Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000477 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000477
Unique NameTCONS_00000477
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length930

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000477 ID=TCONS_00000477|Name=TCONS_00000477|organism=Clytia hemisphaerica|type=transcript|length=930bp
TTTAACTGAACAATCAAGAATATTTTACTGGCCCCAAGGCGCCGTCGTAA
GCCAGTGGGGTCCCAAACTTGCAAAGTTTGCACTAAATATCATCTTTTCA
ATCCACATTGCATTTGTTTTTGGCGCGAAATAAAACATAAACCCAAAGCA
GCCAGCCAGAGACTCCATTTTTTATACTCTCAGACTGTATAAACTTTGCT
ATTATATTTCATTTGCCAGTATTTTCCTTTCACGTTTGGCTCAATTATTA
AGATGGCAATTGGTGCTGGAGcTCCAATTGATTCAACACTTGAGAAATAT
AAGATTGACTCAAATGAGGCACTCAATATTAAGTTAGtccACAATGAAGA
AGATGCAGTTAATGAGGAAACAACATTCCACTCTGAAATGAGTCACCAGG
TTTTTGGAGATGGgGAAGCTATATTTGGTTATAAAGATCTGAAAGTTAAG
TTGTATTACCATGCTGGCAGTCTGTTAACGTACATGAGCATGTCATTTGA
CTCCAAAATCCCTGAAAAATTTGGTATTAGTccTGATCCAGTTCTACCAA
AAATTGCAGAAATAATCCCAGAAGGTTTTGTTTCTAATTTTGATGAATTC
ACCAAGCGTTTACCAGAAGAAAATAAATTCACACCGATGGGATCGAAGGT
TCACTCTTACACACATGAAAATGAAGTCGGTGTAGAATATGAAGTCTATC
ATTGTGACATTTTTACACCACGATTAAAAGAATATCATGAACGGTTACAG
ACTTTCATCATGTGGTACATTGATGCAGCTTCCTTTATAGATGCTGATGA
TGAGAAAtggaatttctttttattgttcaaaaagaagaaagggcCAATGG
AACCTCAATACAGCATCATGGGATACATGACtgtttatcattatttttca
tatCCTGACAAAATCAGACCACGTATTAGG
Run BLAST on NCBI

protein sequence of TCONS_00000477-protein

>TCONS_00000477-protein ID=TCONS_00000477-protein|Name=TCONS_00000477-protein|organism=Clytia hemisphaerica|type=polypeptide|length=226bp
MAIGAGAPIDSTLEKYKIDSNEALNIKLVHNEEDAVNEETTFHSEMSHQV
FGDGEAIFGYKDLKVKLYYHAGSLLTYMSMSFDSKIPEKFGISPDPVLPK
IAEIIPEGFVSNFDEFTKRLPEENKFTPMGSKVHSYTHENEVGVEYEVYH
CDIFTPRLKEYHERLQTFIMWYIDAASFIDADDEKWNFFLLFKKKKGPME
PQYSIMGYMTVYHYFSYPDKIRPRIR
Run BLAST on NCBI

transcript from alignment at sc0000002:1382700..1393081+

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000477 ID=TCONS_00000477|Name=TCONS_00000477|organism=Clytia hemisphaerica|type=transcript|length=10382bp|location=Sequence derived from alignment at sc0000002:1382700..1393081+ (Clytia hemisphaerica)
TTTAACTGAACAATCAAGAATATTTTACTGGCCCCAAGGCGCCGTCGTAA GCCAGTGGGGTCCCAAACTTGCAAAGTTTGCACTAAATATCATCTTTTCA ATCCACATTGCATTTGTTTTTGGCGCGAAATAAAACATAAACCCAAAGCA GCCAGCCAGAGACTCCATTTTTTATACTCTCAGACTGTATAAACTTTGCT ATTATATTTCATTTGCCAGTATTTTCCTTTCACGTTTGGCTCAATTATTA AGATGGCAATTGGTGCTGGAGGTATATATTttattctttatattttttct acaGTTGACAGTTATTTTTAGTCggcagtcgggtgtttaagataaaaact gcaattattgctcttttcggaaattattgccgaaaacggcaattttttta acgatgaaatgctgaatcagtaGAAAAANNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNcattttgctgattcagcatttcatcgttaaaaaaattgccgttttc ggcaataatttccgaaaagagcaataattgcagttttcatcttaaacacc cgactggtcGGTGGtgtgttttttcagttttttttaggccagacgtccgc gctcgataggatcgatcatcggaacggctcgatggcggatcgatatgtga tcgatggattacttaacgatccggataggagattaatagaggatcgatac tcaagtttttttaagcttatgatgattagttatcgatcttatcgaccctt tCGAACTGCTGTTCCCCTCAGGCAAAATCGTCGATTCTGTAAAGGTCACG AAATTGCTGAGTACagacgtcgaaaaaaaaaaattcaaaatggctgccga gcgagcactgactaaaacaaaaaatcaggagtTTTCATTATTTGCCTACT ACAACGGAATAAGACAGAGAaatgcagtaaaataaaaagtaaacaaacca ggaccctgccgacgcaccggacttaacgaacaccggacacgcaaaagtcc ggtgtaaaatgagaattttttttaccaccggacaatctctacacNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNct tttttttacaataacatttgtcttctcacaaatccaaaaatataGGTTAT AAAACCAACACGGGGGTCAACATTCTTTACAACAAACCGTCAgatcaaac tttaaaaagatcaaCCATGTAAATGTCACTTGTTTTCCTGATATTTGGAT AATATTAAAACCTTTCTGTATATATTTGGTTCTTCAAAGCCATTTCCCTT TCCCGCagcaggctttaaagttcatgttGACCCCCAGTTTTTTTTGCGCG GTAATCTAGAAAGGCCTTTAGTGCggtataaacaaatgatttcattggtt taaaaaagtgaaaacatcAAGCTATATCACGTGATCAGAATCATGATCAA ACTAAACGGTTTAGTAAACTCGACCacgtatcaatgttttgatttttcaa gcagggatttctgtagaatgataaaatatggcTTGGCTGGAATGGATACC ATGTAATGACCTACTGTGAGAACGGGTATAATTTGCATAAGATAAGGGAA GGACGGGGAGTTTTCTGGCAGAGAGCAgtaaaaaacactatttttctttc cagaaAGTTCCGGAGCTCTTCTGGTGCTTCCGGAGCAAGTTATTTTTACC ACATTCTAAAAACTGTTTAAAcatgtttacaaaaaaatatttgtccccaG GTGGACTTTGGTCAAATAAAATACTTACAGTTACAGACANNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNTCCAGAGAGATAGTGCTTCGTTTTGTTAGGCCTTGCTTA CACTCTGTAGTAAGAATAATTCTGCACATGGAATAGGTCTATATTTGAGG TCAggcaaaatttccaggaaatagcctatccagcCATGCACAGATCNCAT TTTTTCAGAAGGTCTcatccccccttaagaaagggggaaCGAACTATGAG GTGACTGATGTTTTTCCTAATGTGACTAACAGGATATAAGGATTAGAGTT TCCTAAATAAAGTTCAAGAttccaagaaaattttttaattaaaacttgaa aacttgacATGAAACAAAATGACTGATTATCTACGTGCAGCAGCCAGCTA TAATCAACTGaccaaaatttgttatttaTATAATTCCAGAGAGATAGTGC TTCGTTTTGTTAGGCCTTGCTTACACTCTGTAGTAAGAATAATTCTGCAC ATGGAATAGGTCTAtatttgaggtccggcaaaatttccaggaaatagcct atccagcCATGCACAGATTTATGTGGGTGTCTTCTcccctgtagatcttt ttcttgggaagttgttcttcaaattaattttcaaggttggctctcttagt ttttgaaaatgttaatttcattaaaaagggtcaatttatttttatcatga atccctttagaagttttgtgctgcatttttttgcttttgagtCAAATGAA CAATACAGCACATTttcagcattaatctttgatacaacTATTGGTGGggc gctagtgtgactaactcgTAACTGATGTAGGTTTCTGAGTACAGTAATTT GGAATAAAATATTCCAGCTCtccgaagctcatttttcaactatccagagt cctggtctttttctgGTAGAAAAGTAGCAGTGGAATTTTAGTGTGGGAAA GGGAATGTTATGCAAAGAgcatctacaatcagtgacaaaataattggcac aaaagggaaattccccacaaaatttcatagccacaaacaatttggaagcg ctctaaattaggttggaagggtaataaatagtaataataataataaaata tgtTTTAAGTGGCATGCTCCAAAAAACTCTAGTATTTACACCCTGAGCAT CAGGCCCACCACCATTACCACAAAGAACAAAACTTTTAGAAAGATAAGAA GGACATATATTTTGAATAGCTTTAAAAGTCATAAGAGCTGTACTATAGTT TGCAACCTTATTAAATGATTTGTTCATCGGAGTAACATAGATCTATCTGT CTAGATAGTGATTCAAAACGTTTTCCAACATGTTATAGAGTGTTACTCCA AGTATTTACGCAATAACCCAAATGGGGATATACCAAGGTATTAACCAATA ACCGTTTCGTATCATTATTCAGAGTTGAGCTcacctttttgattttgttg agtCCTAAGTAGGCTTGTTGTCTAACAAGAGCGGCATGTTTTTCTCAGGT TAGACCTTCGTCAAAGATGACGCCGGGGTATTTGACATGTGACTTAGGTT CGATTGGacagttttgaaaagatatagGAGGCATATCCTTCTGTTTTCTG CCAAAGAAAATCACttcagtttttgtggtgtttaCAGATAATTTATTGCA ATAAAAGGGtggagttttaactctgagttttaacgctggacttaggattt gaggatccaaaagctcaaaaatggtccagtagggcttgaaatatagccta gaaaccaataaatcattcccagatcgaaataatcaatgaaatCAAGTCAA AGGcccaaaattgacattctcgctcaaacttcaattttcgaaaaaatggt gGAATaaccaaaattgccaatatgttatggcactgattgtagtaaCATGA AAGGCAAAATATATGATTCTTAAATGggaaatcaaaactataaaatgCAC TAAATAACATTAATTTGTCAGATGTAACAAAATCAGTAGTAACAGCACTG TCAtcaaaaggattttctgtcaaaaatGAGCTGCAATCAATATgattata atatatttttaagAGAAAAGAATGGGTGAGGGAGTAGGAAATGTGTAACA CTCAAAGATGAAGGCTGTTTTGATAGGAGAATATTTCTAGAATCCAATAG AAATTAATTATACCACGATTCATTTTGTTTATACTTACATGCGaataaat ttcaaacttttctctttttcagcTCCAATTGATTCAACACTTGAGAAATA TAAGATTGACTCAAATGAGGCACTCAATATTAAGTTAGGTAGGTTGTAAT AATCAGTCAGTCAGGCTGAATCATTTGAGACGTGTGATACATGCGCACGC CTCCACACACGCCTAAAATCTCTGAGGAGCGcgatttttagtttttatta ttAAAAGTGGTGGCTAGCACGCATTATCACACGTCTAAATCATCAAAATT CAGAttttaggagtgtgattgaccacaTGTCTGAATTCTTCAAATGGCAA AGCCAGCAAGATTACAGTAAGAAGTATAAGAAAGCTTGAATTTGGCCATT ATTCCATCCATCATCTCTAATTTGTCTAATCTCTACTTTTGTATACCCCT ATGAAACTCCCCCATATTTTCAAACTTAACCctgaaaaggtttttttatg gaaaagttcattgattattttattaaaataaattttagtccACAATGAAG AAGATGCAGTTAATGAGGAAACAACATTCCACTCTGAAATGAGTCACCAG GTTTTTGGAGATGGGTAGGACAAAATTATTTCACAAATCCTTTCTCTGTT CCTCTTCTGAAAGAAATTTGCAAATTGTAGCCTTCTAACTgtaaaatgac taaaatttgtcTAGTTGTCGAGGTAAATaataaatgatttttatttttac cttATCATTATCAGTAACATAGGGGATATTCTGGTTCACTTAACCTAAAT CTCTGTGGTAACTTCTTCCTAAtattaagcaaaaaatagttgaGTAACAA ATTAAAAGGTCCTACATATCCTTTTCCTAAACAAAAGAATGAGATATCTA TGAGAATTGTATTGTATTTAGTAGAtgcatttgatttttgatttttattt aggGAAGCTATATTTGGTTATAAAGATCTGAAAGTTAAGGTAAAAGTGGa ttgtgttaaaaaaaattaatttattgttctacaggaaacccttcagaaaa atattggtTAGTCGGTataataaaaatcttaaaatctagggtcggaCAGT CAAGATCTAAAGAATTTCTGACGTGATGAATTTGCACTCATTCATTCAAC ATGTTCAGttaaaaatatctgaaaaaaaattactattattttttcgattt tggaaaaaacatGATTGGTAGCACACTATTTTATCATTGTAGATCTATCT AAGTTGAGTCATTAAAGGAAAAATcgctttgaattttgaatttatattct tttatatCATCTGTTTTATTTCTAGTTGTATTACCATGCTGGCAGTCTGT TAACGTACATGAGCATGTCATTTGACTCCAAAATCCCTGAAAAATTTGGT ATTAGTGTAAGaaagttttgcattttttgataaaaatttaatgTCACAAG TTTACTGctacaaaattaaaaagtctaGTTACTAGAAATATAATTGACTT AATAACCCTTTTTAATTGTAGTGCAACCTTACCTAAGCCTTATCCTTTTg tataatttgaatttgaagaaactGCAATATTATTCACCTGAATGTGTAAT AATCTGTAATAATCGTCCTAAAAGTATCTAGAAACTCGTTTATAGCTCGT CTACGTCGTCTACGCCTAACTGTTTTACTGGTTAATATAAAAGGACTTAA TATCATGTCTTAGTATAGTagaaacttacttacttacgatactaaaatga tttaaattttcttttttatagccTGATCCAGTTCTACCAAAAATTGCAGA AATAATCCCAGAAGGTATGTAAAAGAACGGCAATTTTTCTTGGATCtaga ttttaaacatttttaagtTGCTATTCTGAATCAATGTTGCAGTGGATCta gattttaaacatttttaagtTGCTATTCTGAATCAATGTTGCAGATTCTT CACTCTAGACGGATTTTTGTCCCGTTctatttctgttgtttttttggCTG CACTTTAGTTAACTATATTTCAAGACTGGCTTCAAAGCAATTTAAAGATA TGTCGTTATATAGTTGCTATCCGAAATCAGTGTTGCAAGTTCTACACGTC GATGGATTTTGTCCCGTTGTATTTTTAAAACAATGCATTTTCATCTCCGA ATGTTGATCAGTAATTTAGGCCTCGTTTTTTGTCAAGTATGATTTTCTTC NGAATGTTGGTCAGTAATTTAGGCCTCGTTTTTTGTCATGTATGATTTTC TTTCATCTTCAATATTCCACTTTTCTTTGCAACAAGTGCAGTGCTTAAGG CTAATTAAGATTGTAGTAGTAAAACTAAGCAATTATGTAAAAACATATTT CCATTATTGTCTTATTATTGCAGGTTTTGTTTCTAATTTTGATGAATTCA CCAAGCGTTTACCAGAAGAAAATAAATTCACACCGATGGGATCGAAGGTT CACTCTTACACACATGAAAATGAAGTCGGTGTAGAATATGAAGTCTATCA TGTATGTGAATGAGTTTGTTTAATGCTTTTTTGTTATCGATTTCTCGAAA ATATAAAATATGCTTAATGTAGGCTCTTCTAGTTTCATCAAGAGTATCAA GACCACTCAAATTTTGTTGCCTATTTTTAATTTGGaatgaattcttttca aaatgaCCATATATTTTGGTGATTGCTGTATTAAGGTTTTTGTGAAAAGA AAGTGAGAAATAAGAGTTCTTTGGGCAAACTAACCAACGGGAGTGGAGGA TGTGTTGTCATTTTTAACGGTGTTTTTTAATATTCTAGTGTGACATTTTT ACACCACGATTAAAAGAATATCATGAACGGTTACAGACTTTCATCATGTG GTACATTGATGCAGCTTCCTTTATAGGTGATTTACAATATATTGATCAGT GTAGTCTGCACCTCCTTTTTAATAAAATGCAAGTACCaagatttgccaaa aaaaacaaacaggaaggatgataccgggtgcgccacaaaaaagtttctct ctttaaaactaattttcttgaaatctaaaagttttaaaagaatcatccct atttcattggaaagaagaaagataaacttaaattttgatgggtcatttat ttaACTCGATtgattagatcaaaagttatgctcaattgaataaaaaagtt actttcggaaaatgctcaaaaacggtAAAAAATCGACCTATAGAATTAAA CATAAGCATGATTTcatgatatatcagtattttcgttacagtcattaaaa atgataattagctgtctaaatgacctttagttatttaaaggaaggttgaa tttcaatgaaaggaagaaaatccgtcgaaaaaggccaaataatctggtaa aattcctaaaaatacatcaaatatgggttttgaggtagatccagccttac atagactttatccagtctagaacaaaaaatttgaggaaaatttcggtaaa actaaattaaattgattttgatgaagattttaaacacTTTCgccccttca gtttcaaaatttatgtgttttgttactgaaaaatgctcttaatcatgtaa aggctaatgcaattgccaaatttaaagtaaaaatttgataggtcgNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNtcagaaagtaacttttttattcaattgagcataacttt tgatctaatgaatcgaatttaataaatgacccatcaaaatttaagtctat ctttcttctttccaatgattTAGGAGTGGTTCTtctaaaacttttagatt ttgagaaaattagtctcaaagagagaaacttttttgtggcgcacccggta ttttaGGGGGGAGGCGTCAAATAGAAAGGGTGGGGTCATTAGATTTTAAT GTGATAATGTTTGATCAAAGTGTTTTTGTCAATAAAGACGCAAGTTATAA TATTGTGAAATTTTACCTGTGACTGTTAATACTTTGCACTATTTGATCAT TTTGGTGGTCCATTTAGAGCAAGTTTCCTTTGGAGTGGATTTTCTGTGAA AGAAGCGGAGGTATTCTATCTCATTATAAAAGTTGGGATTATACTAGAGG GAGGGACTGAAATAAACATACCCTTTTGCAAACTATACCCCAAAACCTGG ATTAAATGAATTCtgttttataagcaagtgtcagctgctatatcaggctc gcattatgtttagcattctattgttcttagacaatagaaacaaaaactga gcctgtatttatgcttataaacgttatgcttatagaagaaaaaacatgta agttttcttattatttgtCAGATGCTGATGATGAGAAAtggaatttcttt ttattgtaAGTTGTTCCTTCCAATAGTTATTATTTTTCATACTATATGAG TACGTACCTTTGAGGAGGGAATTAAATTTCACTGTTCTGCGGTTTTTTAg caaaccgcgaaaattagaacCCGCGAATCACAAATTtggccatttttcat caaaaatttgaaaaatccctaaaaaattgaaataaatgtGTCTAAAATAA GGCAATCGCGAAAGTTAGCTCcagctaaaattagttccctttcCTACAGA AGAGTCCCGCAGAAGAGCTATATTGGAATTGAGATCCTTTTTGCCAACAA TTACCCATTAATTCGTCAATCTTTTACCTCCTCTTTTGTCTCTAATTTCT ATACCTATAAGTATAACATGTTTCAggttcaaaaagaagaaagggcCAAT GGAACCTCAATACAGCATCATGGGATACATGACtgtttatcattattttt catatCCTGACAAAATCAGACCACGTATTAGG

Coding sequence (CDS) from alignment at sc0000002:1382700..1393081+

>TCONS_00000477 ID=TCONS_00000477|Name=TCONS_00000477|organism=Clytia hemisphaerica|type=CDS|length=6780bp|location=Sequence derived from alignment at sc0000002:1382700..1393081+ (Clytia hemisphaerica)
ATGGCAATTGGTGCTGGAGcTCCAATTGATTCAACACTTGAGAAATATAA
GATTGACTCAAATGAGGCACTCAATATTAAGTTAGtccACAATGAAGAAG
ATGCAGTTAATGAGGAAACAACATTCCACTCTGAAATGAGTCACCAGGTT
TTTGGAGATGGgGAAGCTATATTTGGTTATAAAGATCTGAAAGTTAAGTT
GTATTACCATGCTGGCAGTCTGTTAACGTACATGAGCATGTCATTTGACT
CCAAAATCCCTGAAAAATTTGGTATTAGTccTGATCCAGTTCTACCAAAA
ATTGCAGAAATAATCCCAGAAGGTTTTGTTTCTAATTTTGATGAATTCAC
CAAGCGTTTACCAGAAGAAAATAAATTCACACCGATGGGATCGAAGGTTC
ACTCTTACACACATGAAAATGAAGTCGGTGTAGAATATGAAGTCTATCAT
TGTGACATTTTTACACCACGATTAAAAGAATATCATGAACGGTTACAGAC
TTTCATCATGTGGTACATTGATGCAGCTTCCTTTATAGATGCTGATGATG
AGAAAtggaatttctttttattgttcaaaaagaagaaagggcCAATGGAA
CCTCAATACAGCATCATGGGATACATGACtgtttatcattatttttcata
tCCTGACAAAATCAGACCACGTATTAGGATGGCAATTGGTGCTGGAGcTC
CAATTGATTCAACACTTGAGAAATATAAGATTGACTCAAATGAGGCACTC
AATATTAAGTTAGtccACAATGAAGAAGATGCAGTTAATGAGGAAACAAC
ATTCCACTCTGAAATGAGTCACCAGGTTTTTGGAGATGGgGAAGCTATAT
TTGGTTATAAAGATCTGAAAGTTAAGTTGTATTACCATGCTGGCAGTCTG
TTAACGTACATGAGCATGTCATTTGACTCCAAAATCCCTGAAAAATTTGG
TATTAGTccTGATCCAGTTCTACCAAAAATTGCAGAAATAATCCCAGAAG
GTTTTGTTTCTAATTTTGATGAATTCACCAAGCGTTTACCAGAAGAAAAT
AAATTCACACCGATGGGATCGAAGGTTCACTCTTACACACATGAAAATGA
AGTCGGTGTAGAATATGAAGTCTATCATTGTGACATTTTTACACCACGAT
TAAAAGAATATCATGAACGGTTACAGACTTTCATCATGTGGTACATTGAT
GCAGCTTCCTTTATAGATGCTGATGATGAGAAAtggaatttctttttatt
gttcaaaaagaagaaagggcCAATGGAACCTCAATACAGCATCATGGGAT
ACATGACtgtttatcattatttttcatatCCTGACAAAATCAGACCACGT
ATTAGGATGGCAATTGGTGCTGGAGcTCCAATTGATTCAACACTTGAGAA
ATATAAGATTGACTCAAATGAGGCACTCAATATTAAGTTAGtccACAATG
AAGAAGATGCAGTTAATGAGGAAACAACATTCCACTCTGAAATGAGTCAC
CAGGTTTTTGGAGATGGgGAAGCTATATTTGGTTATAAAGATCTGAAAGT
TAAGTTGTATTACCATGCTGGCAGTCTGTTAACGTACATGAGCATGTCAT
TTGACTCCAAAATCCCTGAAAAATTTGGTATTAGTccTGATCCAGTTCTA
CCAAAAATTGCAGAAATAATCCCAGAAGGTTTTGTTTCTAATTTTGATGA
ATTCACCAAGCGTTTACCAGAAGAAAATAAATTCACACCGATGGGATCGA
AGGTTCACTCTTACACACATGAAAATGAAGTCGGTGTAGAATATGAAGTC
TATCATTGTGACATTTTTACACCACGATTAAAAGAATATCATGAACGGTT
ACAGACTTTCATCATGTGGTACATTGATGCAGCTTCCTTTATAGATGCTG
ATGATGAGAAAtggaatttctttttattgttcaaaaagaagaaagggcCA
ATGGAACCTCAATACAGCATCATGGGATACATGACtgtttatcattattt
ttcatatCCTGACAAAATCAGACCACGTATTAGGATGGCAATTGGTGCTG
GAGcTCCAATTGATTCAACACTTGAGAAATATAAGATTGACTCAAATGAG
GCACTCAATATTAAGTTAGtccACAATGAAGAAGATGCAGTTAATGAGGA
AACAACATTCCACTCTGAAATGAGTCACCAGGTTTTTGGAGATGGgGAAG
CTATATTTGGTTATAAAGATCTGAAAGTTAAGTTGTATTACCATGCTGGC
AGTCTGTTAACGTACATGAGCATGTCATTTGACTCCAAAATCCCTGAAAA
ATTTGGTATTAGTccTGATCCAGTTCTACCAAAAATTGCAGAAATAATCC
CAGAAGGTTTTGTTTCTAATTTTGATGAATTCACCAAGCGTTTACCAGAA
GAAAATAAATTCACACCGATGGGATCGAAGGTTCACTCTTACACACATGA
AAATGAAGTCGGTGTAGAATATGAAGTCTATCATTGTGACATTTTTACAC
CACGATTAAAAGAATATCATGAACGGTTACAGACTTTCATCATGTGGTAC
ATTGATGCAGCTTCCTTTATAGATGCTGATGATGAGAAAtggaatttctt
tttattgttcaaaaagaagaaagggcCAATGGAACCTCAATACAGCATCA
TGGGATACATGACtgtttatcattatttttcatatCCTGACAAAATCAGA
CCACGTATTAGGATGGCAATTGGTGCTGGAGcTCCAATTGATTCAACACT
TGAGAAATATAAGATTGACTCAAATGAGGCACTCAATATTAAGTTAGtcc
ACAATGAAGAAGATGCAGTTAATGAGGAAACAACATTCCACTCTGAAATG
AGTCACCAGGTTTTTGGAGATGGgGAAGCTATATTTGGTTATAAAGATCT
GAAAGTTAAGTTGTATTACCATGCTGGCAGTCTGTTAACGTACATGAGCA
TGTCATTTGACTCCAAAATCCCTGAAAAATTTGGTATTAGTccTGATCCA
GTTCTACCAAAAATTGCAGAAATAATCCCAGAAGGTTTTGTTTCTAATTT
TGATGAATTCACCAAGCGTTTACCAGAAGAAAATAAATTCACACCGATGG
GATCGAAGGTTCACTCTTACACACATGAAAATGAAGTCGGTGTAGAATAT
GAAGTCTATCATTGTGACATTTTTACACCACGATTAAAAGAATATCATGA
ACGGTTACAGACTTTCATCATGTGGTACATTGATGCAGCTTCCTTTATAG
ATGCTGATGATGAGAAAtggaatttctttttattgttcaaaaagaagaaa
gggcCAATGGAACCTCAATACAGCATCATGGGATACATGACtgtttatca
ttatttttcatatCCTGACAAAATCAGACCACGTATTAGGATGGCAATTG
GTGCTGGAGcTCCAATTGATTCAACACTTGAGAAATATAAGATTGACTCA
AATGAGGCACTCAATATTAAGTTAGtccACAATGAAGAAGATGCAGTTAA
TGAGGAAACAACATTCCACTCTGAAATGAGTCACCAGGTTTTTGGAGATG
GgGAAGCTATATTTGGTTATAAAGATCTGAAAGTTAAGTTGTATTACCAT
GCTGGCAGTCTGTTAACGTACATGAGCATGTCATTTGACTCCAAAATCCC
TGAAAAATTTGGTATTAGTccTGATCCAGTTCTACCAAAAATTGCAGAAA
TAATCCCAGAAGGTTTTGTTTCTAATTTTGATGAATTCACCAAGCGTTTA
CCAGAAGAAAATAAATTCACACCGATGGGATCGAAGGTTCACTCTTACAC
ACATGAAAATGAAGTCGGTGTAGAATATGAAGTCTATCATTGTGACATTT
TTACACCACGATTAAAAGAATATCATGAACGGTTACAGACTTTCATCATG
TGGTACATTGATGCAGCTTCCTTTATAGATGCTGATGATGAGAAAtggaa
tttctttttattgttcaaaaagaagaaagggcCAATGGAACCTCAATACA
GCATCATGGGATACATGACtgtttatcattatttttcatatCCTGACAAA
ATCAGACCACGTATTAGGATGGCAATTGGTGCTGGAGcTCCAATTGATTC
AACACTTGAGAAATATAAGATTGACTCAAATGAGGCACTCAATATTAAGT
TAGtccACAATGAAGAAGATGCAGTTAATGAGGAAACAACATTCCACTCT
GAAATGAGTCACCAGGTTTTTGGAGATGGgGAAGCTATATTTGGTTATAA
AGATCTGAAAGTTAAGTTGTATTACCATGCTGGCAGTCTGTTAACGTACA
TGAGCATGTCATTTGACTCCAAAATCCCTGAAAAATTTGGTATTAGTccT
GATCCAGTTCTACCAAAAATTGCAGAAATAATCCCAGAAGGTTTTGTTTC
TAATTTTGATGAATTCACCAAGCGTTTACCAGAAGAAAATAAATTCACAC
CGATGGGATCGAAGGTTCACTCTTACACACATGAAAATGAAGTCGGTGTA
GAATATGAAGTCTATCATTGTGACATTTTTACACCACGATTAAAAGAATA
TCATGAACGGTTACAGACTTTCATCATGTGGTACATTGATGCAGCTTCCT
TTATAGATGCTGATGATGAGAAAtggaatttctttttattgttcaaaaag
aagaaagggcCAATGGAACCTCAATACAGCATCATGGGATACATGACtgt
ttatcattatttttcatatCCTGACAAAATCAGACCACGTATTAGGATGG
CAATTGGTGCTGGAGcTCCAATTGATTCAACACTTGAGAAATATAAGATT
GACTCAAATGAGGCACTCAATATTAAGTTAGtccACAATGAAGAAGATGC
AGTTAATGAGGAAACAACATTCCACTCTGAAATGAGTCACCAGGTTTTTG
GAGATGGgGAAGCTATATTTGGTTATAAAGATCTGAAAGTTAAGTTGTAT
TACCATGCTGGCAGTCTGTTAACGTACATGAGCATGTCATTTGACTCCAA
AATCCCTGAAAAATTTGGTATTAGTccTGATCCAGTTCTACCAAAAATTG
CAGAAATAATCCCAGAAGGTTTTGTTTCTAATTTTGATGAATTCACCAAG
CGTTTACCAGAAGAAAATAAATTCACACCGATGGGATCGAAGGTTCACTC
TTACACACATGAAAATGAAGTCGGTGTAGAATATGAAGTCTATCATTGTG
ACATTTTTACACCACGATTAAAAGAATATCATGAACGGTTACAGACTTTC
ATCATGTGGTACATTGATGCAGCTTCCTTTATAGATGCTGATGATGAGAA
AtggaatttctttttattgttcaaaaagaagaaagggcCAATGGAACCTC
AATACAGCATCATGGGATACATGACtgtttatcattatttttcatatCCT
GACAAAATCAGACCACGTATTAGGATGGCAATTGGTGCTGGAGcTCCAAT
TGATTCAACACTTGAGAAATATAAGATTGACTCAAATGAGGCACTCAATA
TTAAGTTAGtccACAATGAAGAAGATGCAGTTAATGAGGAAACAACATTC
CACTCTGAAATGAGTCACCAGGTTTTTGGAGATGGgGAAGCTATATTTGG
TTATAAAGATCTGAAAGTTAAGTTGTATTACCATGCTGGCAGTCTGTTAA
CGTACATGAGCATGTCATTTGACTCCAAAATCCCTGAAAAATTTGGTATT
AGTccTGATCCAGTTCTACCAAAAATTGCAGAAATAATCCCAGAAGGTTT
TGTTTCTAATTTTGATGAATTCACCAAGCGTTTACCAGAAGAAAATAAAT
TCACACCGATGGGATCGAAGGTTCACTCTTACACACATGAAAATGAAGTC
GGTGTAGAATATGAAGTCTATCATTGTGACATTTTTACACCACGATTAAA
AGAATATCATGAACGGTTACAGACTTTCATCATGTGGTACATTGATGCAG
CTTCCTTTATAGATGCTGATGATGAGAAAtggaatttctttttattgttc
aaaaagaagaaagggcCAATGGAACCTCAATACAGCATCATGGGATACAT
GACtgtttatcattatttttcatatCCTGACAAAATCAGACCACGTATTA
GGATGGCAATTGGTGCTGGAGcTCCAATTGATTCAACACTTGAGAAATAT
AAGATTGACTCAAATGAGGCACTCAATATTAAGTTAGtccACAATGAAGA
AGATGCAGTTAATGAGGAAACAACATTCCACTCTGAAATGAGTCACCAGG
TTTTTGGAGATGGgGAAGCTATATTTGGTTATAAAGATCTGAAAGTTAAG
TTGTATTACCATGCTGGCAGTCTGTTAACGTACATGAGCATGTCATTTGA
CTCCAAAATCCCTGAAAAATTTGGTATTAGTccTGATCCAGTTCTACCAA
AAATTGCAGAAATAATCCCAGAAGGTTTTGTTTCTAATTTTGATGAATTC
ACCAAGCGTTTACCAGAAGAAAATAAATTCACACCGATGGGATCGAAGGT
TCACTCTTACACACATGAAAATGAAGTCGGTGTAGAATATGAAGTCTATC
ATTGTGACATTTTTACACCACGATTAAAAGAATATCATGAACGGTTACAG
ACTTTCATCATGTGGTACATTGATGCAGCTTCCTTTATAGATGCTGATGA
TGAGAAAtggaatttctttttattgttcaaaaagaagaaagggcCAATGG
AACCTCAATACAGCATCATGGGATACATGACtgtttatcattatttttca
tatCCTGACAAAATCAGACCACGTATTAGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000301XLOC_000301Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000477-proteinTCONS_00000477-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000477-exon-sc0000002-1491911889:1382700..1382970TCONS_00000477-exon-sc0000002-1491911889:1382700..1382970Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1382700..1382970TCONS_00000477-exon-sc0000002-1510915933:1382700..1382970Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1382700..1382970TCONS_00000477-exon-sc0000002-1575043694:1382700..1382970Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1388222..1388287TCONS_00000477-exon-sc0000002-1491911889:1388222..1388287Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1388222..1388287TCONS_00000477-exon-sc0000002-1510915933:1388222..1388287Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1388222..1388287TCONS_00000477-exon-sc0000002-1575043694:1388222..1388287Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1388688..1388763TCONS_00000477-exon-sc0000002-1491911889:1388688..1388763Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1388688..1388763TCONS_00000477-exon-sc0000002-1510915933:1388688..1388763Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1388688..1388763TCONS_00000477-exon-sc0000002-1575043694:1388688..1388763Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1389102..1389138TCONS_00000477-exon-sc0000002-1491911889:1389102..1389138Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1389102..1389138TCONS_00000477-exon-sc0000002-1510915933:1389102..1389138Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1389102..1389138TCONS_00000477-exon-sc0000002-1575043694:1389102..1389138Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1389475..1389555TCONS_00000477-exon-sc0000002-1491911889:1389475..1389555Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1389475..1389555TCONS_00000477-exon-sc0000002-1510915933:1389475..1389555Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1389475..1389555TCONS_00000477-exon-sc0000002-1575043694:1389475..1389555Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1389921..1389963TCONS_00000477-exon-sc0000002-1491911889:1389921..1389963Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1389921..1389963TCONS_00000477-exon-sc0000002-1510915933:1389921..1389963Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1389921..1389963TCONS_00000477-exon-sc0000002-1575043694:1389921..1389963Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1390523..1390650TCONS_00000477-exon-sc0000002-1491911889:1390523..1390650Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1390523..1390650TCONS_00000477-exon-sc0000002-1510915933:1390523..1390650Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1390523..1390650TCONS_00000477-exon-sc0000002-1575043694:1390523..1390650Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1390938..1391025TCONS_00000477-exon-sc0000002-1491911889:1390938..1391025Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1390938..1391025TCONS_00000477-exon-sc0000002-1510915933:1390938..1391025Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1390938..1391025TCONS_00000477-exon-sc0000002-1575043694:1390938..1391025Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1392571..1392604TCONS_00000477-exon-sc0000002-1491911889:1392571..1392604Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1392571..1392604TCONS_00000477-exon-sc0000002-1510915933:1392571..1392604Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1392571..1392604TCONS_00000477-exon-sc0000002-1575043694:1392571..1392604Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1491911889:1392976..1393081TCONS_00000477-exon-sc0000002-1491911889:1392976..1393081Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1510915933:1392976..1393081TCONS_00000477-exon-sc0000002-1510915933:1392976..1393081Clytia hemisphaericaexon
TCONS_00000477-exon-sc0000002-1575043694:1392976..1393081TCONS_00000477-exon-sc0000002-1575043694:1392976..1393081Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000002supercontigsc0000002:1382700..1393081 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
111.108 113.05 46.9668 34.9937 6.90117 6.08264 13.0321 10.8975 17.5398 14.9462 14.3077 12.7152 8.50865 8.90429 12.7131 12.4737 17.4352 18.9685 3.13844 3.99572 12.7978 9.95522 44.571 43.8043 15.4265 19.2844 14.8438 9.21696 22.1738 21.8682
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR019467Hat1_N
IPR016181Acyl_CoA_acyltransferase
Vocabulary: Biological Process
TermDefinition
GO:0006325chromatin organization
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006325 chromatin organization
Blast
BLAST of TCONS_00000477 vs. Swiss-Prot (Human)
Match: HAT1 (Histone acetyltransferase type B catalytic subunit OS=Homo sapiens GN=HAT1 PE=1 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 2.004e-57
Identity = 102/235 (43.40%), Postives = 150/235 (63.83%), Query Frame = 1
Query:  235 FGSIIKMAIGAGAPIDSTLEKYKIDSNEALNIKLVHNEEDAVNEETTFHSEMSHQVFGDGEAIFGYKDLKVKLYYHAGSLLTYMSMSFDSKIPEKF-GISPDPVLPKIAEIIPEGFVSNFDEFTKRLPEENKFTPMGSKVHSYTHENEVGVE---YEVYHCDIFTPRLKEYHERLQTFIMWYIDAASFIDADDEKWNXXXXXXXXXGPMEPQYSIMGYMTVYHYFSYPDKIRPRI 927
            FG++ K  +   + ++  L +YK ++N A+ +KLV   ED  N+  TF  E +HQ+FGD E  FGYK LK+ LYY AGSL T   + + SK+ E F  +  D V  KI +IIP GF +N ++F   L +E  F P G+ +H+Y+  +  G E   +++Y  D+     +EYHERLQTF+MW+I+ ASFID DDE+W++FL+F+K        ++ +GYMTVY+Y+ YPDK RPR+
Sbjct:    4 FGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRV 238          
The following BLAST results are available for this feature:
BLAST of TCONS_00000477 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
HAT12.004e-5743.40Histone acetyltransferase type B catalytic subunit... [more]
back to top