATGATTTATGCCTTAGTAACAATAAAcggaattttgattgg ttgaactGTAAATCTACAAATAACATTGTTGTAAACCCATTATCAACTTC ATCCACACTATCATTAACCGCAGCAACAAATCATCATTCTCCTCTTaaac aacaatcgaacaatTTAATTAAAACTTTCAGTAACAGTAACAACAAGATA GACACTAAAGCGCATTTCTCATCGTCGTCAACTATAACACAATCACAGAT TGGGACAAAATGGAATAAAACTTTCATCAAATCCTCATCACAGTCTGCTA TCTCAACACCAAGAACAATTAATTTAATGTCACCATCAAACAGCGTGCCT TCTTTTAATTATCGAGGAGGTTTATCGAGCATGTCGATTACTGAGCGTGG TGGAGATTCGGCTCACAAAGAAGAGACCAGCCGAGGGGGATCGGACAGAA AGGTGTCTTCTAGCAAAGGAACACTGGACAAATATTTCTCCTCTGATGAT ATCATTCACGAATACCCTGATGAAAATATACAAAACGGATCATTCTTAGA AATCGGGCAAGTCTGCGAGGAGGAGAGCTCCACCGATAATGACTTTATAG CGCCGCTTGAACGGCCTATCGGTGGTTTAAAACGCTCATGTACGAATGAT GAACGTATGATGACCTTGAGAGAGATCCCGTTACAACGCTGCCAAAGTAT TGATAGCACAAAAGGTCTTCAAAAACAAATAGATGAACAGGCTCGCTTCT TTTCAGAGCAGACAAGCCTTCGACCTCGTCAACGCAAAACATCATCTAAT GAGAAACCTCAACAAACAAACACTAATACAGCGGTAACAAAAAGCCGTAA AAAATTACTAAGACGTTCTATGTCGActggtttttcgaaaataaaactCA TCAAATCAAGCATTTCATTCACAAAAAGTCATCAGCGTTTTACGGATGAG GAACTAAACAGCGTCGATATTAAAGACTCTGACCATCAGACGTCGCGTCG TAAAAACACGTCGTGCTCGTCTCCTCTTGACGAATATATTGAAGAAATGA GTAAGGGAGAGAATCCTGATCGGGATGTTGACTCGAACCCGGCTGCTGTA CCGTTCTTAAGAAGCATTAGTGCTCCTGAACAAATCGATAAACTTGATGG CGATGTTTATGATGAAGATTTATCGGAGCTCTATTTACCGAGGCGTCGTG CAATTTGTCCAAATCTGCCAGTCCCGGCAATGAAGCAACTGAAAACATAC CTGATTTTAACGAGACTTAAACAATACTGTTTTGTATGATGTTGAGGGTA AAGAAGATGAAGAATGTGTAAGGAGGTAAACTTTTCGAAGCCACACCTAT ATTCCTGGAGCttgattttatttgatttgcGATAAATGGCTCCAACTATA AAATACAATTATTAAGATCTGGGAGAAGACCGTGAGGCAGAAATATCAAT AAGCATAGATATGATGTGTTTTTAACTGTTACAATTTTCTTATCATATGA TAAaggaaagattttttgatttgttttaaacaaaagagGAGACAGTTCTA TGATATGAGGCTGGTTCTGGAAAATAGTGCGATGAAAAATACACTATtat aaaattttgttgaaaatgtgTATCAATCTTGAAAGACTTGAAGtaagaga agtaaaaaaatctGTTGTAAAAGCTAACCCAACCCCAAGTATCAAAGTAT GAACTGTaatataagatttttttatcaGATCGAGGTTTTGGTTTAGATAT ATATTACAAGACGGAGTTATCTTGATTATAGCTTTCTTATCTCTTGTAAA GCTTGGTTTCCACTGTGTGATAACATGTGATA

Coding sequence (CDS) from alignment at sc0000002:1485497..1490028+

>TCONS_00000486 ID=TCONS_00000486|Name=TCONS_00000486|organism=Clytia hemisphaerica|type=CDS|length=2076bp|location=Sequence derived from alignment at sc0000002:1485497..1490028+ (Clytia hemisphaerica)
ATGATGACTTTTTGTTCGACGACCAACAATCGAAAGAAGAACGCACAATT
CACAATCTCGACTAGTGCTAAAGAAAAGACTGTACCGAATAGTTACGATA
ATAGATCGTTTTTACGCGATTCTTTTACGAACATTTCTGATTACGACAAT
CAGCAACATCGTCAACAACGCTCGCCGATCCTTTCCAAAAATAACCGAAG
TTGTCAATCTGTGTACAACGAAAACATGAGAAATTTGACAAACCTGTCAC
TATCACCGTCACCGTCGGTAAACAGTAAAGACAAAACAATCATCTCAAAT
AATGATGTTACTTTTTCGATCGATGCAACTTCTTCATCAAATACTAAACT
ACCTCCAATTATGGATGATTTATGCCTTAGTAACAATAAAcggaattttg
attggttgaactGTAAATCTACAAATAACATTGTTGTAAACCCATTATCA
ACTTCATCCACACTATCATTAACCGCAGCAACAAATCATCATTCTCCTCT
TaaacaacaatcgaacaatTTAATTAAAACTTTCAGTAACAGTAACAACA
AGATAGACACTAAAGCGCATTTCTCATCGTCGTCAACTATAACACAATCA
CAGATTGGGACAAAATGGAATAAAACTTTCATCAAATCCTCATCACAGTC
TGCTATCTCAACACCAAGAACAATTAATTTAATGTCACCATCAAACAGCG
TGCCTTCTTTTAATTATCGAGGAGGTTTATCGAGCATGTCGATTACTGAG
CGTGGTGGAGATTCGGCTCACAAAGAAGAGACCAGCCGAGGGGGATCGGA
CAGAAAGGTGTCTTCTAGCAAAGGAACACTGGACAAATATTTCTCCTCTG
ATGATATCATTCACGAATACCCTGATGAAAATATACAAAACGGATCATTC
TTAGAAATCGGGCAAGTCTCCGAGGGGGATCGGACAGAAAGGTGTCTTCT
AGCAAAGGAACACTGGACAAATATTTCTCCTCTGATGATATCATTCACGA
ATACCCTGATGAAAATATACAAAACGGATCATTCTTAGATGATGACTTTT
TGTTCGACGACCAACAATCGAAAGAAGAACGCACAATTCACAATCTCGAC
TAGTGCTAAAGAAAAGACTGTACCGAATAGTTACGATAATAGATCGTTTT
TACGCGATTCTTTTACGAACATTTCTGATTACGACAATCAGCAACATCGT
CAACAACGCTCGCCGATCCTTTCCAAAAATAACCGAAGTTGTCAATCTGT
GTACAACGAAAACATGAGAAATTTGACAAACCTGTCACTATCACCGTCAC
CGTCGGTAAACAGTAAAGACAAAACAATCATCTCAAATAATGATGTTACT
TTTTCGATCGATGCAACTTCTTCATCAAATACTAAACTACCTCCAATTAT
GGATGATTTATGCCTTAGTAACAATAAAcggaattttgattggttgaact
GTAAATCTACAAATAACATTGTTGTAAACCCATTATCAACTTCATCCACA
CTATCATTAACCGCAGCAACAAATCATCATTCTCCTCTTaaacaacaatc
gaacaatTTAATTAAAACTTTCAGTAACAGTAACAACAAGATAGACACTA
AAGCGCATTTCTCATCGTCGTCAACTATAACACAATCACAGATTGGGACA
AAATGGAATAAAACTTTCATCAAATCCTCATCACAGTCTGCTATCTCAAC
ACCAAGAACAATTAATTTAATGTCACCATCAAACAGCGTGCCTTCTTTTA
ATTATCGAGGAGGTTTATCGAGCATGTCGATTACTGAGCGTGGTGGAGAT
TCGGCTCACAAAGAAGAGACCAGCCGAGGGGGATCGGACAGAAAGGTGTC
TTCTAGCAAAGGAACACTGGACAAATATTTCTCCTCTGATGATATCATTC
ACGAATACCCTGATGAAAATATACAAAACGGATCATTCTTAGAAATCGGG
CAAGTCTCCGAGGGGGATCGGACAGAAAGGTGTCTTCTAGCAAAGGAACA
CTGGACAAATATTTCTCCTCTGATGATATCATTCACGAATACCCTGATGA
AAATATACAAAACGGATCATTCTTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000305XLOC_000305Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000486-proteinTCONS_00000486-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000486-exon-sc0000002-1491911889:1485497..1487780TCONS_00000486-exon-sc0000002-1491911889:1485497..1487780Clytia hemisphaericaexon
TCONS_00000486-exon-sc0000002-1510915933:1485497..1487780TCONS_00000486-exon-sc0000002-1510915933:1485497..1487780Clytia hemisphaericaexon
TCONS_00000486-exon-sc0000002-1575043694:1485497..1487780TCONS_00000486-exon-sc0000002-1575043694:1485497..1487780Clytia hemisphaericaexon
TCONS_00000486-exon-sc0000002-1491911889:1488627..1490028TCONS_00000486-exon-sc0000002-1491911889:1488627..1490028Clytia hemisphaericaexon
TCONS_00000486-exon-sc0000002-1510915933:1488627..1490028TCONS_00000486-exon-sc0000002-1510915933:1488627..1490028Clytia hemisphaericaexon
TCONS_00000486-exon-sc0000002-1575043694:1488627..1490028TCONS_00000486-exon-sc0000002-1575043694:1488627..1490028Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1485497..1490028 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.0183355 0 2.46838 2.43981 0.932888 0.944268 0.509927 0.403128 3.333 3.34746 2.96257 2.72125 0.957433 0.7837 3.8686 4.54002 1.7576 1.82849 0.746746 1.37026 1.70707 2.11988 0.314201 0.106968 0 0
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000486 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top